WorldWideScience

Sample records for sub-antarctic sea spiders

  1. Genetic signature of Last Glacial Maximum regional refugia in a circum-Antarctic sea spider

    Science.gov (United States)

    Soler-Membrives, Anna; Linse, Katrin; Miller, Karen J.; Arango, Claudia P.

    2017-10-01

    The evolutionary history of Antarctic organisms is becoming increasingly important to understand and manage population trajectories under rapid environmental change. The Antarctic sea spider Nymphon australe, with an apparently large population size compared with other sea spider species, is an ideal target to look for molecular signatures of past climatic events. We analysed mitochondrial DNA of specimens collected from the Antarctic continent and two Antarctic islands (AI) to infer past population processes and understand current genetic structure. Demographic history analyses suggest populations survived in refugia during the Last Glacial Maximum. The high genetic diversity found in the Antarctic Peninsula and East Antarctic (EA) seems related to multiple demographic contraction-expansion events associated with deep-sea refugia, while the low genetic diversity in the Weddell Sea points to a more recent expansion from a shelf refugium. We suggest the genetic structure of N. australe from AI reflects recent colonization from the continent. At a local level, EA populations reveal generally low genetic differentiation, geographically and bathymetrically, suggesting limited restrictions to dispersal. Results highlight regional differences in demographic histories and how these relate to the variation in intensity of glaciation-deglaciation events around Antarctica, critical for the study of local evolutionary processes. These are valuable data for understanding the remarkable success of Antarctic pycnogonids, and how environmental changes have shaped the evolution and diversification of Southern Ocean benthic biodiversity.

  2. Air-sea interaction regimes in the sub-Antarctic Southern Ocean and Antarctic marginal ice zone revealed by icebreaker measurements

    Science.gov (United States)

    Yu, Lisan; Jin, Xiangze; Schulz, Eric W.; Josey, Simon A.

    2017-08-01

    This study analyzed shipboard air-sea measurements acquired by the icebreaker Aurora Australis during its off-winter operation in December 2010 to May 2012. Mean conditions over 7 months (October-April) were compiled from a total of 22 ship tracks. The icebreaker traversed the water between Hobart, Tasmania, and the Antarctic continent, providing valuable in situ insight into two dynamically important, yet poorly sampled, regimes: the sub-Antarctic Southern Ocean and the Antarctic marginal ice zone (MIZ) in the Indian Ocean sector. The transition from the open water to the ice-covered surface creates sharp changes in albedo, surface roughness, and air temperature, leading to consequential effects on air-sea variables and fluxes. Major effort was made to estimate the air-sea fluxes in the MIZ using the bulk flux algorithms that are tuned specifically for the sea-ice effects, while computing the fluxes over the sub-Antarctic section using the COARE3.0 algorithm. The study evidenced strong sea-ice modulations on winds, with the southerly airflow showing deceleration (convergence) in the MIZ and acceleration (divergence) when moving away from the MIZ. Marked seasonal variations in heat exchanges between the atmosphere and the ice margin were noted. The monotonic increase in turbulent latent and sensible heat fluxes after summer turned the MIZ quickly into a heat loss regime, while at the same time the sub-Antarctic surface water continued to receive heat from the atmosphere. The drastic increase in turbulent heat loss in the MIZ contrasted sharply to the nonsignificant and seasonally invariant turbulent heat loss over the sub-Antarctic open water.Plain Language SummaryThe icebreaker Aurora Australis is a research and supply vessel that is regularly chartered by the Australian Antarctic Division during the southern summer to operate in waters between Hobart, Tasmania, and Antarctica. The vessel serves as the main lifeline to three permanent research stations on the

  3. A multivariate analysis of Antarctic sea ice since 1979

    Energy Technology Data Exchange (ETDEWEB)

    Magalhaes Neto, Newton de; Evangelista, Heitor [Universidade do Estado do Rio de Janeiro (Uerj), LARAMG - Laboratorio de Radioecologia e Mudancas Globais, Maracana, Rio de Janeiro, RJ (Brazil); Tanizaki-Fonseca, Kenny [Universidade do Estado do Rio de Janeiro (Uerj), LARAMG - Laboratorio de Radioecologia e Mudancas Globais, Maracana, Rio de Janeiro, RJ (Brazil); Universidade Federal Fluminense (UFF), Dept. Analise Geoambiental, Inst. de Geociencias, Niteroi, RJ (Brazil); Penello Meirelles, Margareth Simoes [Universidade do Estado do Rio de Janeiro (UERJ)/Geomatica, Maracana, Rio de Janeiro, RJ (Brazil); Garcia, Carlos Eiras [Universidade Federal do Rio Grande (FURG), Laboratorio de Oceanografia Fisica, Rio Grande, RS (Brazil)

    2012-03-15

    Recent satellite observations have shown an increase in the total extent of Antarctic sea ice, during periods when the atmosphere and oceans tend to be warmer surrounding a significant part of the continent. Despite an increase in total sea ice, regional analyses depict negative trends in the Bellingshausen-Amundsen Sea and positive trends in the Ross Sea. Although several climate parameters are believed to drive the formation of Antarctic sea ice and the local atmosphere, a descriptive mechanism that could trigger such differences in trends are still unknown. In this study we employed a multivariate analysis in order to identify the response of the Antarctic sea ice with respect to commonly utilized climate forcings/parameters, as follows: (1) The global air surface temperature, (2) The global sea surface temperature, (3) The atmospheric CO{sub 2} concentration, (4) The South Annular Mode, (5) The Nino 3, (6) The Nino (3 + 4, 7) The Nino 4, (8) The Southern Oscillation Index, (9) The Multivariate ENSO Index, (10) the Total Solar Irradiance, (11) The maximum O{sub 3} depletion area, and (12) The minimum O{sub 3} concentration over Antarctica. Our results indicate that western Antarctic sea ice is simultaneously impacted by several parameters; and that the minimum, mean, and maximum sea ice extent may respond to a separate set of climatic/geochemical parameters. (orig.)

  4. Summer diet of the Salvin's prion at sub-Antarctic Marion Island

    African Journals Online (AJOL)

    1988-02-14

    Feb 14, 1988 ... Thirty-nine food samples were collected from Salvin's prions Pachyptila salvini at sub-Antarctic Marion Island,. Prince Edward Islands. ..... guide to foraging methods used by marine birds in. Antarctic and sub-Antarctic seas. BIOMASS Handbook. 24: 1-22. GRINDLEY, J.R. & LANE, S.B. 1979. Zooplankton.

  5. Constraining the Antarctic contribution to interglacial sea-level rise

    Science.gov (United States)

    Naish, T.; Mckay, R. M.; Barrett, P. J.; Levy, R. H.; Golledge, N. R.; Deconto, R. M.; Horgan, H. J.; Dunbar, G. B.

    2015-12-01

    Observations, models and paleoclimate reconstructions suggest that Antarctica's marine-based ice sheets behave in an unstable manner with episodes of rapid retreat in response to warming climate. Understanding the processes involved in this "marine ice sheet instability" is key for improving estimates of Antarctic ice sheet contribution to future sea-level rise. Another motivating factor is that far-field sea-level reconstructions and ice sheet models imply global mean sea level (GMSL) was up to 20m and 10m higher, respectively, compared with present day, during the interglacials of the warm Pliocene (~4-3Ma) and Late Pleistocene (at ~400ka and 125ka). This was when atmospheric CO2 was between 280 and 400ppm and global average surface temperatures were 1- 3°C warmer, suggesting polar ice sheets are highly sensitive to relatively modest increases in climate forcing. Such magnitudes of GMSL rise not only require near complete melt of the Greenland Ice Sheet and the West Antarctic Ice Sheet, but a substantial retreat of marine-based sectors of East Antarctic Ice Sheet. Recent geological drilling initiatives on the continental margin of Antarctica from both ship- (e.g. IODP; International Ocean Discovery Program) and ice-based (e.g. ANDRILL/Antarctic Geological Drilling) platforms have provided evidence supporting retreat of marine-based ice. However, without direct access through the ice sheet to archives preserved within sub-glacial sedimentary basins, the volume and extent of ice sheet retreat during past interglacials cannot be directly constrained. Sediment cores have been successfully recovered from beneath ice shelves by the ANDRILL Program and ice streams by the WISSARD (Whillans Ice Stream Sub-glacial Access Research Drilling) Project. Together with the potential of the new RAID (Rapid Access Ice Drill) initiative, these demonstrate the technological feasibility of accessing the subglacial bed and deeper sedimentary archives. In this talk I will outline the

  6. Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

    Science.gov (United States)

    Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

    2014-11-01

    The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

  7. Constraining the Antarctic contribution to global sea-level change: ANDRILL and beyond

    Science.gov (United States)

    Naish, Timothy

    2016-04-01

    Observations, models and paleoclimate reconstructions suggest that Antarctica's marine-based ice sheets behave in an unstable manner with episodes of rapid retreat in response to warming climate. Understanding the processes involved in this "marine ice sheet instability" is key for improving estimates of Antarctic ice sheet contribution to future sea-level rise. Another motivating factor is that far-field sea-level reconstructions and ice sheet models imply global mean sea level (GMSL) was up to 20m and 10m higher, respectively, compared with present day, during the interglacials of the warm Pliocene (~4-3Ma) and Late Pleistocene (at ~400ka and 125ka). This was when atmospheric CO2 was between 280 and 400ppm and global average surface temperatures were 1 to 3°C warmer, suggesting polar ice sheets are highly sensitive to relatively modest increases in climate forcing. Such magnitudes of GMSL rise not only require near complete melt of the Greenland Ice Sheet and the West Antarctic Ice Sheet, but a substantial retreat of marine-based sectors of East Antarctic Ice Sheet. Recent geological drilling initiatives on the continental margin of Antarctica from both ship- (e.g. IODP; International Ocean Discovery Program) and ice-based (e.g. ANDRILL/Antarctic Geological Drilling) platforms have provided evidence supporting retreat of marine-based ice. However, without direct access through the ice sheet to archives preserved within sub-glacial sedimentary basins, the volume and extent of ice sheet retreat during past interglacials cannot be directly constrained. Sediment cores have been successfully recovered from beneath ice shelves by the ANDRILL Program and ice streams by the WISSARD (Whillans Ice Stream Sub-glacial Access Research Drilling) Project. Together with the potential of the new RAID (Rapid Access Ice Drill) initiative, these demonstrate the technological feasibility of accessing the subglacial bed and deeper sedimentary archives. In this talk I will outline the

  8. Unexpectedly high ultrafine aerosol concentrations above East Antarctic sea ice

    Directory of Open Access Journals (Sweden)

    R. S. Humphries

    2016-02-01

    Full Text Available Better characterisation of aerosol processes in pristine, natural environments, such as Antarctica, have recently been shown to lead to the largest reduction in uncertainties in our understanding of radiative forcing. Our understanding of aerosols in the Antarctic region is currently based on measurements that are often limited to boundary layer air masses at spatially sparse coastal and continental research stations, with only a handful of studies in the vast sea-ice region. In this paper, the first observational study of sub-micron aerosols in the East Antarctic sea ice region is presented. Measurements were conducted aboard the icebreaker Aurora Australis in spring 2012 and found that boundary layer condensation nuclei (CN3 concentrations exhibited a five-fold increase moving across the polar front, with mean polar cell concentrations of 1130 cm−3 – higher than any observed elsewhere in the Antarctic and Southern Ocean region. The absence of evidence for aerosol growth suggested that nucleation was unlikely to be local. Air parcel trajectories indicated significant influence from the free troposphere above the Antarctic continent, implicating this as the likely nucleation region for surface aerosol, a similar conclusion to previous Antarctic aerosol studies. The highest aerosol concentrations were found to correlate with low-pressure systems, suggesting that the passage of cyclones provided an accelerated pathway, delivering air masses quickly from the free troposphere to the surface. After descent from the Antarctic free troposphere, trajectories suggest that sea-ice boundary layer air masses travelled equatorward into the low-albedo Southern Ocean region, transporting with them emissions and these aerosol nuclei which, after growth, may potentially impact on the region's radiative balance. The high aerosol concentrations and their transport pathways described here, could help reduce the discrepancy currently present between

  9. Unexpectedly high ultrafine aerosol concentrations above East Antarctic sea ice

    Science.gov (United States)

    Humphries, R. S.; Klekociuk, A. R.; Schofield, R.; Keywood, M.; Ward, J.; Wilson, S. R.

    2016-02-01

    Better characterisation of aerosol processes in pristine, natural environments, such as Antarctica, have recently been shown to lead to the largest reduction in uncertainties in our understanding of radiative forcing. Our understanding of aerosols in the Antarctic region is currently based on measurements that are often limited to boundary layer air masses at spatially sparse coastal and continental research stations, with only a handful of studies in the vast sea-ice region. In this paper, the first observational study of sub-micron aerosols in the East Antarctic sea ice region is presented. Measurements were conducted aboard the icebreaker Aurora Australis in spring 2012 and found that boundary layer condensation nuclei (CN3) concentrations exhibited a five-fold increase moving across the polar front, with mean polar cell concentrations of 1130 cm-3 - higher than any observed elsewhere in the Antarctic and Southern Ocean region. The absence of evidence for aerosol growth suggested that nucleation was unlikely to be local. Air parcel trajectories indicated significant influence from the free troposphere above the Antarctic continent, implicating this as the likely nucleation region for surface aerosol, a similar conclusion to previous Antarctic aerosol studies. The highest aerosol concentrations were found to correlate with low-pressure systems, suggesting that the passage of cyclones provided an accelerated pathway, delivering air masses quickly from the free troposphere to the surface. After descent from the Antarctic free troposphere, trajectories suggest that sea-ice boundary layer air masses travelled equatorward into the low-albedo Southern Ocean region, transporting with them emissions and these aerosol nuclei which, after growth, may potentially impact on the region's radiative balance. The high aerosol concentrations and their transport pathways described here, could help reduce the discrepancy currently present between simulations and observations of

  10. Contrasting Arctic and Antarctic atmospheric responses to future sea-ice loss

    Science.gov (United States)

    England, M.; Polvani, L. M.; Sun, L.

    2017-12-01

    By the end of this century, the annual mean Antarctic sea ice area is projected to decline by over a third, an amount similar to that in the Arctic, but the effect of Antarctic sea ice loss on the atmosphere remains largely unexplored. Using the Community Earth Systems Model (CESM) Whole Atmosphere Coupled Climate Model (WACCM), we investigate the effect of future Antarctic sea ice loss, and contrast it with its Arctic counterpart. This is accomplished by analyzing integrations of the model with historic and future sea ice levels, using the RCP8.5 scenario. This allows us to disentangle the effect of future sea ice loss on the atmosphere from other aspects of the coupled system. We find that both Antarctic and Arctic sea ice loss act to shift the tropospheric jet equatorwards, counteracting the poleward shift due to increases in greenhouse gases. Although the total forcing to the atmosphere is similar in both hemispheres, the response to Arctic sea ice loss is larger in amplitude and but more seasonally varying, while the response in the Antarctic persists throughout the year but with a smaller amplitude. Furthermore, the atmospheric temperature response over the Antarctic is trapped closer to the surface than in the Arctic, and perhaps surprisingly, we find that the surface temperature response to Antarctic sea ice loss is unable to penetrate the Antarctic continent.

  11. Arctic and Antarctic Sea Ice Changes and Impacts (Invited)

    Science.gov (United States)

    Nghiem, S. V.

    2013-12-01

    The extent of springtime Arctic perennial sea ice, important to preconditioning summer melt and to polar sunrise photochemistry, continues its precipitous reduction in the last decade marked by a record low in 2012, as the Bromine, Ozone, and Mercury Experiment (BROMEX) was conducted around Barrow, Alaska, to investigate impacts of sea ice reduction on photochemical processes, transport, and distribution in the polar environment. In spring 2013, there was further loss of perennial sea ice, as it was not observed in the ocean region adjacent to the Alaskan north coast, where there was a stretch of perennial sea ice in 2012 in the Beaufort Sea and Chukchi Sea. In contrast to the rapid and extensive loss of sea ice in the Arctic, Antarctic sea ice has a trend of a slight increase in the past three decades. Given the significant variability in time and in space together with uncertainties in satellite observations, the increasing trend of Antarctic sea ice may arguably be considered as having a low confidence level; however, there was no overall reduction of Antarctic sea ice extent anywhere close to the decreasing rate of Arctic sea ice. There exist publications presenting various factors driving changes in Arctic and Antarctic sea ice. After a short review of these published factors, new observations and atmospheric, oceanic, hydrological, and geological mechanisms contributed to different behaviors of sea ice changes in the Arctic and Antarctic are presented. The contribution from of hydrologic factors may provide a linkage to and enhance thermal impacts from lower latitudes. While geological factors may affect the sensitivity of sea ice response to climate change, these factors can serve as the long-term memory in the system that should be exploited to improve future projections or predictions of sea ice changes. Furthermore, similarities and differences in chemical impacts of Arctic and Antarctic sea ice changes are discussed. Understanding sea ice changes and

  12. Reconsidering connectivity in the sub-Antarctic.

    Science.gov (United States)

    Moon, Katherine L; Chown, Steven L; Fraser, Ceridwen I

    2017-11-01

    Extreme and remote environments provide useful settings to test ideas about the ecological and evolutionary drivers of biological diversity. In the sub-Antarctic, isolation by geographic, geological and glaciological processes has long been thought to underpin patterns in the region's terrestrial and marine diversity. Molecular studies using increasingly high-resolution data are, however, challenging this perspective, demonstrating that many taxa disperse among distant sub-Antarctic landmasses. Here, we reconsider connectivity in the sub-Antarctic region, identifying which taxa are relatively isolated, which are well connected, and the scales across which this connectivity occurs in both terrestrial and marine systems. Although many organisms show evidence of occasional long-distance, trans-oceanic dispersal, these events are often insufficient to maintain gene flow across the region. Species that do show evidence of connectivity across large distances include both active dispersers and more sedentary species. Overall, connectivity patterns in the sub-Antarctic at intra- and inter-island scales are highly complex, influenced by life-history traits and local dynamics such as relative dispersal capacity and propagule pressure, natal philopatry, feeding associations, the extent of human exploitation, past climate cycles, contemporary climate, and physical barriers to movement. An increasing use of molecular data - particularly genomic data sets that can reveal fine-scale patterns - and more effective international collaboration and communication that facilitates integration of data from across the sub-Antarctic, are providing fresh insights into the processes driving patterns of diversity in the region. These insights offer a platform for assessing the ways in which changing dispersal mechanisms, such as through increasing human activity and changes to wind and ocean circulation, may alter sub-Antarctic biodiversity patterns in the future. © 2017 Cambridge

  13. Seroprevalence of Toxoplasma gondii in mainland and sub-Antarctic New Zealand sea lion (Phocarctos hookeri) populations.

    Science.gov (United States)

    Michael, S A; Howe, L; Chilvers, B L; Morel, Pch; Roe, W D

    2016-09-01

    To investigate the seroprevalence of antibodies to Toxoplasma gondii in New Zealand sea lions (Phocarctos hookeri), as a potential contributor to reproductive failure. Archived sera were sourced from New Zealand sea lions from two recolonising mainland populations in the Otago Peninsula (n=15) and Stewart Island (n=12), as well as a declining population at Enderby Island (n=28) in the New Zealand sub-Antarctic. Sera were tested for antibodies to T. gondii using a commercially available ELISA (with samples considered positive if the sample to positive ratio was >30%), and latex agglutination test (LAT; with titres ≥1:32 considered positive). Western blot analysis was used to validate the results of a subset of 14 samples. Five samples from sea lions in mainland locations were confirmed positive for antibodies to T. gondii. Two adult females exhibited high LAT antibody titres (min 1:2048, max 1:4096) on both occasions when sampled 1 and 2 years apart, respectively. No animals from Enderby Island were seropositive. Toxoplasma gondii infection is unlikely to be a major contributor to poor reproductive success in New Zealand sea lions. However, continued surveillance is pertinent to assess subclinical and clinical impacts of the parasite on these threatened populations. The commercial tests evaluated here, with further species-specific threshold refinement could provide a fast, inexpensive and reliable indicator of T. gondii exposure in New Zealand sea lions.

  14. Unexpectedly high ultrafine aerosol concentrations above East Antarctic sea-ice

    Science.gov (United States)

    Humphries, R. S.; Klekociuk, A. R.; Schofield, R.; Keywood, M.; Ward, J.; Wilson, S. R.

    2015-10-01

    The effect of aerosols on clouds and their radiative properties is one of the largest uncertainties in our understanding of radiative forcing. A recent study has concluded that better characterisation of pristine, natural aerosol processes leads to the largest reduction in these uncertainties. Antarctica, being far from anthropogenic activities, is an ideal location for the study of natural aerosol processes. Aerosol measurements in Antarctica are often limited to boundary layer air-masses at spatially sparse coastal and continental research stations, with only a handful of studies in the sea ice region. In this paper, the first observational study of sub-micron aerosols in the East Antarctic sea ice region is presented. Measurements were conducted aboard the ice-breaker Aurora Australis in spring 2012 and found that boundary layer condensation nuclei (CN3) concentrations exhibited a five-fold increase moving across the Polar Front, with mean Polar Cell concentrations of 1130 cm-3 - higher than any observed elsewhere in the Antarctic and Southern Ocean region. The absence of evidence for aerosol growth suggested that nucleation was unlikely to be local. Air parcel trajectories indicated significant influence from the free troposphere above the Antarctic continent, implicating this as the likely nucleation region for surface aerosol, a similar conclusion to previous Antarctic aerosol studies. The highest aerosol concentrations were found to correlate with low pressure systems, suggesting that the passage of cyclones provided an accelerated pathway, delivering air-masses quickly from the free-troposphere to the surface. After descent from the Antarctic free troposphere, trajectories suggest that sea ice boundary layer air-masses travelled equator-ward into the low albedo Southern Ocean region, transporting with them emissions and these aerosol nuclei where, after growth, may potentially impact on the region's radiative balance. The high aerosol concentrations and

  15. Expanding Antarctic Sea Ice: Anthropogenic or Natural Variability?

    Science.gov (United States)

    Bitz, C. M.

    2016-12-01

    Antarctic sea ice extent has increased over the last 36 years according to the satellite record. Concurrent with Antarctic sea-ice expansion has been broad cooling of the Southern Ocean sea-surface temperature. Not only are Southern Ocean sea ice and SST trends at odds with expectations from greenhouse gas-induced warming, the trend patterns are not reproduced in historical simulations with comprehensive global climate models. While a variety of different factors may have contributed to the observed trends in recent decades, we propose that it is atmospheric circulation changes - and the changes in ocean circulation they induce - that have emerged as the most likely cause of the observed Southern Ocean sea ice and SST trends. I will discuss deficiencies in models that could explain their incorrect response. In addition, I will present results from a series of experiments where the Antarctic sea ice and ocean are forced by atmospheric perturbations imposed within a coupled climate model. Figure caption: Linear trends of annual-mean SST (left) and annual-mean sea-ice concentration (right) over 1980-2014. SST is from NOAA's Optimum Interpolation SST dataset (version 2; Reynolds et al. 2002). Sea-ice concentration is from passive microwave observations using the NASA Team algorithm. Only the annual means are shown here for brevity and because the signal to noise is greater than in the seasonal means. Figure from Armour and Bitz (2015).

  16. Structural Uncertainty in Antarctic sea ice simulations

    Science.gov (United States)

    Schneider, D. P.

    2016-12-01

    The inability of the vast majority of historical climate model simulations to reproduce the observed increase in Antarctic sea ice has motivated many studies about the quality of the observational record, the role of natural variability versus forced changes, and the possibility of missing or inadequate forcings in the models (such as freshwater discharge from thinning ice shelves or an inadequate magnitude of stratospheric ozone depletion). In this presentation I will highlight another source of uncertainty that has received comparatively little attention: Structural uncertainty, that is, the systematic uncertainty in simulated sea ice trends that arises from model physics and mean-state biases. Using two large ensembles of experiments from the Community Earth System Model (CESM), I will show that the model is predisposed towards producing negative Antarctic sea ice trends during 1979-present, and that this outcome is not simply because the model's decadal variability is out-of-synch with that in nature. In the "Tropical Pacific Pacemaker" ensemble, in which observed tropical Pacific SST anomalies are prescribed, the model produces very realistic atmospheric circulation trends over the Southern Ocean, yet the sea ice trend is negative in every ensemble member. However, if the ensemble-mean trend (commonly interpreted as the forced response) is removed, some ensemble members show a sea ice increase that is very similar to the observed. While this results does confirm the important role of natural variability, it also suggests a strong bias in the forced response. I will discuss the reasons for this systematic bias and explore possible remedies. This an important problem to solve because projections of 21st -Century changes in the Antarctic climate system (including ice sheet surface mass balance changes and related changes in the sea level budget) have a strong dependence on the mean state of and changes in the Antarctic sea ice cover. This problem is not unique to

  17. The multi-millennial Antarctic commitment to future sea-level rise.

    Science.gov (United States)

    Golledge, N R; Kowalewski, D E; Naish, T R; Levy, R H; Fogwill, C J; Gasson, E G W

    2015-10-15

    Atmospheric warming is projected to increase global mean surface temperatures by 0.3 to 4.8 degrees Celsius above pre-industrial values by the end of this century. If anthropogenic emissions continue unchecked, the warming increase may reach 8-10 degrees Celsius by 2300 (ref. 2). The contribution that large ice sheets will make to sea-level rise under such warming scenarios is difficult to quantify because the equilibrium-response timescale of ice sheets is longer than those of the atmosphere or ocean. Here we use a coupled ice-sheet/ice-shelf model to show that if atmospheric warming exceeds 1.5 to 2 degrees Celsius above present, collapse of the major Antarctic ice shelves triggers a centennial- to millennial-scale response of the Antarctic ice sheet in which enhanced viscous flow produces a long-term commitment (an unstoppable contribution) to sea-level rise. Our simulations represent the response of the present-day Antarctic ice-sheet system to the oceanic and climatic changes of four representative concentration pathways (RCPs) from the Fifth Assessment Report of the Intergovernmental Panel on Climate Change. We find that substantial Antarctic ice loss can be prevented only by limiting greenhouse gas emissions to RCP 2.6 levels. Higher-emissions scenarios lead to ice loss from Antarctic that will raise sea level by 0.6-3 metres by the year 2300. Our results imply that greenhouse gas emissions in the next few decades will strongly influence the long-term contribution of the Antarctic ice sheet to global sea level.

  18. Glacier extent in sub-Antarctic Kerguelen archipelago from MIS 3 period: Evidence from 36Cl dating

    Science.gov (United States)

    Jomelli, Vincent; Schimmelpfennig, Irene; Favier, Vincent; Mokadem, Fatima; Landais, Amaelle; Rinterknecht, Vincent; Brunstein, Daniel; Verfaillie, Deborah; Legentil, Claude; Aumaitre, Georges; Bourlès, Didier L.; Keddadouche, Karim

    2018-03-01

    Documenting sub-Antarctic glacier variations during the local last glacial maximum is of major interest to better understand their sensitivity to atmospheric and oceanic temperature changes in conjunction with Antarctic ice sheet changes. However, data are sparse because evidence of earlier glacier extents is for most sub-Antarctic islands located offshore making their observation complex. Here, we present 22 cosmogenic 36Cl surface exposure ages obtained from five sites at Kerguelen to document the glacial history. The 36Cl ages from roche moutonnee surfaces, erratics and boulders collected on moraines span from 41.9 ± 4.4 ka to 14.3 ± 1.1 ka. Ice began to retreat on the eastern part of the main island before 41.4 ± 4.4 ka. Slow deglaciation occurred from ∼41 to ∼29 ka. There is no evidence of advances between 29 ka and the Antarctic Cold Reversal (ACR) period (∼14.5-12.9 ka) period. During the ACR, however, the Bontemps and possibly Belvedere moraines were formed by the advance of a Cook Ice Cap outlet glacier and a local glacier on the Presque Ile Jeanne d'Arc, respectively. This glacier evolution differs partly from that of glaciers in New Zealand and in Patagonia. These asynchronous glacier changes in the sub-Antarctic region are however in agreement with sea surface temperature changes recorded around Antarctica, which suggest differences in the climate evolution of the Indo-Pacific and Atlantic sectors of Antarctica.

  19. Spring–summer albedo variations of Antarctic sea ice from 1982 to 2009

    International Nuclear Information System (INIS)

    Shao, Zhu-De; Ke, Chang-Qing

    2015-01-01

    This study examined the spring–summer (November, December, January and February) albedo averages and trends using a dataset consisting of 28 years of homogenized satellite data for the entire Antarctic sea ice region and for five longitudinal sectors around Antarctica: the Weddell Sea (WS), the Indian Ocean sector (IO), the Pacific Ocean sector (PO), the Ross Sea (RS) and the Bellingshausen–Amundsen Sea (BS). Time series data of the sea ice concentrations and sea surface temperatures were used to analyse their relations to the albedo. The results indicated that the sea ice albedo increased slightly during the study period, at a rate of 0.314% per decade, over the Antarctic sea ice region. The sea ice albedos in the PO, the IO and the WS increased at rates of 2.599% per decade (confidence level 99.86%), 0.824% per decade and 0.413% per decade, respectively, and the steepest increase occurred in the PO. However, the sea ice albedo in the BS decreased at a rate of −1.617% per decade (confidence level 95.05%) and was near zero in the RS. The spring–summer average albedo over the Antarctic sea ice region was 50.24%. The highest albedo values were mainly found on the continental coast and in the WS; in contrast, the lowest albedo values were found on the outer edge of the sea ice, the RS and the Amery Ice Shelf. The average albedo in the western Antarctic sea ice region was distinctly higher than that in the east. The albedo was significantly positively correlated with sea ice concentration (SIC) and was significantly negatively correlated with sea surface temperature (SST); these scenarios held true for all five longitudinal sectors. Spatially, the higher surface albedos follow the higher SICs and lower SST patterns. The increasing albedo means that Antarctic sea ice region reflects more solar radiation and absorbs less, leading to a decrease in temperature and much snowfall on sea ice, and further resulted in an increase in albedo. Conversely, the decreasing

  20. Environmental constraints on West Antarctic ice-sheet formation

    Energy Technology Data Exchange (ETDEWEB)

    Lindstrom, D R; MacAyeal, D R

    1987-01-01

    Small perturbations in Antarctic environmental conditions can culminate in the demise of the Antarctic ice sheet's western sector. This may have happened during the last interglacial period, and could recur within the next millennium due to atmospheric warming from trace gas and CO/sub 2/ increases. In this study, we investigate the importance of sea-level, accumulation rate, and ice influx from the East Antarctic ice sheet in the re-establishment of the West Antarctic ice sheet from a thin cover using a time-dependent numerical ice-shelf model. Our results show that a precursor to the West Antarctic ice sheet can form within 3000 years. Sea-level lowering caused by ice-sheet development in the Northern Hemisphere has the greatest environmental influence. Under favorable conditions, ice grounding occurs over all parts of the West Antarctic ice sheet except up-stream of Thwaites Glacier and in the Ross Sea region.

  1. Regional Changes in the Sea Ice Cover and Ice Production in the Antarctic

    Science.gov (United States)

    Comiso, Josefino C.

    2011-01-01

    Coastal polynyas around the Antarctic continent have been regarded as sea ice factories because of high ice production rates in these regions. The observation of a positive trend in the extent of Antarctic sea ice during the satellite era has been intriguing in light of the observed rapid decline of the ice extent in the Arctic. The results of analysis of the time series of passive microwave data indicate large regional variability with the trends being strongly positive in the Ross Sea, strongly negative in the Bellingshausen/Amundsen Seas and close to zero in the other regions. The atmospheric circulation in the Antarctic is controlled mainly by the Southern Annular Mode (SAM) and the marginal ice zone around the continent shows an alternating pattern of advance and retreat suggesting the presence of a propagating wave (called Antarctic Circumpolar Wave) around the circumpolar region. The results of analysis of the passive microwave data suggest that the positive trend in the Antarctic sea ice cover could be caused primarily by enhanced ice production in the Ross Sea that may be associated with more persistent and larger coastal polynyas in the region. Over the Ross Sea shelf, analysis of sea ice drift data from 1992 to 2008 yields a positive rate-of-increase in the net ice export of about 30,000 km2 per year. For a characteristic ice thickness of 0.6 m, this yields a volume transport of about 20 km3/year, which is almost identical, within error bars, to our estimate of the trend in ice production. In addition to the possibility of changes in SAM, modeling studies have also indicated that the ozone hole may have a role in that it causes the deepening of the lows in the western Antarctic region thereby causing strong winds to occur offthe Ross-ice shelf.

  2. Improved simulation of Antarctic sea ice due to the radiative effects of falling snow

    Science.gov (United States)

    Li, J.-L. F.; Richardson, Mark; Hong, Yulan; Lee, Wei-Liang; Wang, Yi-Hui; Yu, Jia-Yuh; Fetzer, Eric; Stephens, Graeme; Liu, Yinghui

    2017-08-01

    Southern Ocean sea-ice cover exerts critical control on local albedo and Antarctic precipitation, but simulated Antarctic sea-ice concentration commonly disagrees with observations. Here we show that the radiative effects of precipitating ice (falling snow) contribute substantially to this discrepancy. Many models exclude these radiative effects, so they underestimate both shortwave albedo and downward longwave radiation. Using two simulations with the climate model CESM1, we show that including falling-snow radiative effects improves the simulations relative to cloud properties from CloudSat-CALIPSO, radiation from CERES-EBAF and sea-ice concentration from passive microwave sensors. From 50-70°S, the simulated sea-ice-area bias is reduced by 2.12 × 106 km2 (55%) in winter and by 1.17 × 106 km2 (39%) in summer, mainly because increased wintertime longwave heating restricts sea-ice growth and so reduces summer albedo. Improved Antarctic sea-ice simulations will increase confidence in projected Antarctic sea level contributions and changes in global warming driven by long-term changes in Southern Ocean feedbacks.

  3. Impacts of the north and tropical Atlantic Ocean on the Antarctic Peninsula and sea ice.

    Science.gov (United States)

    Li, Xichen; Holland, David M; Gerber, Edwin P; Yoo, Changhyun

    2014-01-23

    In recent decades, Antarctica has experienced pronounced climate changes. The Antarctic Peninsula exhibited the strongest warming of any region on the planet, causing rapid changes in land ice. Additionally, in contrast to the sea-ice decline over the Arctic, Antarctic sea ice has not declined, but has instead undergone a perplexing redistribution. Antarctic climate is influenced by, among other factors, changes in radiative forcing and remote Pacific climate variability, but none explains the observed Antarctic Peninsula warming or the sea-ice redistribution in austral winter. However, in the north and tropical Atlantic Ocean, the Atlantic Multidecadal Oscillation (a leading mode of sea surface temperature variability) has been overlooked in this context. Here we show that sea surface warming related to the Atlantic Multidecadal Oscillation reduces the surface pressure in the Amundsen Sea and contributes to the observed dipole-like sea-ice redistribution between the Ross and Amundsen-Bellingshausen-Weddell seas and to the Antarctic Peninsula warming. Support for these findings comes from analysis of observational and reanalysis data, and independently from both comprehensive and idealized atmospheric model simulations. We suggest that the north and tropical Atlantic is important for projections of future climate change in Antarctica, and has the potential to affect the global thermohaline circulation and sea-level change.

  4. Halogen species record Antarctic sea ice extent over glacial–interglacial periods

    Directory of Open Access Journals (Sweden)

    A. Spolaor

    2013-07-01

    Full Text Available Sea ice is an integral part of the earth's climate system because it affects planetary albedo, sea-surface salinity, and the atmosphere–ocean exchange of reactive gases and aerosols. Bromine and iodine chemistry is active at polar sea ice margins with the occurrence of bromine explosions and the biological production of organoiodine from sea ice algae. Satellite measurements demonstrate that concentrations of bromine oxide (BrO and iodine oxide (IO decrease over sea ice toward the Antarctic interior. Here we present speciation measurements of bromine and iodine in the TALDICE (TALos Dome Ice CorE ice core (159°11' E, 72°49' S; 2315 m a.s.l. spanning the last 215 ky. The Talos Dome ice core is located 250 km inland and is sensitive to marine air masses intruding onto the Antarctic Plateau. Talos Dome bromide (Br− is positively correlated with temperature and negatively correlated with sodium (Na. Based on the Br−/Na seawater ratio, bromide is depleted in the ice during glacial periods and enriched during interglacial periods. Total iodine, consisting of iodide (I− and iodate (IO3−, peaks during glacials with lower values during interglacial periods. Although IO3− is considered the most stable iodine species in the atmosphere it was only observed in the TALDICE record during glacial maxima. Sea ice dynamics are arguably the primary driver of halogen fluxes over glacial–interglacial timescales, by altering the distance between the sea ice edge and the Antarctic plateau and by altering the surface area of sea ice available to algal colonization. Based on our results we propose the use of both halogens for examining Antarctic variability of past sea ice extent.

  5. Antarctic sea ice increase consistent with intrinsic variability of the Amundsen Sea Low

    Science.gov (United States)

    Turner, John; Hosking, J. Scott; Marshall, Gareth J.; Phillips, Tony; Bracegirdle, Thomas J.

    2016-04-01

    We investigate the relationship between atmospheric circulation variability and the recent trends in Antarctic sea ice extent (SIE) using Coupled Model Intercomparison Project Phase 5 (CMIP5) atmospheric data, ECMWF Interim reanalysis fields and passive microwave satellite data processed with the Bootstrap version 2 algorithm. Over 1979-2013 the annual mean total Antarctic SIE increased at a rate of 195 × 103 km2 dec-1 (1.6 % dec-1), p 4.0 % dec-1) has been in the Ross Sea sector. Off West Antarctica there is a high correlation between trends in SIE and trends in the near-surface winds. The Ross Sea SIE seasonal trends are positive throughout the year, but largest in spring. The stronger meridional flow over the Ross Sea has been driven by a deepening of the Amundsen Sea Low (ASL). Pre-industrial control and historical simulations from CMIP5 indicate that the observed deepening of the ASL and stronger southerly flow over the Ross Sea are within the bounds of modeled intrinsic variability. The spring trend would need to continue for another 11 years for it to fall outside the 2 standard deviation range seen in 90 % of the simulations.

  6. Parasites of the Antarctic toothfish (Dissostichus mawsoni Norman, 1937 (Perciformes, Nototheniidae in the Pacific sector of the Antarctic

    Directory of Open Access Journals (Sweden)

    Ilya I. Gordeev

    2016-06-01

    Full Text Available The Antarctic toothfish (Dissostichus mawsoni Norman, 1937 is one of the main target species of commercial fisheries in the Antarctic. It is an endemic and is found along the shelf of Antarctica, as well as on the slopes of seamounts, underwater elevations and islands in the sub-Antarctic. It feeds on a variety of fish and cephalopods and can be an intermediate/paratenic host of some helminthes, whose final hosts are whales, seals, large rays and sharks. This article presents new data on toothfish infection in the Pacific sector of the Antarctic. Specimens were examined during commercial longline fishing in the Ross Sea and the Amundsen Sea in January–February 2013. Fourteen species of parasites were found using standard parasitological methods and genetic analysis.

  7. Reconciling projections of the Antarctic contribution to sea level rise

    Science.gov (United States)

    Edwards, Tamsin; Holden, Philip; Edwards, Neil; Wernecke, Andreas

    2017-04-01

    Two recent studies of the Antarctic contribution to sea level rise this century had best estimates that differed by an order of magnitude (around 10 cm and 1 m by 2100). The first, Ritz et al. (2015), used a model calibrated with satellite data, giving a 5% probability of exceeding 30cm by 2100 for sea level rise due to Antarctic instability. The second, DeConto and Pollard (2016), used a model evaluated with reconstructions of palaeo-sea level. They did not estimate probabilities, but using a simple assumption here about the distribution shape gives up to a 5% chance of Antarctic contribution exceeding 2.3 m this century with total sea level rise approaching 3 m. If robust, this would have very substantial implications for global adaptation to climate change. How are we to make sense of this apparent inconsistency? How much is down to the data - does the past tell us we will face widespread and rapid Antarctic ice losses in the future? How much is due to the mechanism of rapid ice loss ('cliff failure') proposed in the latter paper, or other parameterisation choices in these low resolution models (GRISLI and PISM, respectively)? How much is due to choices made in the ensemble design and calibration? How do these projections compare with high resolution, grounding line resolving models such as BISICLES? Could we reduce the huge uncertainties in the palaeo-study? Emulation provides a powerful tool for understanding these questions and reconciling the projections. By describing the three numerical ice sheet models with statistical models, we can re-analyse the ensembles and re-do the calibrations under a common statistical framework. This reduces uncertainty in the PISM study because it allows massive sampling of the parameter space, which reduces the sensitivity to reconstructed palaeo-sea level values and also narrows the probability intervals because the simple assumption about distribution shape above is no longer needed. We present reconciled probabilistic

  8. Intercomparison of Antarctic ice-shelf, ocean, and sea-ice interactions simulated by MetROMS-iceshelf and FESOM 1.4

    Science.gov (United States)

    Naughten, Kaitlin A.; Meissner, Katrin J.; Galton-Fenzi, Benjamin K.; England, Matthew H.; Timmermann, Ralph; Hellmer, Hartmut H.; Hattermann, Tore; Debernard, Jens B.

    2018-04-01

    An increasing number of Southern Ocean models now include Antarctic ice-shelf cavities, and simulate thermodynamics at the ice-shelf/ocean interface. This adds another level of complexity to Southern Ocean simulations, as ice shelves interact directly with the ocean and indirectly with sea ice. Here, we present the first model intercomparison and evaluation of present-day ocean/sea-ice/ice-shelf interactions, as simulated by two models: a circumpolar Antarctic configuration of MetROMS (ROMS: Regional Ocean Modelling System coupled to CICE: Community Ice CodE) and the global model FESOM (Finite Element Sea-ice Ocean Model), where the latter is run at two different levels of horizontal resolution. From a circumpolar Antarctic perspective, we compare and evaluate simulated ice-shelf basal melting and sub-ice-shelf circulation, as well as sea-ice properties and Southern Ocean water mass characteristics as they influence the sub-ice-shelf processes. Despite their differing numerical methods, the two models produce broadly similar results and share similar biases in many cases. Both models reproduce many key features of observations but struggle to reproduce others, such as the high melt rates observed in the small warm-cavity ice shelves of the Amundsen and Bellingshausen seas. Several differences in model design show a particular influence on the simulations. For example, FESOM's greater topographic smoothing can alter the geometry of some ice-shelf cavities enough to affect their melt rates; this improves at higher resolution, since less smoothing is required. In the interior Southern Ocean, the vertical coordinate system affects the degree of water mass erosion due to spurious diapycnal mixing, with MetROMS' terrain-following coordinate leading to more erosion than FESOM's z coordinate. Finally, increased horizontal resolution in FESOM leads to higher basal melt rates for small ice shelves, through a combination of stronger circulation and small-scale intrusions of

  9. Atmospheric Influences on the Anomalous 2016 Antarctic Sea Ice Decay

    Science.gov (United States)

    Raphael, M. N.; Schlosser, E.; Haumann, A.

    2017-12-01

    Over the past three decades, a small but significant increase in sea ice extent (SIE) has been observed in the Antarctic. However, in 2016 there was a surprisingly early onset of the melt season. The maximum Antarctic SIE was reached in August rather than end of September, and was followed by a rapid decrease. The decline of the sea ice area (SIA) started even earlier, in July. The retreat of the ice was particularly large in November where Antarctic SIE exhibited a negative anomaly (compared to the 1981-2010 average) of almost 2 Mio. km2, which, combined with reduced Arctic SIE, led to a distinct minimum in global SIE. And, satellite observations show that from November 2016 to February 2017, the daily Antarctic SIE has been at record low levels. We use sea level pressure and geopotential height data from the ECMWF- Interim reanalysis, in conjunction with sea ice data obtained from the National Snow and Ice Data Centre (NSIDC), to investigate possible atmospheric influences on the observed phenomena. Indications are that both the onset of the melt in July and the rapid decrease in SIA and SIE in November were triggered by atmospheric flow patterns related to a positive Zonal Wave 3 index, i.e. synoptic situations leading to strong meridional flow. Additionally the Southern Annular Mode (SAM) index reached its second lowest November value since the beginning of the satellite observations. It is likely that the SIE decrease was preconditioned by SIA decrease. Positive feedback effects led to accelerated melt and consequently to the extraordinary low November SIE.

  10. Antarctic sea ice losses drive gains in benthic carbon drawdown.

    Science.gov (United States)

    Barnes, D K A

    2015-09-21

    Climate forcing of sea-ice losses from the Arctic and West Antarctic are blueing the poles. These losses are accelerating, reducing Earth's albedo and increasing heat absorption. Subarctic forest (area expansion and increased growth) and ice-shelf losses (resulting in new phytoplankton blooms which are eaten by benthos) are the only significant described negative feedbacks acting to counteract the effects of increasing CO2 on a warming planet, together accounting for uptake of ∼10(7) tonnes of carbon per year. Most sea-ice loss to date has occurred over polar continental shelves, which are richly, but patchily, colonised by benthic animals. Most polar benthos feeds on microscopic algae (phytoplankton), which has shown increased blooms coincident with sea-ice losses. Here, growth responses of Antarctic shelf benthos to sea-ice losses and phytoplankton increases were investigated. Analysis of two decades of benthic collections showed strong increases in annual production of shelf seabed carbon in West Antarctic bryozoans. These were calculated to have nearly doubled to >2x10(5) tonnes of carbon per year since the 1980s. Annual production of bryozoans is median within wider Antarctic benthos, so upscaling to include other benthos (combined study species typically constitute ∼3% benthic biomass) suggests an increased drawdown of ∼2.9x10(6) tonnes of carbon per year. This drawdown could become sequestration because polar continental shelves are typically deeper than most modern iceberg scouring, bacterial breakdown rates are slow, and benthos is easily buried. To date, most sea-ice losses have been Arctic, so, if hyperboreal benthos shows a similar increase in drawdown, polar continental shelves would represent Earth's largest negative feedback to climate change. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. Response of Antarctic sea surface temperature and sea ice to ozone depletion

    Science.gov (United States)

    Ferreira, D.; Gnanadesikan, A.; Kostov, Y.; Marshall, J.; Seviour, W.; Waugh, D.

    2017-12-01

    The influence of the Antarctic ozone hole extends all the way from the stratosphere through the troposphere down to the surface, with clear signatures on surface winds, and SST during summer. In this talk we discuss the impact of these changes on the ocean circulation and sea ice state. We are notably motivated by the observed cooling of the surface Southern Ocean and associated increase in Antarctic sea ice extent since the 1970s. These trends are not reproduced by CMIP5 climate models, and the underlying mechanism at work in nature and the models remain unexplained. Did the ozone hole contribute to the observed trends?Here, we review recent advances toward answering these issues using "abrupt ozone depletion" experiments. The ocean and sea ice response is rather complex, comprising two timescales: a fast ( 1-2y) cooling of the surface ocean and sea ice cover increase, followed by a slower warming trend, which, depending on models, flip the sign of the SST and sea ice responses on decadal timescale. Although the basic mechanism seems robust, comparison across climate models reveal large uncertainties in the timescales and amplitude of the response to the extent that even the sign of the ocean and sea ice response to ozone hole and recovery remains unconstrained. After briefly describing the dynamics and thermodynamics behind the two-timescale response, we will discuss the main sources of uncertainties in the modeled response, namely cloud effects and air-sea heat exchanges, surface wind stress response and ocean eddy transports. Finally, we will consider the implications of our results on the ability of coupled climate models to reproduce observed Southern Ocean changes.

  12. Assessment of Arctic and Antarctic sea ice predictability in CMIP5 decadal hindcasts

    Directory of Open Access Journals (Sweden)

    C.-Y. Yang

    2016-10-01

    Full Text Available This paper examines the ability of coupled global climate models to predict decadal variability of Arctic and Antarctic sea ice. We analyze decadal hindcasts/predictions of 11 Coupled Model Intercomparison Project Phase 5 (CMIP5 models. Decadal hindcasts exhibit a large multi-model spread in the simulated sea ice extent, with some models deviating significantly from the observations as the predicted ice extent quickly drifts away from the initial constraint. The anomaly correlation analysis between the decadal hindcast and observed sea ice suggests that in the Arctic, for most models, the areas showing significant predictive skill become broader associated with increasing lead times. This area expansion is largely because nearly all the models are capable of predicting the observed decreasing Arctic sea ice cover. Sea ice extent in the North Pacific has better predictive skill than that in the North Atlantic (particularly at a lead time of 3–7 years, but there is a re-emerging predictive skill in the North Atlantic at a lead time of 6–8 years. In contrast to the Arctic, Antarctic sea ice decadal hindcasts do not show broad predictive skill at any timescales, and there is no obvious improvement linking the areal extent of significant predictive skill to lead time increase. This might be because nearly all the models predict a retreating Antarctic sea ice cover, opposite to the observations. For the Arctic, the predictive skill of the multi-model ensemble mean outperforms most models and the persistence prediction at longer timescales, which is not the case for the Antarctic. Overall, for the Arctic, initialized decadal hindcasts show improved predictive skill compared to uninitialized simulations, although this improvement is not present in the Antarctic.

  13. Changes in Arctic and Antarctic Sea Ice as a Microcosm of Global Climate Change

    Science.gov (United States)

    Parkinson, Claire L.

    2014-01-01

    Polar sea ice is a key element of the climate system and has now been monitored through satellite observations for over three and a half decades. The satellite observations reveal considerable information about polar ice and its changes since the late 1970s, including a prominent downward trend in Arctic sea ice coverage and a much lesser upward trend in Antarctic sea ice coverage, illustrative of the important fact that climate change entails spatial contrasts. The decreasing ice coverage in the Arctic corresponds well with contemporaneous Arctic warming and exhibits particularly large decreases in the summers of 2007 and 2012, influenced by both preconditioning and atmospheric conditions. The increasing ice coverage in the Antarctic is not as readily explained, but spatial differences in the Antarctic trends suggest a possible connection with atmospheric circulation changes that have perhaps been influenced by the Antarctic ozone hole. The changes in the polar ice covers and the issues surrounding those changes have many commonalities with broader climate changes and their surrounding issues, allowing the sea ice changes to be viewed in some important ways as a microcosm of global climate change.

  14. Development of a Regional Glycerol Dialkyl Glycerol Tetraether (GDGT) - Temperature Calibration for Antarctic and sub-Antarctic Lakes

    Science.gov (United States)

    Roberts, S. J.; Foster, L. C.; Pearson, E. J.; Steve, J.; Hodgson, D.; Saunders, K. M.; Verleyen, E.

    2016-12-01

    Temperature calibration models based on the relative abundances of sedimentary glycerol dialkyl glycerol tetraethers (GDGTs) have been used to reconstruct past temperatures in both marine and terrestrial environments, but have not been widely applied in high latitude environments. This is mainly because the performance of GDGT-temperature calibrations at lower temperatures and GDGT provenance in many lacustrine settings remains uncertain. To address these issues, we examined surface sediments from 32 Antarctic, sub-Antarctic and Southern Chilean lakes. First, we quantified GDGT compositions present and then investigated modern-day environmental controls on GDGT composition. GDGTs were found in all 32 lakes studied. Branched GDGTs (brGDGTs) were dominant in 31 lakes and statistical analyses showed that their composition was strongly correlated with mean summer air temperature (MSAT) rather than pH, conductivity or water depth. Second, we developed the first regional brGDGT-temperature calibration for Antarctic and sub-Antarctic lakes based on four brGDGT compounds (GDGT-Ib, GDGT-II, GDGT-III and GDGT-IIIb). Of these, GDGT-IIIb proved particularly important in cold lacustrine environments. Our brGDGT-Antarctic temperature calibration dataset has an improved statistical performance at low temperatures compared to previous global calibrations (r2=0.83, RMSE=1.45°C, RMSEP-LOO=1.68°C, n=36 samples), highlighting the importance of basing palaeotemperature reconstructions on regional GDGT-temperature calibrations, especially if specific compounds lead to improved model performance. Finally, we applied the new Antarctic brGDGT-temperature calibration to two key lake records from the Antarctic Peninsula and South Georgia. In both, downcore temperature reconstructions show similarities to known Holocene warm periods, providing proof of concept for the new Antarctic calibration model.

  15. Climate Change Impacts in the sub-Antarctic Islands Technical Report N.2 of ONERC

    International Nuclear Information System (INIS)

    2009-01-01

    Difficult to apprehend as a whole, the polar regions constitute the Arctic to the North, an ocean surrounded by emerged lands, and the Antarctic to the South, a continent bordered by the Austral Ocean where a belt of sub Antarctic islands lies. Climate change impacts on sub Antarctic islands are varied, direct and indirect: glacier retreat, more favourable conditions for introduced species, marine biodiversity modification, etc. This report discusses the French, British, Australian, South African and New Zealand sub Antarctic islands, the climatic evolutions and the resulting impacts, focused especially on biodiversity. The Observatoire National sur les Effets du Rechauffement Climatique and the International Polar Foundation have been joined in this endeavour by the French polar institute Paul-Emile Victor, the administration of the French Southern and Antarctic Lands (TAAF in French) and the International Union for the Conservation of Nature. (authors)

  16. The biodiversity and species composition of the spider community of Marion Island, a recent survey (Arachnida: Araneae

    Directory of Open Access Journals (Sweden)

    T.T. Khoza

    2005-12-01

    Full Text Available Marion Island, the larger of the Prince Edward Islands, lies in the sub-Antarctic biogeographic region in the southern Indian Ocean. From previous surveys, four spider species are known from Marion. The last survey was undertaken in 1968. During this study a survey was undertaken over a period of four weeks on the island to determine the present spider diversity and to record information about the habitat preferences and general behaviour of the species present. Three collection methods (active search, Tullgren funnels and pitfall traps were used, and spiders were sampled from six habitat sites. A total of 430 spiders represented by four families were collected, Myro kerguelenesis crozetensis Enderlein, 1909 and M. paucispinosus Berland, 1947 (Desidae, Prinerigone vagans (Audouin, 1826 (Linyphiidae, Cheiracanthium furculatum Karsch, 1879 (Miturgidae and an immature Salticidae. The miturgid and salticid are first records. Neomaso antarticus (Hickman, 1939 (Linyphiidae was absent from samples, confirming that the species might have been an erroneous record.

  17. Photosynthesis in a sub-Antarctic shore-zone lichen

    NARCIS (Netherlands)

    Smith, V.; Gremmen, N.J.M.

    2001-01-01

    Photosynthetic responses to moisture, light, temperature, salinity and inorganic nitrogen fertilization are reported for a shore-zone lichen Turgidiusculum complicatulum (formerly Mastodia tesselata), a possible recent introduction to sub-Antarctic Marion Island. Optimum moisture contents for net

  18. Submarine glacial landforms and interactions with volcanism around Sub-Antarctic Heard and McDonald Islands

    Science.gov (United States)

    Picard, K.; Watson, S. J.; Fox, J. M.; Post, A.; Whittaker, J. M.; Lucieer, V.; Carey, R.; Coffin, M. F.; Hodgson, D.; Hogan, K.; Graham, A. G. C.

    2017-12-01

    Unravelling the glacial history of Sub-Antarctic islands can provide clues to past climate and Antarctic ice sheet stability. The glacial history of many sub-Antarctic islands is poorly understood, including the Heard and McDonald Islands (HIMI) located on the Kerguelen Plateau in the southern Indian Ocean. The geomorphologic development of HIMI has involved a combination of construction via hotspot volcanism and mechanical erosion caused by waves, weather, and glaciers. Today, the 2.5 km2 McDonald Islands are not glacierised; in contrast, the 368 km2 Heard Island has 12 major glaciers, some extending from the summit of 2813 m to sea level. Historical accounts from Heard Island suggest that the glaciers were more extensive in the 1850s to 1870s, and have retreated at least 12% (33.89 km2) since 1997. However, surrounding bathymetry suggests a much more extensive previous glaciation of the HIMI region that encompassed 9,585 km2, likely dating back at least to the Last Glacial Maximum (LGM) ca. 26.5 -19 ka. We present analyses of multibeam bathymetry and backscatter data, acquired aboard RV Investigator in early 2016, that support the previous existence of an extensive icecap. These data reveal widespread ice-marginal and subglacial features including moraines, over-deepened troughs, drumlins and crag-and-tails. Glacial landforms suggest paleo-ice flow directions and a glacial extent that are consistent with previously documented broad scale morphological features. We identify >660 iceberg keel scours in water depths ranging from 150 - 530 m. The orientations of the iceberg keel scours reflect the predominantly east-flowing Antarctic Circumpolar Current and westerly winds in the region. 40Ar/39Ar dating of volcanic rocks from submarine volcanoes around McDonald Islands suggests that volcanism and glaciation coincided. The flat-topped morphology of these volcanoes may result from lava-ice interaction or erosion by glaciers post eruption during a time of extensive ice

  19. Fuel oil and dispersant toxicity to the Antarctic sea urchin (Sterechinus neumayeri).

    Science.gov (United States)

    Alexander, Frances J; King, Catherine K; Reichelt-Brushett, Amanda J; Harrison, Peter L

    2017-06-01

    The risk of a major marine fuel spill in Antarctic waters is increasing, yet there are currently no standard or suitable response methods under extreme Antarctic conditions. Fuel dispersants may present a possible solution; however, little data exist on the toxicity of dispersants or fuels to Antarctic species, thereby preventing informed management decisions. Larval development toxicity tests using 3 life history stages of the Antarctic sea urchin (Sterechinus neumayeri) were completed to assess the toxicity of physically dispersed, chemically dispersed, and dispersant-only water-accommodated fractions (WAFs) of an intermediate fuel oil (IFO 180, BP) and the chemical dispersant Slickgone NS (Dasic International). Despite much lower total petroleum hydrocarbon concentrations, physically dispersed fuels contained higher proportions of low-to-intermediate weight carbon compounds and were generally at least an order of magnitude more toxic than chemically dispersed fuels. Based on concentrations that caused 50% abnormality (EC50) values, the embryonic unhatched blastula life stage was the least affected by fuels and dispersants, whereas the larval 4-armed pluteus stage was the most sensitive. The present study is the first to investigate the possible implications of the use of fuel dispersants for fuel spill response in Antarctica. The results indicate that the use of a fuel dispersant did not increase the hydrocarbon toxicity of IFO 180 to the early life stages of Antarctic sea urchins, relative to physical dispersal. Environ Toxicol Chem 2017;36:1563-1571. © 2016 SETAC. © 2016 SETAC.

  20. Neoglacial Antarctic sea-ice expansion driven by mid-Holocene retreat of the Ross Ice Shelf.

    Science.gov (United States)

    Bendle, J. A.; Newton, K.; Mckay, R. M.; Crosta, X.; Etourneau, J.; Anya, A. B.; Seki, O.; Golledge, N. R.; Bertler, N. A. N.; Willmott, V.; Schouten, S.; Riesselman, C. R.; Masse, G.; Dunbar, R. B.

    2017-12-01

    Recent decades have seen expanding Antarctic sea-ice coverage, coeval with thinning West Antarctic Ice Sheet (WAIS) ice shelves and the rapid freshening of surface and bottom waters along the Antarctic margin. The mid-Holocene Neoglacial transition represents the last comparable baseline shift in sea-ice behaviour. The drivers and feedbacks involved in both the recent and Holocene events are poorly understood and characterised by large proxy-model mismatches. We present new records of compound specific fatty acid isotope analyses (δ2H-FA), highly-branched isoprenoid alkenes (HBIs) TEX86L temperatures, grain-size, mass accumulations rates (MARs) and image analyses from a 171m Holocene sediment sequence from Site U1357 (IODP leg 318). In combination with published records we reconstruct Holocene changes in glacial meltwater, sedimentary inputs and sea-ice. The early Holocene (11 to 10 ka) is characterised by large fluctuations in inputs of deglacial meltwater and sediments and seismic evidence of downlapping material from the south, suggesting a dominating influence from glacial retreat of the local outlet glaciers. From 10 to 8 ka there is decreasing meltwater inputs, an onlapping drift and advection of material from the east. After ca. 8 ka positively correlated δ2H-FA and MARs infer that pulses of glacial melt correlate to stronger easterly currents, driving erosion of material from upstream banks and that the Ross Ice Shelf (RIS) becomes a major influence. A large mid-Holocene meltwater pulse (preceded by warming TEX86L temperatures) is evident between ca. 6 to 4.5 ka, culminating in a rapid and permanent increase in sea-ice from 4.5 ka. This is coeval with cosmogenic nuclide evidence for a rapid thinning of the Antarctic ice sheet during the mid-Holocene (Hein et al., 2016). We suggest this represents a final major pulse of deglaciation from the Ross Ice Shelf, which initiates the Neoglacial, driving cool surface waters along the coast and greater sea

  1. Freshwater invertebrates of sub-Antarctic Marion Island | Dartnall ...

    African Journals Online (AJOL)

    The aquatic species include five platyhelminthes, a gastrotrich, three tardigrades, 28 rotifers, six nematodes, two annelids and 11 arthropods. Most are familiar species that have been recorded on other sub-Antarctic islands. The invertebrate faunas of the various freshwater habitats were basically similar in species ...

  2. Antarctic science

    Science.gov (United States)

    Summerhayes, Colin

    Once upon a time, dinosaurs roamed Antarctica and swam in its seas. Since then, life evolved as the climate cooled into the ice ages. Life will no doubt continue to evolve there as the globe now warms. But nowadays, humans are having a profound and direct effect on life in Antarctica, the sub-Antarctic islands, and the surrounding Southern Ocean, which are being invaded by a wide range of alien species including microbes, algae, fungi, bryophytes, land plants, invertebrates, fish, birds, and mammals.

  3. Possible connections of the opposite trends in Arctic and Antarctic sea-ice cover.

    Science.gov (United States)

    Yu, Lejiang; Zhong, Shiyuan; Winkler, Julie A; Zhou, Mingyu; Lenschow, Donald H; Li, Bingrui; Wang, Xianqiao; Yang, Qinghua

    2017-04-05

    Sea ice is an important component of the global climate system and a key indicator of climate change. A decreasing trend in Arctic sea-ice concentration is evident in recent years, whereas Antarctic sea-ice concentration exhibits a generally increasing trend. Various studies have investigated the underlying causes of the observed trends for each region, but possible linkages between the regional trends have not been studied. Here, we hypothesize that the opposite trends in Arctic and Antarctic sea-ice concentration may be linked, at least partially, through interdecadal variability of the Pacific Decadal Oscillation (PDO) and the Atlantic Multidecadal Oscillation (AMO). Although evaluation of this hypothesis is constrained by the limitations of the sea-ice cover record, preliminary statistical analyses of one short-term and two long-term time series of observed and reanalysis sea-ice concentrations data suggest the possibility of the hypothesized linkages. For all three data sets, the leading mode of variability of global sea-ice concentration is positively correlated with the AMO and negatively correlated with the PDO. Two wave trains related to the PDO and the AMO appear to produce anomalous surface-air temperature and low-level wind fields in the two polar regions that contribute to the opposite changes in sea-ice concentration.

  4. Soils of Sub-Antarctic tundras: diversity and basic chemical characteristics

    Science.gov (United States)

    Abakumov, Evgeny; Vlasov, Dmitry; Mukhametova, Nadezhda

    2014-05-01

    Antarctic peninsula is known as specific part of Antarctica, which is characterizes by humid and relatively warm climate of so-called sub Antarctic (maritime) zone. Annual precipitation and long above zero period provides the possibility of sustainable tundra's ecosystem formation. Therefore, the soil diversity of these tundra landscapes is maximal in the whole Antarctic. Moreover, the thickness of parent material debris's is also highest and achieves a 1 or 2 meters as highest. The presence of higher vascular plants Deshampsia antarctica which is considered as one of the main edificators provides the development of humus accumulation in upper solum. Penguins activity provides an intensive soil fertilization and development of plant communities with increased density. All these factors leads to formation of specific and quite diverse soil cover in sub Antarctic tundra's. These ecosystems are presented by following permafrost affected soils: Leptosols, Lithoosols, Crysols, Gleysols, Peats and Ornhitosols. Also the post Ornhitosols are widely spreaded in subantarcic ecosystems, they forms on the penguin rockeries during the plant succession development, leaching of nutrients and organic matter mineralization. "Amphibious" soils are specific for seasonal lakes, which evaporates in the end if Australian summer. These soils have specific features of bio sediments and soils as well. Soil chemical characteristic as well as organic matter features discussed in comparison with Antacrtic continental soil in presentation.

  5. The Osservatorio Geofisico Sperimentale marine magnetic surveys in the Antarctic Seas

    Directory of Open Access Journals (Sweden)

    C. Zanolla

    1999-06-01

    Full Text Available About 40 000 km of marine magnetic and gradiometric data have been collected during eight geophysical surveys conducted since the Austral summer 1987/1988 in the circum-antarctic seas, by the research vessel OGS-Explora. For the most surveyed areas (Ross Sea, Southwestern Pacific Ocean, and Southern Scotia Sea, the analysis of the acquired data have contributed to clarify important aspects of their geological structure and tectonic evolution. The main scientific results, obtained combining other available geophysical data (multichannel seismic profiles and satellite-derived data, will be briefly illustrated.

  6. Impact of increasing antarctic glacial freshwater release on regional sea-ice cover in the Southern Ocean

    Science.gov (United States)

    Merino, Nacho; Jourdain, Nicolas C.; Le Sommer, Julien; Goosse, Hugues; Mathiot, Pierre; Durand, Gael

    2018-01-01

    The sensitivity of Antarctic sea-ice to increasing glacial freshwater release into the Southern Ocean is studied in a series of 31-year ocean/sea-ice/iceberg model simulations. Glaciological estimates of ice-shelf melting and iceberg calving are used to better constrain the spatial distribution and magnitude of freshwater forcing around Antarctica. Two scenarios of glacial freshwater forcing have been designed to account for a decadal perturbation in glacial freshwater release to the Southern Ocean. For the first time, this perturbation explicitly takes into consideration the spatial distribution of changes in the volume of Antarctic ice shelves, which is found to be a key component of changes in freshwater release. In addition, glacial freshwater-induced changes in sea ice are compared to typical changes induced by the decadal evolution of atmospheric states. Our results show that, in general, the increase in glacial freshwater release increases Antarctic sea ice extent. But the response is opposite in some regions like the coastal Amundsen Sea, implying that distinct physical mechanisms are involved in the response. We also show that changes in freshwater forcing may induce large changes in sea-ice thickness, explaining about one half of the total change due to the combination of atmospheric and freshwater changes. The regional contrasts in our results suggest a need for improving the representation of freshwater sources and their evolution in climate models.

  7. Antarctic Circumpolar Current Dynamics and Their Relation to Antarctic Ice Sheet and Perennial Sea-Ice Variability in the Central Drake Passage During the Last Climate Cycle

    Science.gov (United States)

    Kuhn, G.; Wu, S.; Hass, H. C.; Klages, J. P.; Zheng, X.; Arz, H. W.; Esper, O.; Hillenbrand, C. D.; Lange, C.; Lamy, F.; Lohmann, G.; Müller, J.; McCave, I. N. N.; Nürnberg, D.; Roberts, J.; Tiedemann, R.; Timmermann, A.; Titschack, J.; Zhang, X.

    2017-12-01

    The evolution of the Antarctic Ice Sheet during the last climate cycle and the interrelation to global atmospheric and ocean circulation remains controversial and plays an important role for our understanding of ice sheet response to modern global warming. The timing and sequence of deglacial warming is relevant for understanding the variability and sensitivity of the Antarctic Ice Sheet to climatic changes, and the continuing rise of atmospheric greenhouse gas concentrations. The Antarctic Ice Sheet is a pivotal component of the global water budget. Freshwater fluxes from the ice sheet may affect the Antarctic Circumpolar Current (ACC), which is strongly impacted by the westerly wind belt in the Southern Hemisphere (SHWW) and constricted to its narrowest extent in the Drake Passage. The flow of ACC water masses through Drake Passage is, therefore, crucial for advancing our understanding of the Southern Ocean's role in global meridional overturning circulation and global climate change. In order to address orbital and millennial-scale variability of the Antarctic ice sheet and the ACC, we applied a multi-proxy approach on a sediment core from the central Drake Passage including grain size, iceberg-rafted debris, mineral dust, bulk chemical and mineralogical composition, and physical properties. In combination with already published and new sediment records from the Drake Passage and Scotia Sea, as well as high-resolution data from Antarctic ice cores (WDC, EDML), we now have evidence that during glacial times a more northerly extent of the perennial sea-ice zone decreased ACC current velocities in the central Drake Passage. During deglaciation the SHWW shifted southwards due to a decreasing temperature gradient between subtropical and polar latitudes caused by sea ice and ice sheet decline. This in turn caused Southern Hemisphere warming, a more vigorous ACC, stronger Southern Ocean ventilation, and warm Circumpolar Deep Water (CDW) upwelling on Antarctic shelves

  8. Water masses, ocean fronts, and the structure of Antarctic seabird communities: putting the eastern Bellingshausen Sea in perspective

    Science.gov (United States)

    Ribic, Christine A.; Ainley, David G.; Ford, R. Glenn; Fraser, William R.; Tynan, Cynthia T.; Woehler, Eric J.

    2015-01-01

    Waters off the western Antarctic Peninsula (i.e., the eastern Bellingshausen Sea) are unusually complex owing to the convergence of several major fronts. Determining the relative influence of fronts on occurrence patterns of top-trophic species in that area, therefore, has been challenging. In one of the few ocean-wide seabird data syntheses, in this case for the Southern Ocean, we analyzed ample, previously collected cruise data, Antarctic-wide, to determine seabird species assemblages and quantitative relationships to fronts as a way to provide context to the long-term Palmer LTER and the winter Southern Ocean GLOBEC studies in the eastern Bellingshausen Sea. Fronts investigated during both winter (April–September) and summer (October–March) were the southern boundary of the Antarctic Circumpolar Current (ACC), which separates the High Antarctic from the Low Antarctic water mass, and within which are embedded the marginal ice zone and Antarctic Shelf Break Front; and the Antarctic Polar Front, which separates the Low Antarctic and the Subantarctic water masses. We used clustering to determine species' groupings with water masses, and generalized additive models to relate species' densities, biomass and diversity to distance to respective fronts. Antarctic-wide, in both periods, highest seabird densities and lowest species diversity were found in the High Antarctic water mass. In the eastern Bellingshausen, seabird density in the High Antarctic water mass was lower (as low as half that of winter) than found in other Antarctic regions. During winter, Antarctic-wide, two significant species groups were evident: one dominated by Adélie penguins (Pygoscelis adeliae) (High Antarctic water mass) and the other by petrels and prions (no differentiation among water masses); in eastern Bellingshausen waters during winter, the one significant species group was composed of species from both Antarctic-wide groups. In summer, Antarctic-wide, a High Antarctic group

  9. The response of spider (Araneae assemblages to structural heterogeneity and prey abundance in sub-montane vegetation modified by conservation grazing

    Directory of Open Access Journals (Sweden)

    Peter Dennis

    2015-01-01

    Full Text Available The effect of experimental livestock grazing regimens (4 treatments×6 replicates on spiders via habitat structure and prey abundance was investigated on sub-montane habitats in the Southern Highlands of Scotland. The study, 2002–2004 included a baseline survey under the prior, commercial sheep grazing regimen and two assessments of spider assemblages post-treatment: commercial stocking density of sheep; 1/3 stocking density with sheep; 1/3 stocking density cattle with sheep; and no grazing. Spiders were sampled with a suction sampler, five sucks at each of 25 sample units by 24 plots (600 samples in 2003 and 2004, ca. 320 in 2002. Spider abundance and species richness increased under reduced stocking density, mixed herbivore and ungrazed treatments indirectly via changes in vegetation structure and prey abundance. The results refuted a meta-analysis that concluded species richness of spiders is unaffected by grazing. Grazing regimens caused turnover in species composition more than the net difference in species richness suggested, implying that no single, optimal grazing regimen will support as many species as a patchwork under varied grazing management. Conservation grazing benefits spiders and will have significant benefits for food webs in sub-montane ecosystems but the period to equilibrium after changes to grazing requires further investigation.

  10. Satellite Remote Sensing of Snow Depth on Antarctic Sea Ice: An Inter-Comparison of Two Empirical Approaches

    Directory of Open Access Journals (Sweden)

    Stefan Kern

    2016-05-01

    Full Text Available Snow on Antarctic sea ice plays a key role for sea ice physical processes and complicates retrieval of sea ice thickness using altimetry. Current methods of snow depth retrieval are based on satellite microwave radiometry, which perform best for dry, homogeneous snow packs on level sea ice. We introduce an alternative approach based on in-situ measurements of total (sea ice plus snow freeboard and snow depth, which we use to compute snow depth on sea ice from Ice, Cloud, and land Elevation Satellite (ICESat total freeboard observations. We compare ICESat snow depth for early winter and spring of the years 2004 through 2006 with the Advanced Scanning Microwave Radiometer aboard EOS (AMSR-E snow depth product. We find ICESat snow depths agree more closely with ship-based visual and air-borne snow radar observations than AMSR-E snow depths. We obtain average modal and mean ICESat snow depths, which exceed AMSR-E snow depths by 5–10 cm in winter and 10–15 cm in spring. We observe an increase in ICESat snow depth from winter to spring for most Antarctic regions in accordance with ground-based observations, in contrast to AMSR-E snow depths, which we find to stay constant or to decrease. We suggest satellite laser altimetry as an alternative method to derive snow depth on Antarctic sea ice, which is independent of snow physical properties.

  11. Tropically driven and externally forced patterns of Antarctic sea ice change: reconciling observed and modeled trends

    Science.gov (United States)

    Schneider, David P.; Deser, Clara

    2017-09-01

    Recent work suggests that natural variability has played a significant role in the increase of Antarctic sea ice extent during 1979-2013. The ice extent has responded strongly to atmospheric circulation changes, including a deepened Amundsen Sea Low (ASL), which in part has been driven by tropical variability. Nonetheless, this increase has occurred in the context of externally forced climate change, and it has been difficult to reconcile observed and modeled Antarctic sea ice trends. To understand observed-model disparities, this work defines the internally driven and radiatively forced patterns of Antarctic sea ice change and exposes potential model biases using results from two sets of historical experiments of a coupled climate model compared with observations. One ensemble is constrained only by external factors such as greenhouse gases and stratospheric ozone, while the other explicitly accounts for the influence of tropical variability by specifying observed SST anomalies in the eastern tropical Pacific. The latter experiment reproduces the deepening of the ASL, which drives an increase in regional ice extent due to enhanced ice motion and sea surface cooling. However, the overall sea ice trend in every ensemble member of both experiments is characterized by ice loss and is dominated by the forced pattern, as given by the ensemble-mean of the first experiment. This pervasive ice loss is associated with a strong warming of the ocean mixed layer, suggesting that the ocean model does not locally store or export anomalous heat efficiently enough to maintain a surface environment conducive to sea ice expansion. The pervasive upper-ocean warming, not seen in observations, likely reflects ocean mean-state biases.

  12. Tropically driven and externally forced patterns of Antarctic sea ice change: reconciling observed and modeled trends

    Science.gov (United States)

    Schneider, David P.; Deser, Clara

    2018-06-01

    Recent work suggests that natural variability has played a significant role in the increase of Antarctic sea ice extent during 1979-2013. The ice extent has responded strongly to atmospheric circulation changes, including a deepened Amundsen Sea Low (ASL), which in part has been driven by tropical variability. Nonetheless, this increase has occurred in the context of externally forced climate change, and it has been difficult to reconcile observed and modeled Antarctic sea ice trends. To understand observed-model disparities, this work defines the internally driven and radiatively forced patterns of Antarctic sea ice change and exposes potential model biases using results from two sets of historical experiments of a coupled climate model compared with observations. One ensemble is constrained only by external factors such as greenhouse gases and stratospheric ozone, while the other explicitly accounts for the influence of tropical variability by specifying observed SST anomalies in the eastern tropical Pacific. The latter experiment reproduces the deepening of the ASL, which drives an increase in regional ice extent due to enhanced ice motion and sea surface cooling. However, the overall sea ice trend in every ensemble member of both experiments is characterized by ice loss and is dominated by the forced pattern, as given by the ensemble-mean of the first experiment. This pervasive ice loss is associated with a strong warming of the ocean mixed layer, suggesting that the ocean model does not locally store or export anomalous heat efficiently enough to maintain a surface environment conducive to sea ice expansion. The pervasive upper-ocean warming, not seen in observations, likely reflects ocean mean-state biases.

  13. New Visualizations Highlight New Information on the Contrasting Arctic and Antarctic Sea-Ice Trends Since the Late 1970s

    Science.gov (United States)

    Parkinson, Claire L.; DiGirolamo, Nicolo E.

    2016-01-01

    Month-by-month ranking of 37 years (1979-2015) of satellite-derived sea-ice extents in the Arctic and Antarctic reveals interesting new details in the overall trends toward decreasing sea-ice coverage in the Arctic and increasing sea-ice coverage in the Antarctic. The Arctic decreases are so definitive that there has not been a monthly record high in Arctic sea-ice extents in any month since 1986, a time period during which there have been 75 monthly record lows. The Antarctic, with the opposite but weaker trend toward increased ice extents, experienced monthly record lows in 5 months of 1986, then 6 later monthly record lows scattered through the dataset, with the last two occurring in 2006, versus 45 record highs since 1986. However, in the last three years of the 1979-2015 dataset, the downward trends in Arctic sea-ice extents eased up, with no new record lows in any month of 2013 or 2014 and only one record low in 2015,while the upward trends in Antarctic ice extents notably strengthened, with new record high ice extents in 4 months (August-November) of 2013, in 6 months (April- September) of 2014, and in 3 months (January, April, and May) of 2015. Globally, there have been only 3 monthly record highs since 1986 (only one since 1988), whereas there have been 43 record lows, although the last record lows (in the 1979-2015 dataset) occurred in 2012.

  14. Prey and seasonal abundance of killer whales at sub-Antarctic ...

    African Journals Online (AJOL)

    The diet of killer whales Orcinus orca was investigated from 48 predation events observed during sightings at sub-Antarctic Marion Island between 2006 and 2009. From these events, there were 10 cases where prey could be identified. Killer whales fed on fur seals Arctocephalus tropicalis, elephant seals Mirounga leonina ...

  15. The role of feedbacks in Antarctic sea ice change

    Science.gov (United States)

    Feltham, D. L.; Frew, R. C.; Holland, P.

    2017-12-01

    The changes in Antarctic sea ice over the last thirty years have a strong seasonal dependence, and the way these changes grow in spring and decay in autumn suggests that feedbacks are strongly involved. The changes may ultimately be caused by atmospheric warming, the winds, snowfall changes, etc., but we cannot understand these forcings without first untangling the feedbacks. A highly simplified coupled sea ice -mixed layer model has been developed to investigate the importance of feedbacks on the evolution of sea ice in two contrasting regions in the Southern Ocean; the Amundsen Sea where sea ice extent has been decreasing, and the Weddell Sea where it has been expanding. The change in mixed layer depth in response to changes in the atmosphere to ocean energy flux is implicit in a strong negative feedback on ice cover changes in the Amundsen Sea, with atmospheric cooling leading to a deeper mixed layer resulting in greater entrainment of warm Circumpolar Deep Water, causing increased basal melting of sea ice. This strong negative feedback produces counter intuitive responses to changes in forcings in the Amundsen Sea. This feedback is absent in the Weddell due to the complete destratification and strong water column cooling that occurs each winter in simulations. The impact of other feedbacks, including the albedo feedback, changes in insulation due to ice thickness and changes in the freezing temperature of the mixed layer, were found to be of secondary importance compared to changes in the mixed layer depth.

  16. An Ensemble Analysis of Antarctic Glacial Isostatic Adjustment and Sea Level

    Science.gov (United States)

    Lecavalier, B.; Tarasov, L.

    2016-12-01

    Inferences of past ice sheet evolution that lack any uncertainty assessment (implicit or explicit), have little value. A developing technique for explicit uncertainty quantification of glacial systems is Bayesian calibration of models against large observational data-sets (Tarasov et al., 2012). The foundation for a Bayesian calibration of a 3D glacial systems model (GSM) for Antarctica has recently been completed (Briggs et al., 2013; 2014; Briggs and Tarasov, 2013). Bayesian calibration thoroughly samples model uncertainties against fits to observational data to generate a probability distribution for the Antarctic Ice Sheet deglaciation with explicit and well-defined confidence intervals. To have validity as a complete inference of past ice sheet evolution, Bayesian calibration requires a model that "brackets reality".Past work has shown the GSM to have likely inadequate range of grounding line migration in certain sectors as well as persistent ice thickness biases in topographically complex regions (Briggs et al., 2014). To advance towards full calibration, these deficiencies are being addressed through a number of model developments. The grounding line scheme has been revised (Pollard and DeConto, 2012), the horizontal resolution is increased to 20 km, and boundary conditions are updated. The basal drag representation now includes the sub-grid treatment of the thermo-mechanical impacts of high basal roughness. Parametric uncertainties in basal drag for regions that are presently marine have been re-evaluated. The impact of past changes in ocean temperature on sub ice shelf melt is explicitly incorporated in the current ocean forcing parametric scheme. Uncertainties in earth rheology are also probed to robustly quantify uncertainties affiliated with glacial isostatic adjustment. The ensemble analysis of the Antarctic glacial system provides dynamical bounds on past and present Antarctica glacial isostatic adjustment and sea level contributions. This research

  17. Resolving the Antarctic contribution to sea-level rise: a hierarchical modelling framework.

    Science.gov (United States)

    Zammit-Mangion, Andrew; Rougier, Jonathan; Bamber, Jonathan; Schön, Nana

    2014-06-01

    Determining the Antarctic contribution to sea-level rise from observational data is a complex problem. The number of physical processes involved (such as ice dynamics and surface climate) exceeds the number of observables, some of which have very poor spatial definition. This has led, in general, to solutions that utilise strong prior assumptions or physically based deterministic models to simplify the problem. Here, we present a new approach for estimating the Antarctic contribution, which only incorporates descriptive aspects of the physically based models in the analysis and in a statistical manner. By combining physical insights with modern spatial statistical modelling techniques, we are able to provide probability distributions on all processes deemed to play a role in both the observed data and the contribution to sea-level rise. Specifically, we use stochastic partial differential equations and their relation to geostatistical fields to capture our physical understanding and employ a Gaussian Markov random field approach for efficient computation. The method, an instantiation of Bayesian hierarchical modelling, naturally incorporates uncertainty in order to reveal credible intervals on all estimated quantities. The estimated sea-level rise contribution using this approach corroborates those found using a statistically independent method. © 2013 The Authors. Environmetrics Published by John Wiley & Sons, Ltd.

  18. Resolving the Antarctic contribution to sea-level rise: a hierarchical modelling framework†

    Science.gov (United States)

    Zammit-Mangion, Andrew; Rougier, Jonathan; Bamber, Jonathan; Schön, Nana

    2014-01-01

    Determining the Antarctic contribution to sea-level rise from observational data is a complex problem. The number of physical processes involved (such as ice dynamics and surface climate) exceeds the number of observables, some of which have very poor spatial definition. This has led, in general, to solutions that utilise strong prior assumptions or physically based deterministic models to simplify the problem. Here, we present a new approach for estimating the Antarctic contribution, which only incorporates descriptive aspects of the physically based models in the analysis and in a statistical manner. By combining physical insights with modern spatial statistical modelling techniques, we are able to provide probability distributions on all processes deemed to play a role in both the observed data and the contribution to sea-level rise. Specifically, we use stochastic partial differential equations and their relation to geostatistical fields to capture our physical understanding and employ a Gaussian Markov random field approach for efficient computation. The method, an instantiation of Bayesian hierarchical modelling, naturally incorporates uncertainty in order to reveal credible intervals on all estimated quantities. The estimated sea-level rise contribution using this approach corroborates those found using a statistically independent method. © 2013 The Authors. Environmetrics Published by John Wiley & Sons, Ltd. PMID:25505370

  19. Aspects of reproductive ecology and benthic-pelagic coupling in the sub-antarctic sea cucumber Pseudostichopus mollis (Theel)

    Science.gov (United States)

    Morgan, Andrew; Neal, Lance

    2012-07-01

    For deeper regions of the continental shelf environmental cues entraining reproduction in echinoderms are often absent, which contributes to adoption of continuous reproduction, having larger eggs, and a lecithotrophic mode of larval development. In the present study the sub-Antarctic sea cucumber Pseudostichopus mollis from the family Synallactidae was obtained during June (winter) and September (spring) from a depth of approximately 300 m north of the Auckland Islands in an area abundant in biogenic sediments. Samples were processed for body indices and gonad development. Features characteristic of non-continuous reproduction were exhibited. Although a larger egg size was found (212±14 μm), two distinct winter cohorts of oocytes occurred (41-81 and 161-201 μm) and body wall weight fluctuations (7.6% increase in males and 27.5% reduction in females) coincided with changes in gonad indices between sample dates. For males gonad as a proportion of body wall weight decreased from 3.31±0.9 to 2.11±0.37% and for females it increased from 1.59±0.28 to 2.5±0.30%. For both sample dates the gonad of males maintained mature spermatozoa whereas female gonad shifted from mainly recovery and growth of oocytes to growth and advanced growth of mature oocytes. In habitats with low or variable food availability intermittent reproduction is predicted as resources are too low for a high reproductive effort and too erratic for synchrony. A pattern of reproduction where fluctuations in seasonal organic input into an accumulated benthic food source initiates and synchronises gametogenesis for future spawning is proposed.

  20. Observational Evidence of a Hemispheric-wide Ice-ocean Albedo Feedback Effect on Antarctic Sea-ice Decay

    Science.gov (United States)

    Nihashi, Sohey; Cavalieri, Donald J.

    2007-01-01

    The effect of ice-ocean albedo feedback (a kind of ice-albedo feedback) on sea-ice decay is demonstrated over the Antarctic sea-ice zone from an analysis of satellite-derived hemispheric sea ice concentration and European Centre for Medium-Range Weather Forecasts (ERA-40) atmospheric data for the period 1979-2001. Sea ice concentration in December (time of most active melt) correlates better with the meridional component of the wind-forced ice drift (MID) in November (beginning of the melt season) than the MID in December. This 1 month lagged correlation is observed in most of the Antarctic sea-ice covered ocean. Daily time series of ice , concentration show that the ice concentration anomaly increases toward the time of maximum sea-ice melt. These findings can be explained by the following positive feedback effect: once ice concentration decreases (increases) at the beginning of the melt season, solar heating of the upper ocean through the increased (decreased) open water fraction is enhanced (reduced), leading to (suppressing) a further decrease in ice concentration by the oceanic heat. Results obtained fi-om a simple ice-ocean coupled model also support our interpretation of the observational results. This positive feedback mechanism explains in part the large interannual variability of the sea-ice cover in summer.

  1. New records of Acari from the sub-Antarctic Prince Edward Islands

    NARCIS (Netherlands)

    Marshall, D.J.; Gremmen, N.J.M.; Coetzee, L.; Oconnor, B.M.; Pugh, P.J.A.; Theron, P.D.; Ueckermann, E.A.

    1999-01-01

    Sixty species of Acari are recorded from the sub-Antarctic Marion and Prince Edward Islands (the Prince Edward archipelago). Twenty of the 45 species collected on recent expeditions are new and currently undescribed. Other new taxa include a family of Mesostigmata, four new genera, and the first

  2. Sea-level response to melting of Antarctic ice shelves on multi-centennial timescales with the fast Elementary Thermomechanical Ice Sheet model (f.ETISh v1.0

    Directory of Open Access Journals (Sweden)

    F. Pattyn

    2017-08-01

    Full Text Available The magnitude of the Antarctic ice sheet's contribution to global sea-level rise is dominated by the potential of its marine sectors to become unstable and collapse as a response to ocean (and atmospheric forcing. This paper presents Antarctic sea-level response to sudden atmospheric and oceanic forcings on multi-centennial timescales with the newly developed fast Elementary Thermomechanical Ice Sheet (f.ETISh model. The f.ETISh model is a vertically integrated hybrid ice sheet–ice shelf model with vertically integrated thermomechanical coupling, making the model two-dimensional. Its marine boundary is represented by two different flux conditions, coherent with power-law basal sliding and Coulomb basal friction. The model has been compared to existing benchmarks. Modelled Antarctic ice sheet response to forcing is dominated by sub-ice shelf melt and the sensitivity is highly dependent on basal conditions at the grounding line. Coulomb friction in the grounding-line transition zone leads to significantly higher mass loss in both West and East Antarctica on centennial timescales, leading to 1.5 m sea-level rise after 500 years for a limited melt scenario of 10 m a−1 under freely floating ice shelves, up to 6 m for a 50 m a−1 scenario. The higher sensitivity is attributed to higher ice fluxes at the grounding line due to vanishing effective pressure. Removing the ice shelves altogether results in a disintegration of the West Antarctic ice sheet and (partially marine basins in East Antarctica. After 500 years, this leads to a 5 m and a 16 m sea-level rise for the power-law basal sliding and Coulomb friction conditions at the grounding line, respectively. The latter value agrees with simulations by DeConto and Pollard (2016 over a similar period (but with different forcing and including processes of hydrofracturing and cliff failure. The chosen parametrizations make model results largely independent of spatial resolution so

  3. Sea-level response to melting of Antarctic ice shelves on multi-centennial timescales with the fast Elementary Thermomechanical Ice Sheet model (f.ETISh v1.0)

    Science.gov (United States)

    Pattyn, Frank

    2017-08-01

    The magnitude of the Antarctic ice sheet's contribution to global sea-level rise is dominated by the potential of its marine sectors to become unstable and collapse as a response to ocean (and atmospheric) forcing. This paper presents Antarctic sea-level response to sudden atmospheric and oceanic forcings on multi-centennial timescales with the newly developed fast Elementary Thermomechanical Ice Sheet (f.ETISh) model. The f.ETISh model is a vertically integrated hybrid ice sheet-ice shelf model with vertically integrated thermomechanical coupling, making the model two-dimensional. Its marine boundary is represented by two different flux conditions, coherent with power-law basal sliding and Coulomb basal friction. The model has been compared to existing benchmarks. Modelled Antarctic ice sheet response to forcing is dominated by sub-ice shelf melt and the sensitivity is highly dependent on basal conditions at the grounding line. Coulomb friction in the grounding-line transition zone leads to significantly higher mass loss in both West and East Antarctica on centennial timescales, leading to 1.5 m sea-level rise after 500 years for a limited melt scenario of 10 m a-1 under freely floating ice shelves, up to 6 m for a 50 m a-1 scenario. The higher sensitivity is attributed to higher ice fluxes at the grounding line due to vanishing effective pressure. Removing the ice shelves altogether results in a disintegration of the West Antarctic ice sheet and (partially) marine basins in East Antarctica. After 500 years, this leads to a 5 m and a 16 m sea-level rise for the power-law basal sliding and Coulomb friction conditions at the grounding line, respectively. The latter value agrees with simulations by DeConto and Pollard (2016) over a similar period (but with different forcing and including processes of hydrofracturing and cliff failure). The chosen parametrizations make model results largely independent of spatial resolution so that f.ETISh can potentially be

  4. Wiring a Periscope ? Ocelli, Retinula Axons, Visual Neuropils and the Ancestrality of Sea Spiders

    OpenAIRE

    Lehmann, Tobias; He?, Martin; Melzer, Roland R.

    2012-01-01

    The Pycnogonida or sea spiders are cryptic, eight-legged arthropods with four median ocelli in a 'periscope' or eye tubercle. In older attempts at reconstructing phylogeny they were Arthropoda incertae sedis, but recent molecular trees placed them as the sister group either to all other euchelicerates or even to all euarthropods. Thus, pycnogonids are among the oldest extant arthropods and hold a key position for the understanding of arthropod evolution. This has stimulated studies of new set...

  5. How reversible is sea ice loss?

    Directory of Open Access Journals (Sweden)

    J. K. Ridley

    2012-02-01

    Full Text Available It is well accepted that increasing atmospheric CO<sub>2sub> results in global warming, leading to a decline in polar sea ice area. Here, the specific question of whether there is a tipping point in the sea ice cover is investigated. The global climate model HadCM3 is used to map the trajectory of sea ice area under idealised scenarios. The atmospheric CO<sub>2sub> is first ramped up to four times pre-industrial levels (4 × CO<sub>2sub>, then ramped down to pre-industrial levels. We also examine the impact of stabilising climate at 4 × CO<sub>2sub> prior to ramping CO<sub>2sub> down to pre-industrial levels. Against global mean temperature, Arctic sea ice area is reversible, while the Antarctic sea ice shows some asymmetric behaviour – its rate of change slower, with falling temperatures, than its rate of change with rising temperatures. However, we show that the asymmetric behaviour is driven by hemispherical differences in temperature change between transient and stabilisation periods. We find no irreversible behaviour in the sea ice cover.

  6. Stable isotope and sea-level data from New Guinea supports Antarctic ice-surge theory of ice ages

    International Nuclear Information System (INIS)

    Aharon, P.; Chappell, J.; Compston, W.

    1980-01-01

    Two theories of glaciation which have received considerable attention, the Milankovitch orbital theory and the Antarctic surge hypothesis, are discussed. Oxygen-18 and sea-level data obtained from the coral reefs of Huon Peninsula, Papua New Guinea which contain a particularly good record of the interval 140-105 kyr, are presented. These seem to require an Antarctic surge at 120 kyr and also have a bearing on the role of the Milankovitch factor. (UK)

  7. Stable isotope and sea-level data from New Guinea supports Antarctic ice-surge theory of ice ages

    Energy Technology Data Exchange (ETDEWEB)

    Aharon, P; Chappell, J; Compston, W [Australian National Univ., Canberra. Inst. of Advanced Studies

    1980-02-14

    Two theories of glaciation which have received considerable attention, the Milankovitch orbital theory and the Antarctic surge hypothesis, are discussed. Oxygen-18 and sea-level data obtained from the coral reefs of Huon Peninsula, Papua New Guinea which contain a particularly good record of the interval 140-105 kyr, are presented. These seem to require an Antarctic surge at 120 kyr and also have a bearing on the role of the Milankovitch factor.

  8. (Pre-) calibration of a Reduced Complexity Model of the Antarctic Contribution to Sea-level Changes

    Science.gov (United States)

    Ruckert, K. L.; Guan, Y.; Shaffer, G.; Forest, C. E.; Keller, K.

    2015-12-01

    (Pre-) calibration of a Reduced Complexity Model of the Antarctic Contribution to Sea-level ChangesKelsey L. Ruckert1*, Yawen Guan2, Chris E. Forest1,3,7, Gary Shaffer 4,5,6, and Klaus Keller1,7,81 Department of Geosciences, The Pennsylvania State University, University Park, Pennsylvania, USA 2 Department of Statistics, The Pennsylvania State University, University Park, Pennsylvania, USA 3 Department of Meteorology, The Pennsylvania State University, University Park, Pennsylvania, USA 4 GAIA_Antarctica, University of Magallanes, Punta Arenas, Chile 5 Center for Advanced Studies in Arid Zones, La Serena, Chile 6 Niels Bohr Institute, University of Copenhagen, Copenhagen, Denmark 7 Earth and Environmental Systems Institute, The Pennsylvania State University, University Park, Pennsylvania, USA 8 Department of Engineering and Public Policy, Carnegie Mellon University, Pittsburgh, Pennsylvania, USA * Corresponding author. E-mail klr324@psu.eduUnderstanding and projecting future sea-level changes poses nontrivial challenges. Sea-level changes are driven primarily by changes in the density of seawater as well as changes in the size of glaciers and ice sheets. Previous studies have demonstrated that a key source of uncertainties surrounding sea-level projections is the response of the Antarctic ice sheet to warming temperatures. Here we calibrate a previously published and relatively simple model of the Antarctic ice sheet over a hindcast period from the last interglacial period to the present. We apply and compare a range of (pre-) calibration methods, including a Bayesian approach that accounts for heteroskedasticity. We compare the model hindcasts and projections for different levels of model complexity and calibration methods. We compare the projections with the upper bounds from previous studies and find our projections have a narrower range in 2100. Furthermore we discuss the implications for the design of climate risk management strategies.

  9. Dynamics of sea-ice biogeochemistry in the coastal Antarctica during transition from summer to winter

    Digital Repository Service at National Institute of Oceanography (India)

    Shetye, S; Jena, B.; Mohan, R.

    The seasonality of carbon dioxide partial pressure (pCO<sub>2sub>), air-sea CO<sub>2sub> fluxes and associated environmental parameters were investigated in the Antarctic coastal waters. The in-situ survey was carried out from the austral summer...

  10. Photoluminescent properties of spider silk coated with Eu-doped nanoceria

    Energy Technology Data Exchange (ETDEWEB)

    Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

    2017-02-15

    Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

  11. Effects of sea-ice extent and krill or salp dominance on the Antarctic food web

    Science.gov (United States)

    Loeb, V.; Siegel, V.; Holm-Hansen, O.; Hewitt, R.; Fraser, W.; Trivelpiece, W.; Trivelpiece, S.

    1997-06-01

    Krill (Euphausia superba) provide a direct link between primary producers and higher trophic levels in the Antarctic marine food web. The pelagic tunicate Salpa thompsoni can also be important during spring and summer through the formation of extensive and dense blooms. Although salps are not a major dietary item for Antarctic vertebrate predators,, their blooms can affect adult krill reproduction and survival of krill larvae. Here we provide data from 1995 and 1996 that support hypothesized relationships between krill, salps and region-wide sea-ice conditions,. We have assessed salp consumption as a proportion of net primary production, and found correlations between herbivore densities and integrated chlorophyll-a that indicate that there is a degree of competition between krill and salps. Our analysis of the relationship between annual sea-ice cover and a longer time series of air temperature measurements, indicates a decreased frequency of winters with extensive sea-ice development over the last five decades. Our data suggest that decreased krill availability may affect the levels of their vertebrate predators. Regional warming and reduced krill abundance therefore affect the marine food web and krill resource management.

  12. Potential sea-level rise from Antarctic ice-sheet instability constrained by observations

    Science.gov (United States)

    Ritz, Catherine; Edwards, Tamsin L.; Durand, Gaël; Payne, Antony J.; Peyaud, Vincent; Hindmarsh, Richard C. A.

    2015-12-01

    Large parts of the Antarctic ice sheet lying on bedrock below sea level may be vulnerable to marine-ice-sheet instability (MISI), a self-sustaining retreat of the grounding line triggered by oceanic or atmospheric changes. There is growing evidence that MISI may be underway throughout the Amundsen Sea embayment (ASE), which contains ice equivalent to more than a metre of global sea-level rise. If triggered in other regions, the centennial to millennial contribution could be several metres. Physically plausible projections are challenging: numerical models with sufficient spatial resolution to simulate grounding-line processes have been too computationally expensive to generate large ensembles for uncertainty assessment, and lower-resolution model projections rely on parameterizations that are only loosely constrained by present day changes. Here we project that the Antarctic ice sheet will contribute up to 30 cm sea-level equivalent by 2100 and 72 cm by 2200 (95% quantiles) where the ASE dominates. Our process-based, statistical approach gives skewed and complex probability distributions (single mode, 10 cm, at 2100; two modes, 49 cm and 6 cm, at 2200). The dependence of sliding on basal friction is a key unknown: nonlinear relationships favour higher contributions. Results are conditional on assessments of MISI risk on the basis of projected triggers under the climate scenario A1B (ref. 9), although sensitivity to these is limited by theoretical and topographical constraints on the rate and extent of ice loss. We find that contributions are restricted by a combination of these constraints, calibration with success in simulating observed ASE losses, and low assessed risk in some basins. Our assessment suggests that upper-bound estimates from low-resolution models and physical arguments (up to a metre by 2100 and around one and a half by 2200) are implausible under current understanding of physical mechanisms and potential triggers.

  13. Preconditioning of Antarctic maximum sea-ice extent by upper-ocean stratification on a seasonal timescale

    OpenAIRE

    Su, Zhan

    2017-01-01

    This study uses an observationally constrained and dynamically consistent ocean and sea ice state estimate. The author presents a remarkable agreement between the location of the edge of Antarctic maximum sea ice extent, reached in September, and the narrow transition band for the upper ocean (0–100 m depths) stratification, as early as April to June. To the south of this edge, the upper ocean has high stratification, which forbids convective fluxes to cross through; consequently, the ocean h...

  14. Past and present stability of the Weddell Sea sector of the Antarctic Ice Sheet

    Science.gov (United States)

    Whitehouse, P. L.; Vieli, A.; Jamieson, S.; Bentley, M.; Hein, A.; Sugden, D.

    2016-12-01

    The contribution of the Weddell Sea sector of the Antarctic Ice Sheet to sea-level rise since the Last Glacial Maximum (LGM), along with the processes controlling the past and ongoing dynamics of this sector, are poorly known. Of particular concern is the fact that significant portions of the present-day grounding line are unstably located on bathymetry that deepens towards the interior of the continent. We present new modelling results, constrained by field evidence relating to past ice extent and thickness along the Foundation Ice Stream and Thiel Trough, which suggest that the post-LGM sea-level contribution from this sector was modest, and that the grounding line is unlikely to have been located at the continental shelf break for a prolonged period during the last glacial cycle. Poorly-constrained ice shelf and ocean processes are found to play a crucial role in controlling the past configuration and stability of this sector of the ice sheet. In particular, we find that we cannot rule out a scenario in which the grounding line of the Foundation Ice Stream retreated behind present during deglaciation, and has since re-advanced. This work complements a number of recent studies, based on independent data sets, that explore the possibility that grounding line re-advance occurred within the Weddell Sea sector during the mid-to-late Holocene. If this hypothesis is correct, then current glacial isostatic adjustment models, and hence contemporary estimates of ice mass balance derived from GRACE data, will be significantly biased. Piecing together, and understanding, the reason for recent changes in ice dynamics is crucial for determining the contemporary stability of the Weddell Sea sector of the Antarctic Ice Sheet.

  15. Rapid changes in surface water carbonate chemistry during Antarctic sea ice melt

    Science.gov (United States)

    Jones, Elizabeth M.; Bakker, Dorothee C. E.; Venables, Hugh J.; Whitehouse, Michael J.; Korb, Rebecca E.; Watson, Andrew J.

    2010-11-01

    ABSTRACT The effect of sea ice melt on the carbonate chemistry of surface waters in the Weddell-Scotia Confluence, Southern Ocean, was investigated during January 2008. Contrasting concentrations of dissolved inorganic carbon (DIC), total alkalinity (TA) and the fugacity of carbon dioxide (fCO2) were observed in and around the receding sea ice edge. The precipitation of carbonate minerals such as ikaite (CaCO3.6H2O) in sea ice brine has the net effect of decreasing DIC and TA and increasing the fCO2 in the brine. Deficits in DIC up to 12 +/- 3 μmol kg-1 in the marginal ice zone (MIZ) were consistent with the release of DIC-poor brines to surface waters during sea ice melt. Biological utilization of carbon was the dominant processes and accounted for 41 +/- 1 μmol kg-1 of the summer DIC deficit. The data suggest that the combined effects of biological carbon uptake and the precipitation of carbonates created substantial undersaturation in fCO2 of 95 μatm in the MIZ during summer sea ice melt. Further work is required to improve the understanding of ikaite chemistry in Antarctic sea ice and its importance for the sea ice carbon pump.

  16. The effects of sub-ice-shelf melting on dense shelf water formation and export in idealized simulations of Antarctic margins

    Science.gov (United States)

    Marques, Gustavo; Stern, Alon; Harrison, Matthew; Sergienko, Olga; Hallberg, Robert

    2017-04-01

    Dense shelf water (DSW) is formed in coastal polynyas around Antarctica as a result of intense cooling and brine rejection. A fraction of this water reaches ice shelves cavities and is modified due to interactions with sub-ice-shelf melt water. This modified water mass contributes to the formation of Antarctic Bottom Water, and consequently, influences the large-scale ocean circulation. Here, we investigate the role of sub-ice-shelf melting in the formation and export of DSW using idealized simulations with an isopycnal ocean model (MOM6) coupled with a sea ice model (SIS2) and a thermodynamic active ice shelf. A set of experiments is conducted with variable horizontal grid resolutions (0.5, 1.0 and 2.0 km), ice shelf geometries and atmospheric forcing. In all simulations DSW is spontaneously formed in coastal polynyas due to the combined effect of the imposed atmospheric forcing and the ocean state. Our results show that sub-ice-shelf melting can significantly change the rate of dense shelf water outflows, highlighting the importance of this process to correctly represent bottom water formation.

  17. Modelling the Antarctic Ice Sheet

    DEFF Research Database (Denmark)

    Pedersen, Jens Olaf Pepke; Holm, A.

    2015-01-01

    to sea level high stands during past interglacial periods. A number of AIS models have been developed and applied to try to understand the workings of the AIS and to form a robust basis for future projections of the AIS contribution to sea level change. The recent DCESS (Danish Center for Earth System......The Antarctic ice sheet is a major player in the Earth’s climate system and is by far the largest depository of fresh water on the planet. Ice stored in the Antarctic ice sheet (AIS) contains enough water to raise sea level by about 58 m, and ice loss from Antarctica contributed significantly...

  18. Boundary layer new particle formation over East Antarctic sea ice – possible Hg-driven nucleation?

    Directory of Open Access Journals (Sweden)

    R. S. Humphries

    2015-12-01

    Full Text Available Aerosol observations above the Southern Ocean and Antarctic sea ice are scarce. Measurements of aerosols and atmospheric composition were made in East Antarctic pack ice on board the Australian icebreaker Aurora Australis during the spring of 2012. One particle formation event was observed during the 32 days of observations. This event occurred on the only day to exhibit extended periods of global irradiance in excess of 600 W m−2. Within the single air mass influencing the measurements, number concentrations of particles larger than 3 nm (CN3 reached almost 7700 cm−3 within a few hours of clouds clearing, and grew at rates of 5.6 nm h−1. Formation rates of 3 nm particles were in the range of those measured at other Antarctic locations at 0.2–1.1 ± 0.1 cm−3 s−1. Our investigations into the nucleation chemistry found that there were insufficient precursor concentrations for known halogen or organic chemistry to explain the nucleation event. Modelling studies utilising known sulfuric acid nucleation schemes could not simultaneously reproduce both particle formation or growth rates. Surprising correlations with total gaseous mercury (TGM were found that, together with other data, suggest a mercury-driven photochemical nucleation mechanism may be responsible for aerosol nucleation. Given the very low vapour pressures of the mercury species involved, this nucleation chemistry is likely only possible where pre-existing aerosol concentrations are low and both TGM concentrations and solar radiation levels are relatively high (∼ 1.5 ng m−3 and ≥ 600 W m−2, respectively, such as those observed in the Antarctic sea ice boundary layer in this study or in the global free troposphere, particularly in the Northern Hemisphere.

  19. Sea ice contribution to the air-sea CO{sub 2} exchange in the Arctic and Southern Oceans

    Energy Technology Data Exchange (ETDEWEB)

    Rysgaard, Soeren (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Centre for Earth Observation Science, CHR Faculty of Environment Earth and Resources, Univ. of Manitoba, Winnipeg (Canada)), e-mail: rysgaard@natur.gl; Bendtsen, Joergen (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Centre for Ice and Climate, Niels Bohr Inst., Univ. of Copenhagen, Copenhagen O (Denmark)); Delille, Bruno (Unit' e d' Oceanographie Chimique, Interfacultary Centre for Marine Research, Universite de Liege, Liege (Belgium)); Dieckmann, Gerhard S. (Alfred Wegener Inst. for Polar and Marine Research, Bremerhaven (Germany)); Glud, Ronnie N. (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark); Scottish Association of Marine Sciences, Scotland UK, Southern Danish Univ. and NordCee, Odense M (Denmark)); Kennedy, Hilary; Papadimitriou, Stathys (School of Ocean Sciences, Bangor Univ., Menai Bridge, Anglesey, Wales (United Kingdom)); Mortensen, John (Greenland Climate Research Centre, Greenland Inst. of Natural Resources, Nuuk, Greenland (Denmark)); Thomas, David N. (School of Ocean Sciences, Bangor Univ., Menai Bridge, Anglesey, Wales (United Kingdom); Finnish Environment Inst. (SYKE), Marine Research Centre, Helsinki (Finland)); Tison, Jean-Louis (Glaciology Unit, Dept. of Earth and Environmental Sciences, Universite Libre de Bruxelles, Bruxelles, (Belgium))

    2011-11-15

    Although salt rejection from sea ice is a key process in deep-water formation in ice-covered seas, the concurrent rejection of CO{sub 2} and the subsequent effect on air-sea CO{sub 2} exchange have received little attention. We review the mechanisms by which sea ice directly and indirectly controls the air-sea CO{sub 2} exchange and use recent measurements of inorganic carbon compounds in bulk sea ice to estimate that oceanic CO{sub 2} uptake during the seasonal cycle of sea-ice growth and decay in ice-covered oceanic regions equals almost half of the net atmospheric CO{sub 2} uptake in ice-free polar seas. This sea-ice driven CO{sub 2} uptake has not been considered so far in estimates of global oceanic CO{sub 2} uptake. Net CO{sub 2} uptake in sea-ice-covered oceans can be driven by; (1) rejection during sea-ice formation and sinking of CO{sub 2}-rich brine into intermediate and abyssal oceanic water masses, (2) blocking of air-sea CO{sub 2} exchange during winter, and (3) release of CO{sub 2}-depleted melt water with excess total alkalinity during sea-ice decay and (4) biological CO{sub 2} drawdown during primary production in sea ice and surface oceanic waters

  20. A New Limit on CMB Circular Polarization from SPIDER

    Science.gov (United States)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; Van Der List, J. F.; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.

    2017-08-01

    We present a new upper limit on cosmic microwave background (CMB) circular polarization from the 2015 flight of Spider, a balloon-borne telescope designed to search for B-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the nonzero circular-to-linear polarization coupling of the half-wave plate polarization modulators, data from Spider's 2015 Antarctic flight provide a constraint on Stokes V at 95 and 150 GHz in the range 33< {\\ell }< 307. No other limits exist over this full range of angular scales, and Spider improves on the previous limit by several orders of magnitude, providing 95% C.L. constraints on {\\ell }({\\ell }+1){C}{\\ell }{VV}/(2π ) ranging from 141 to 255 μK2 at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain even stronger constraints on circular polarization.

  1. A New Limit on CMB Circular Polarization from SPIDER

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; List, J. F. Van Der; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.

    2017-08-01

    We present a new upper limit on CMB circular polarization from the 2015 flight of SPIDER, a balloon-borne telescope designed to search for $B$-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the non-zero circular-to-linear polarization coupling of the HWP polarization modulators, data from SPIDER's 2015 Antarctic flight provides a constraint on Stokes $V$ at 95 and 150 GHz from $33<\\ell<307$. No other limits exist over this full range of angular scales, and SPIDER improves upon the previous limit by several orders of magnitude, providing 95% C.L. constraints on $\\ell (\\ell+1)C_{\\ell}^{VV}/(2\\pi)$ ranging from 141 $\\mu K ^2$ to 203 $\\mu K ^2$ at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain stronger constraints on circular polarization.

  2. Sea-level response to abrupt ocean warming of Antarctic ice shelves

    Science.gov (United States)

    Pattyn, Frank

    2016-04-01

    Antarctica's contribution to global sea-level rise increases steadily. A fundamental question remains whether the ice discharge will lead to marine ice sheet instability (MISI) and collapse of certain sectors of the ice sheet or whether ice loss will increase linearly with the warming trends. Therefore, we employ a newly developed ice sheet model of the Antarctic ice sheet, called f.ETISh (fast Elementary Thermomechanical Ice Sheet model) to simulate ice sheet response to abrupt perturbations in ocean and atmospheric temperature. The f.ETISh model is a vertically integrated hybrid (SSA/SIA) ice sheet model including ice shelves. Although vertically integrated, thermomechanical coupling is ensured through a simplified representation of ice sheet thermodynamics based on an analytical solution of the vertical temperature profile, including strain heating and horizontal advection. The marine boundary is represented by a flux condition either coherent with power-law basal sliding (Pollard & Deconto (2012) based on Schoof (2007)) or according to Coulomb basal friction (Tsai et al., 2015), both taking into account ice-shelf buttressing. Model initialization is based on optimization of the basal friction field. Besides the traditional MISMIP tests, new tests with respect to MISI in plan-view models have been devised. The model is forced with stepwise ocean and atmosphere temperature perturbations. The former is based on a parametrised sub-shelf melt (limited to ice shelves), while the latter is based on present-day mass balance/surface temperature and corrected for elevation changes. Surface melting is introduced using a PDD model. Results show a general linear response in mass loss to ocean warming. Nonlinear response due to MISI occurs under specific conditions and is highly sensitive to the basal conditions near the grounding line, governed by both the initial conditions and the basal sliding/deformation model. The Coulomb friction model leads to significantly higher

  3. Influence of Ross Sea Bottom Water changes on the warming and freshening of the Antarctic Bottom Water in the Australian-Antarctic Basin

    Directory of Open Access Journals (Sweden)

    K. Shimada

    2012-07-01

    Full Text Available Changes to the properties of Antarctic Bottom Water in the Australian-Antarctic Basin (AA-AABW between the 1990s and 2000s are documented using data from the WOCE Hydrographic Program (WHP and repeated hydrographic surveys. Strong cooling and freshening are observed on isopycnal layers denser than γn = 28.30 kg m−3. Changes in the average salinity and potential temperature below this isopycnal correspond to a basin-wide warming of 1300 ± 200 GW and freshening of 24 ± 3 Gt year−1. Recent changes to dense shelf water in the source regions in the Ross Sea and George V Land can explain the freshening of AA-AABW but not its extensive warming. An alternative mechanism for this warming is a decrease in the supply of AABW from the Ross Sea (RSBW. Hydrographic profiles between the western Ross Sea and George V Land (171–158° E were analyzed with a simple advective-diffusive model to assess the causes of the observed changes. The model suggests that the warming of RSBW observed between the 1970s and 2000s can be explained by a 21 ± 23% reduction in RSBW transport and the enhancement of the vertical diffusion of heat resulting from a 30 ± 7% weakening of the abyssal stratification. The documented freshening of Ross Sea dense shelf water leads to a reduction in both salinity and density stratification. Therefore the direct freshening of RSBW at its source also produces an indirect warming of the RSBW. A simple box model suggests that the changes in RSBW properties and volume transport (a decrease of 6.7% is assumed between the year 1995 and 2005 can explain 51 ± 6% of the warming and 84 ± 10% of the freshening observed in AA-AABW.

  4. Description of Pseudingolfiella possessionis n. sp. (Crustacea, Amphipoda) from sub-Antarctic Île de La Possession, Crozet archipelago: the second freshwater amphipod known from the Antarctic biome, a human introduction of Gondwanan ancestry?

    Science.gov (United States)

    Smet, Willem H De

    2015-03-31

    A new species of freshwater amphipod, Pseudingolfiella possessionis n. sp. (Senticaudata, Pseudingolfiellidae), is described from the submerged moss vegetation of small brooklets at sub-Antarctic Île de La Possession, Crozet archipelago. It constitutes the second freshwater amphipod species known for the sub-Antarctic and Antarctic region, and the fourth member of the genus. The main characters distinguishing it from all congeners are: the spine on the posterior margin of the dactylus, incisor and lamina mobilis of mandible each with 5 teeth, the setation of the maxilliped, the vestigial second article of pleopod 3 in the female, the undulate and laterally notched posterolateral margin of the external ramus of uropods 1 and 2 in the male, the spinulate dorsomedian projection of the telson.

  5. Evidence for link between modelled trends in Antarctic sea ice and underestimated westerly wind changes.

    Science.gov (United States)

    Purich, Ariaan; Cai, Wenju; England, Matthew H; Cowan, Tim

    2016-02-04

    Despite global warming, total Antarctic sea ice coverage increased over 1979-2013. However, the majority of Coupled Model Intercomparison Project phase 5 models simulate a decline. Mechanisms causing this discrepancy have so far remained elusive. Here we show that weaker trends in the intensification of the Southern Hemisphere westerly wind jet simulated by the models may contribute to this disparity. During austral summer, a strengthened jet leads to increased upwelling of cooler subsurface water and strengthened equatorward transport, conducive to increased sea ice. As the majority of models underestimate summer jet trends, this cooling process is underestimated compared with observations and is insufficient to offset warming in the models. Through the sea ice-albedo feedback, models produce a high-latitude surface ocean warming and sea ice decline, contrasting the observed net cooling and sea ice increase. A realistic simulation of observed wind changes may be crucial for reproducing the recent observed sea ice increase.

  6. [Corynosoma hannae Zdzitowiecki, 1984--a parasite of sea leopard from the Pacific sector of Antarctic].

    Science.gov (United States)

    Striukov, A A; Iurakhno, M V

    2007-01-01

    Specimens of the acanthocephalan Corynosoma hannae Zdzitowiecki, 1984 from the Pacific (Balleni islands) and Atlantic (South Shetland) sectors of Antarctic are compared with those from the Pacific sector of Subantarctic (Auckland and Campbell islands). Probably New Zealand sea lion Phocarctos hookeri (Gray, 1844) is the secondary definitive host for Corynosoma hannae. Description and figures of the specimens examined are provided.

  7. The Antarctic Ice Sheet, Sea Ice, and the Ozone Hole: Satellite Observations of how they are Changing

    Science.gov (United States)

    Parkinson, Claire L.

    2012-01-01

    Antarctica is the Earth's coldest and highest continent and has major impacts on the climate and life of the south polar vicinity. It is covered almost entirely by the Earth's largest ice sheet by far, with a volume of ice so great that if all the Antarctic ice were to go into the ocean (as ice or liquid water), this would produce a global sea level rise of about 60 meters (197 feet). The continent is surrounded by sea ice that in the wintertime is even more expansive than the continent itself and in the summertime reduces to only about a sixth of its wintertime extent. Like the continent, the expansive sea ice cover has major impacts, reflecting the sun's radiation back to space, blocking exchanges between the ocean and the atmosphere, and providing a platform for some animal species while impeding other species. Far above the continent, the Antarctic ozone hole is a major atmospheric phenomenon recognized as human-caused and potentially quite serious to many different life forms. Satellites are providing us with remarkable information about the ice sheet, the sea ice, and the ozone hole. Satellite visible and radar imagery are providing views of the large scale structure of the ice sheet never seen before; satellite laser altimetry has produced detailed maps of the topography of the ice sheet; and an innovative gravity-measuring two-part satellite has allowed mapping of regions of mass loss and mass gain on the ice sheet. The surrounding sea ice cover has a satellite record that goes back to the 1970s, allowing trend studies that show a decreasing sea ice presence in the region of the Bellingshausen and Amundsen seas, to the west of the prominent Antarctic Peninsula, but increasing sea ice presence around much of the rest of the continent. Overall, sea ice extent around Antarctica has increased at an average rate of about 17,000 square kilometers per year since the late 1970s, as determined from satellite microwave data that can be collected under both light and

  8. Oxygen hypothesis of polar gigantism not supported by performance of Antarctic pycnogonids in hypoxia

    Science.gov (United States)

    Woods, H. Arthur; Moran, Amy L.; Arango, Claudia P.; Mullen, Lindy; Shields, Chris

    2008-01-01

    Compared to temperate and tropical relatives, some high-latitude marine species are large-bodied, a phenomenon known as polar gigantism. A leading hypothesis on the physiological basis of gigantism posits that, in polar water, high oxygen availability coupled to low metabolic rates relieves constraints on oxygen transport and allows the evolution of large body size. Here, we test the oxygen hypothesis using Antarctic pycnogonids, which have been evolving in very cold conditions (−1.8–0°C) for several million years and contain spectacular examples of gigantism. Pycnogonids from 12 species, spanning three orders of magnitude in body mass, were collected from McMurdo Sound, Antarctica. Individual sea spiders were forced into activity and their performance was measured at different experimental levels of dissolved oxygen (DO). The oxygen hypothesis predicts that, all else being equal, large pycnogonids should perform disproportionately poorly in hypoxia, an outcome that would appear as a statistically significant interaction between body size and oxygen level. In fact, although we found large effects of DO on performance, and substantial interspecific variability in oxygen sensitivity, there was no evidence for size×DO interactions. These data do not support the oxygen hypothesis of Antarctic pycnogonid gigantism and suggest that explanations must be sought in other ecological or evolutionary processes. PMID:19129117

  9. Role of the Tropical Pacific in recent Antarctic Sea-Ice Trends

    Science.gov (United States)

    Codron, F.; Bardet, D.; Allouache, C.; Gastineau, G.; Friedman, A. R.; Douville, H.; Voldoire, A.

    2017-12-01

    The recent (up to 2016) trends in Antarctic sea-ice cover - a global increase masking a dipole between the Ross and Bellingshausen-Weddel seas - are still not well understood, and not reproduced by CMIP5 coupled climate models. We here explore the potential role of atmospheric circulation changes around the Amundsen Sea, themselves possibly forced by tropical SSTs, an explanation that has been recently advanced. As a first check on this hypothesis, we compare the atmospheric circulation trends simulated by atmospheric GCMs coupled with an ocean or with imposed SSTs (AMIP experiment from CMIP5); the latter being in theory able to reproduce changes caused by natural SST variability. While coupled models simulate in aggregate trends that project on the SAM structure, strongest in summer, the AMIP simulations add in the winter season a pronounced Amundsen Sea Low signature (and a PNA signature in the northern hemisphere) both consistent with a Niña-like trend in the tropical Pacific. We then use a specific coupled GCM setup, in which surface wind anomalies over the tropical Pacific are strongly nudged towards the observed ones, including their interannual variability, but the model is free to evolve elsewhere. The two GCMs used then simulate a deepening trend in the Amundsen-Sea Low in winter, and are able to reproduce a dipole in sea-ice cover. Further analysis shows that the sea-ice dipole is partially forced by surface heat flux anomalies in early winter - the extent varying with the region and GCM used. The turbulent heat fluxes then act to damp the anomalies in late winter, which may however be maintained by ice-albedo feedbacks.

  10. The complete mitochondrial genome of the sea spider Achelia bituberculata (Pycnogonida, Ammotheidae: arthropod ground pattern of gene arrangement

    Directory of Open Access Journals (Sweden)

    Lee Yong-Seok

    2007-10-01

    Full Text Available Abstract Background The phylogenetic position of pycnogonids is a long-standing and controversial issue in arthropod phylogeny. This controversy has recently been rekindled by differences in the conclusions based on neuroanatomical data concerning the chelifore and the patterns of Hox expression. The mitochondrial genome of a sea spider, Nymphon gracile (Pycnogonida, Nymphonidae, was recently reported in an attempt to address this issue. However, N. gracile appears to be a long-branch taxon on the phylogenetic tree and exhibits a number of peculiar features, such as 10 tRNA translocations and even an inversion of several protein-coding genes. Sequences of other pycnogonid mitochondrial genomes are needed if the position of pycnogonids is to be elucidated on this basis. Results The complete mitochondrial genome (15,474 bp of a sea spider (Achelia bituberculata belonging to the family Ammotheidae, which combines a number of anatomical features considered plesiomorphic with respect to other pycnogonids, was sequenced and characterized. The genome organization shows the features typical of most metazoan animal genomes (37 tightly-packed genes. The overall gene arrangement is completely identical to the arthropod ground pattern, with one exception: the position of the trnQ gene between the rrnS gene and the control region. Maximum likelihood and Bayesian inference trees inferred from the amino acid sequences of mitochondrial protein-coding genes consistently indicate that the pycnogonids (A. bituberculata and N. gracile may be closely related to the clade of Acari and Araneae. Conclusion The complete mitochondrial genome sequence of A. bituberculata (Family Ammotheidae and the previously-reported partial sequence of Endeis spinosa show the gene arrangement patterns typical of arthropods (Limulus-like, but they differ markedly from that of N. gracile. Phylogenetic analyses based on mitochondrial protein-coding genes showed that Pycnogonida may be

  11. Ferocia gen. nov., a new centric diatom genus (Bacillariophyceae) from the sub-Antarctic region

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Chattová, B.; Lebouvier, M.; Houk, Václav

    2017-01-01

    Roč. 332, č. 1 (2017), s. 22-30 ISSN 1179-3155 R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : centric diatoms * new genus * Melosira * Ferocia * sub-Antarctic Region Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.240, year: 2016

  12. Low salinity and high-level UV-B radiation reduce single-cell activity in antarctic sea ice bacteria.

    Science.gov (United States)

    Martin, Andrew; Hall, Julie; Ryan, Ken

    2009-12-01

    Experiments simulating the sea ice cycle were conducted by exposing microbes from Antarctic fast ice to saline and irradiance regimens associated with the freeze-thaw process. In contrast to hypersaline conditions (ice formation), the simulated release of bacteria into hyposaline seawater combined with rapid exposure to increased UV-B radiation significantly reduced metabolic activity.

  13. Regional genetic diversity patterns in Antarctic hairgrass (Deschampsia antartica Desv.)

    NARCIS (Netherlands)

    van de Wouw, M.J.; Van Dijk, P.J.; Huiskes, A.H.L.

    2008-01-01

    Aim To determine patterns in diversity of a major Antarctic plant species, including relationships of Antarctic populations with those outside the Antarctic zone. Location Antarctic Peninsula, Maritime Antarctica, sub-Antarctic islands, Falkland Islands and South America. Methods Amplified fragment

  14. Submarine geology and geomorphology of active Sub-Antarctic volcanoes: Heard and McDonald Islands

    Science.gov (United States)

    Watson, S. J.; Coffin, M. F.; Whittaker, J. M.; Lucieer, V.; Fox, J. M.; Carey, R.; Arculus, R. J.; Bowie, A. R.; Chase, Z.; Robertson, R.; Martin, T.; Cooke, F.

    2016-12-01

    Heard and McDonald Islands (HIMI) are World Heritage listed sub-Antarctic active volcanic islands in the Southern Indian Ocean. Built atop the Kerguelen Plateau by Neogene-Quaternary volcanism, HIMI represent subaerial exposures of the second largest submarine Large Igneous Province globally. Onshore, processes influencing island evolution include glaciers, weathering, volcanism, vertical tectonics and mass-wasting (Duncan et al. 2016). Waters surrounding HIMI are largely uncharted, due to their remote location. Hence, the extent to which these same processes shape the submarine environment around HIMI has not been investigated. In early 2016, we conducted marine geophysical and geologic surveys around HIMI aboard RV Investigator (IN2016_V01). Results show that volcanic and sedimentary features prominently trend east-west, likely a result of erosion by the eastward flowing Antarctic Circumpolar Current and tidal currents. However, spatial patterns of submarine volcanism and sediment distribution differ substantially between the islands. >70 sea knolls surround McDonald Island suggesting substantial submarine volcanism. Geophysical data reveals hard volcanic seafloor around McDonald Island, whereas Heard Island is characterised by sedimentary sequences tens of meters or more thick and iceberg scours - indicative of glacial processes. Differences in submarine geomorphology are likely due to the active glaciation of Heard Island and differing rock types (Heard: alkali basalt, McDonald: phonolite), and dominant products (clastics vs. lava). Variations may also reflect different magmatic plumbing systems beneath the two active volcanoes (Heard produces larger volumes of more focused lava, whilst McDonald extrudes smaller volumes of more evolved lavas from multiple vents across the edifice). Using geophysical data, corroborated with new and existing geologic data, we present the first geomorphic map revealing the processes that shape the submarine environment around HIMI.

  15. Porifera collection of the Italian National Antarctic Museum (MNA, with an updated checklist from Terra Nova Bay (Ross Sea

    Directory of Open Access Journals (Sweden)

    Claudio Ghiglione

    2018-05-01

    Full Text Available This new dataset presents occurrence data for Porifera collected in the Ross Sea, mainly in the Terra Nova Bay area, and curated at the Italian National Antarctic Museum (MNA, section of Genoa. Specimens were collected in 331 different sampling stations at depths ranging from 17 to 1,100 meters in the framework of 17 different Italian Antarctic expeditions funded by the Italian National Antarctic Research Program (PNRA. A total of 807 specimens, belonging to 144 morphospecies (i.e., 95 taxa identified at species level and 49 classified at least at the genus level is included in the dataset. Nearly half (45% of the species reported here correspond to species already known for Terra Nova Bay. Out of the remaining 55% previously unknown records, under a third (~29% were classified at the species level, while over a quarter (~26% were ascribed to the genus level only and these would require further study. All vouchers are permanently curated at the MNA and are available for study to the scientific community. A 3D model of an uncommon species from the Ross Sea, i.e. Tethyopsis brondstedi (Burton, 1929, is also presented and will be made available for outreach purposes.

  16. Spider-Ant Associations: An Updated Review of Myrmecomorphy, Myrmecophily, and Myrmecophagy in Spiders

    Directory of Open Access Journals (Sweden)

    Paula E. Cushing

    2012-01-01

    Full Text Available This paper provides a summary of the extensive theoretical and empirical work that has been carried out in recent years testing the adaptational significance of various spider-ant associations. Hundreds of species of spiders have evolved close relationships with ants and can be classified as myrmecomorphs, myrmecophiles, or myrmecophages. Myrmecomorphs are Batesian mimics. Their close morphological and behavioral resemblance to ants confers strong survival advantages against visually hunting predators. Some species of spiders have become integrated into the ant society as myrmecophiles or symbionts. These spider myrmecophiles gain protection against their own predators, live in an environment with a stable climate, and are typically surrounded by abundant food resources. The adaptations by which this integration is made possible are poorly known, although it is hypothesized that most spider myrmecophiles are chemical mimics and some are even phoretic on their hosts. The third type of spider-ant association discussed is myrmecophagy—or predatory specialization on ants. A table of known spider myrmecophages is provided as is information on their biology and hunting strategies. Myrmecophagy provides these predators with an essentially unlimited food supply and may even confer other protections to the spiders.

  17. Cytogenetic, cellular, and developmental responses in antarctic sea urchins (Sterechinus neumayeri) following laboratory ultraviolet-B and ambient solar radiation exposures

    International Nuclear Information System (INIS)

    Anderson, S.; Hoffman, J.; Wild, G.; Bosch, I.; Karentz, D.

    1993-01-01

    Increasing ultraviolet-B radiation as a consequence of springtime ozone depletion, could harm antarctic ecosystems. This study uses several techniques for studying genotoxic effects to evaluate UV-B effects in sea urchins from Antarctica. 6 refs., 2 figs

  18. Crustose corallinaceous algae (Rhodophyta) of the New Zealand and United States scientific expedition to the Ross Sea, Balleny Islands, and Macquarie Ridge, 1965

    NARCIS (Netherlands)

    Zaneveld, Jacques S.; Sanford, Robert B.

    1980-01-01

    Fourteen taxa of crustose Corallinaceae are described from a collection of marine algae picked up in Antarctic and sub-Antarctic waters along a Ross Sea — Balleny Islands — Macquarie Island traject aboard the USS Glacier in 1965. Three of these taxa are newly described, i.e. Lithothamnium

  19. Seasonal variations and vertical features of aerosol particles in the Antarctic troposphere

    Directory of Open Access Journals (Sweden)

    K. Hara

    2011-06-01

    Full Text Available Tethered balloon-borne aerosol measurements were conducted at Syowa Station, Antarctica during the 46th Japanese Antarctic expedition (2005–2006. The CN concentration reached a maximum in the summer, although the number concentrations of fine particles (D<sub>p>>0.3 μm and coarse particles (D<sub>p>>2.0 μm increased during the winter–spring. The CN concentration was 30–2200 cm−3 near the surface (surface – 500 m and 7–7250 cm−3 in the lower free troposphere (>1500 m. During the austral summer, higher CN concentration was often observed in the lower free troposphere, where the number concentrations in fine and coarse modes were remarkably lower. The frequent appearance of higher CN concentrations in the free troposphere relative to continuous aerosol measurements at the ground strongly suggests that new particle formation is more likely to occur in the lower free troposphere in Antarctic regions. Seasonal variations of size distribution of fine-coarse particles show that the contribution of the coarse mode was greater in the winter–spring than in summer because of the dominance of sea-salt particles in the winter–spring. The number concentrations of fine and coarse particles were high in air masses from the ocean and mid-latitudes. Particularly, aerosol enhancement was observed not only in the boundary layer, but also in the lower free troposphere during and immediately after Antarctic haze events occurring in May, July and September.

  20. Icebergs, sea ice, blue carbon and Antarctic climate feedbacks.

    Science.gov (United States)

    Barnes, David K A; Fleming, Andrew; Sands, Chester J; Quartino, Maria Liliana; Deregibus, Dolores

    2018-06-28

    Sea ice, including icebergs, has a complex relationship with the carbon held within animals (blue carbon) in the polar regions. Sea-ice losses around West Antarctica's continental shelf generate longer phytoplankton blooms but also make it a hotspot for coastal iceberg disturbance. This matters because in polar regions ice scour limits blue carbon storage ecosystem services, which work as a powerful negative feedback on climate change (less sea ice increases phytoplankton blooms, benthic growth, seabed carbon and sequestration). This resets benthic biota succession (maintaining regional biodiversity) and also fertilizes the ocean with nutrients, generating phytoplankton blooms, which cascade carbon capture into seabed storage and burial by benthos. Small icebergs scour coastal shallows, whereas giant icebergs ground deeper, offshore. Significant benthic communities establish where ice shelves have disintegrated (giant icebergs calving), and rapidly grow to accumulate blue carbon storage. When 5000 km 2 giant icebergs calve, we estimate that they generate approximately 10 6 tonnes of immobilized zoobenthic carbon per year (t C yr -1 ). However, their collisions with the seabed crush and recycle vast benthic communities, costing an estimated 4 × 10 4  t C yr -1 We calculate that giant iceberg formation (ice shelf disintegration) has a net potential of approximately 10 6  t C yr -1 sequestration benefits as well as more widely known negative impacts.This article is part of the theme issue 'The marine system of the West Antarctic Peninsula: status and strategy for progress in a region of rapid change'. © 2018 The Authors.

  1. Attending to detail by communal spider-eating spiders.

    Science.gov (United States)

    Jackson, Robert R; Nelson, Ximena J

    2012-07-01

    Communal predators may often need to make especially intricate foraging decisions, as a predator's success may depend on the actions of its neighbours. Here,we consider the decisions made by Portia africana, a jumping spider (Salticidae) that preys on other spiders, including Oecobius amboseli (Oecobiidae), a small prey spider that lives under small sheets of silk (nests) on the walls of buildings. P. africana juveniles settle near oecobiid nests and then ambush oecobiids as they leave or enter the nest. Two or more P. africana juveniles sometimes settle at the same nest and, when an oecobiid is captured, the P. africana juveniles may share the meal. We investigated the joining decisions made by naïve P. africana juveniles. Experiments were based on using lures (dead spiders positioned in lifelike posture) arranged in a series of 17 different scenes defined by the presence/absence of a nest, the lure types present and the configuration of the lures and the nest. Our findings imply that P. africana juveniles make remarkably precise predatory decisions, with the variables that matter including whether a nest is present, the identity of spiders inside and outside a nest and how spiders are positioned relative to each other and the nest.

  2. Paleocene-Eocene and Plio-Pleistocene sea-level changes as "species pumps" in Southeast Asia: Evidence from Althepus spiders.

    Science.gov (United States)

    Li, Fengyuan; Li, Shuqiang

    2018-05-17

    Sea-level change has been viewed as a primary driver in the formation of biodiversity. Early studies confirmed that Plio-Pleistocene sea-level changes led to the isolation and subsequent genetic differentiation of Southeast (SE) Asian organisms over short geological timescales. However, long-time consequences of sea-level fluctuations remain unclear. Herein, we analyze the evolutionary history of Althepus (spiders) whose distribution encompasses Indo-Burma and the Sunda shelf islands to understand how sea-level changes over shallow and deep timescales effected their history. Our integrative analyses, including phylogeny, divergence times, ancestral area reconstruction and diversification dynamics, reveal an intricate pattern of diversification, probably triggered by sea-level fluctuations during the Paleocene-Eocene and Plio-Pleistocene. The timing of one early divergence between the Indo-Burmese and Sundaic species coincides with late Paleocene and early Eocene high global sea levels, which induced the formation of inland seaways in the Thai-Malay Peninsula. Subsequent lowered sea levels could have provided a land bridge for its dispersal colonization across the Isthmus of Kra. Analyses suggest that Plio-Pleistocene sea-level rises contributed to recent divergence of many species. Thus, our findings cannot reject the hypothesis that sea-level changes during the Paleocene-Eocene and Plio-Pleistocene played a major role in generating biodiversity in SE Asia; sea-level changes can act as "species pumps". Copyright © 2018 Elsevier Inc. All rights reserved.

  3. Forecasting Antarctic Sea Ice Concentrations Using Results of Temporal Mixture Analysis

    Science.gov (United States)

    Chi, Junhwa; Kim, Hyun-Cheol

    2016-06-01

    Sea ice concentration (SIC) data acquired by passive microwave sensors at daily temporal frequencies over extended areas provide seasonal characteristics of sea ice dynamics and play a key role as an indicator of global climate trends; however, it is typically challenging to study long-term time series. Of the various advanced remote sensing techniques that address this issue, temporal mixture analysis (TMA) methods are often used to investigate the temporal characteristics of environmental factors, including SICs in the case of the present study. This study aims to forecast daily SICs for one year using a combination of TMA and time series modeling in two stages. First, we identify temporally meaningful sea ice signatures, referred to as temporal endmembers, using machine learning algorithms, and then we decompose each pixel into a linear combination of temporal endmembers. Using these corresponding fractional abundances of endmembers, we apply a autoregressive model that generally fits all Antarctic SIC data for 1979 to 2013 to forecast SIC values for 2014. We compare our results using the proposed approach based on daily SIC data reconstructed from real fractional abundances derived from a pixel unmixing method and temporal endmember signatures. The proposed method successfully forecasts new fractional abundance values, and the resulting images are qualitatively and quantitatively similar to the reference data.

  4. Diatom and silicoflagellate biostratigraphy for the late Eocene: ODP 1090 (sub-Antarctic Atlantic)

    Science.gov (United States)

    Barron, John A.; Bukry, David B.; Gersonde, Rainer

    2014-01-01

    Abundant and well-preserved diatoms and silicofl agellate assemblages are documented through a complete late Eocene sequence, ODP Hole 1090B, recovered from the southern Agulhas Ridge in the sub-Antarctic South Atlantic. A sequence of Cestodiscus (diatom) species occurrence events involving C. pulchellus var. novazealandica, C. fennerae, C. antarcticus, C. convexus, C. trochus, and C. robustus is tied with paleomagnetic stratigraphy and provides the basis of proposing a new diatom zonation for the latest middle Eocene to early Oligocene (~37.6–33.4 Ma) of the sub-Antarctic South Atlantic. Comparison with previously published diatom occurrence charts suggested this zonation should be applicable throughout the low latitude regions of the world’s oceans. Silicofl agellates belong to the Dictyocha hexacantha and the overlying Corbisema apiculata Zones. The late Eocene succession of silicofl agellate species is dominated by Naviculopsis (20–60%). Naviculopsis constricta and N. foliacea dominate the D. hexacantha Zone, followed by the N. constricta, then N. biapiculata in the C. apiculata Zone. Cold-water Distephanus is most abundant in the latest Eocene along with N. biapiculata. The tops of zonal guide fossils Dictyocha hexacantha and Hannaites quadria (both 36.6 Ma) and Dictyocha spinosa (37.1 Ma) are tied with paleomagnetic stratigraphy.

  5. Enhanced tropospheric BrO over Antarctic sea ice in mid winter observed by MAX-DOAS on board the research vessel Polarstern

    Directory of Open Access Journals (Sweden)

    T. Wagner

    2007-06-01

    Full Text Available We present Multi AXis-Differential Optical Absorption Spectroscopy (MAX-DOAS observations of tropospheric BrO carried out on board the German research vessel Polarstern during the Antarctic winter 2006. Polarstern entered the area of first year sea ice around Antarctica on 24 June 2006 and stayed within this area until 15 August 2006. For the period when the ship cruised inside the first year sea ice belt, enhanced BrO concentrations were almost continuously observed. Outside the first year sea ice belt, typically low BrO concentrations were found. Based on back trajectory calculations we find a positive correlation between the observed BrO differential slant column densities (ΔSCDs and the duration for which the air masses had been in contact with the sea ice surface prior to the measurement. While we can not completely rule out that in several cases the highest BrO concentrations might be located close to the ground, our observations indicate that the maximum BrO concentrations might typically exist in a (possibly extended layer around the upper edge of the boundary layer. Besides the effect of a decreasing pH of sea salt aerosol with altitude and therefore an increase of BrO with height, this finding might be also related to vertical mixing of air from the free troposphere with the boundary layer, probably caused by convection over the warm ocean surface at polynyas and cracks in the ice. Strong vertical gradients of BrO and O<sub>3sub> could also explain why we found enhanced BrO levels almost continuously for the observations within the sea ice. Based on our estimated BrO profiles we derive BrO mixing ratios of several ten ppt, which is slightly higher than many existing observations. Our observations indicate that enhanced BrO concentrations around Antarctica exist about one month earlier than observed by satellite instruments. From detailed radiative transfer simulations we find that MAX-DOAS observations are up to about one order of

  6. Is there a distinct continental slope fauna in the Antarctic?

    Science.gov (United States)

    Kaiser, Stefanie; Griffiths, Huw J.; Barnes, David K. A.; Brandão, Simone N.; Brandt, Angelika; O'Brien, Philip E.

    2011-02-01

    The Antarctic continental slope spans the depths from the shelf break (usually between 500 and 1000 m) to ˜3000 m, is very steep, overlain by 'warm' (2-2.5 °C) Circumpolar Deep Water (CDW), and life there is poorly studied. This study investigates whether life on Antarctica's continental slope is essentially an extension of the shelf or the abyssal fauna, a transition zone between these or clearly distinct in its own right. Using data from several cruises to the Weddell Sea and Scotia Sea, including the ANDEEP (ANtarctic benthic DEEP-sea biodiversity, colonisation history and recent community patterns) I-III, BIOPEARL (BIOdiversity, Phylogeny, Evolution and Adaptive Radiation of Life in Antarctica) 1 and EASIZ (Ecology of the Antarctic Sea Ice Zone) II cruises as well as current databases (SOMBASE, SCAR-MarBIN), four different taxa were selected (i.e. cheilostome bryozoans, isopod and ostracod crustaceans and echinoid echinoderms) and two areas, the Weddell Sea and the Scotia Sea, to examine faunal composition, richness and affinities. The answer has important ramifications to the link between physical oceanography and ecology, and the potential of the slope to act as a refuge and resupply zone to the shelf during glaciations. Benthic samples were collected using Agassiz trawl, epibenthic sledge and Rauschert sled. By bathymetric definition, these data suggest that despite eurybathy in some of the groups examined and apparent similarity of physical conditions in the Antarctic, the shelf, slope and abyssal faunas were clearly separated in the Weddell Sea. However, no such separation of faunas was apparent in the Scotia Sea (except in echinoids). Using a geomorphological definition of the slope, shelf-slope-abyss similarity only changed significantly in the bryozoans. Our results did not support the presence of a homogenous and unique Antarctic slope fauna despite a high number of species being restricted to the slope. However, it remains the case that there may be

  7. Evaluating Potential Tipping Points of Antarctic basins

    Science.gov (United States)

    Durand, G.; Sainan, S.; Pattyn, F.; Jourdain, N.

    2017-12-01

    Antarctica is currently loosing mass and its forthcoming contribution to sea-level rise could substantially increase during the coming centuries. This is essentially due to geometrical constraints, i.e., in regions where grounded ice lies on a bedrock below sea-level sloping down towards the interior of the ice sheet (retrograde slope). For such a configuration the ice sheet is considered potentially unstable, as suggested by theory. However, recent observations on accelerated grounding-line retreat and new insights in modeling Pine Island and Thwaites glaciers give evidence that such self-sustained retreat, called marine ice sheet instability (MISI), has already been on its way. Although West Antarctica appears to be the most vulnerable region for MISI occurrence, similar topographic configurations are also observed in East Antarctica, in the Wilkes Basin in particular. Therefore, evaluating the MISI potential at a pan-Antarctic scale is becoming a priority. Here, using the f.ETISh ice sheet model, an ensemble of simulations of the entire contemporary Antarctic ice sheet has been carried out. In particular, we investigate the debuttressing of ice shelves required to initiate MISI for each coastal region around Antarctica by forcing the model with realistic sub-shelf melt pulses of varying duration and amplitude. We further identify the currently grounded areas where the outlet glaciers could hardly stabilize, the Amundsen Sea Sector being the more prone to large self-sustained retreats. On the contrary, the ability of Cook and Ninnis ice shelves to recover after large perturbations and enough buttress upstream outlet glaciers tends to limit self-sustained retreat of the sector. For each basin, rates of contribution to sea-level rise are discussed together with the RCPs and time when tipping points could be reached and MISI triggered.

  8. Organic compounds and suspended matter in the marine ice of the Eastern Antarctic

    International Nuclear Information System (INIS)

    Nemirovskaya, I.A.; Novigatsky, A.N.

    2005-01-01

    Data on the composition of organic compounds in Antarctic sea ice are virtually non-existent, as most works concentrate on the structure, physical composition and biological properties of the ice. Data is needed for the study of the global carbon cycle and the estimation of background values and anthropogenic compounds. Specific features of the hydrometeorological regime near Antarctica affect the structure of the ice cover and its properties. The transportation of large volumes of snow to the ocean results in the formation of a snow sludge layer which gradually accumulates on the sea surface and freezes into young slush ice. The irregular distribution of snow at the ice surface and seawater infiltration results in the formation of ice with a specific crystalline structure and physiochemical properties. This paper discussed the dissolved and suspended lipids and hydrocarbons, as well as suspended matter (SM) concentrations in snow, sea ice and sub-ice water in coastal zones of the East Antarctic. The data was obtained during the Russian Antarctic Expedition in 2003. Variations in the concentration and distribution of the various substances suggest that they are related to ice forming conditions and to the processes that occur when ice forms, as well as in the interaction of the substances with ice, snow and sub-ice water. The SM and organic compounds are accumulated in layers characterized by intense autochthonous processes. It was noted that the zones stay biogeochemically active even under low temperature conditions. The highest concentrations of organic compounds, along with the biggest variations in their proportions have been discovered in the areas surrounded by penguin colonies near Buromsky Island and Haswell Island's Lake. The presence of significant quantities of PAHs in both pack and seasonal ice of high latitudes indicates that their formation is relatively rapid even at low temperatures. Many biochemical processes are intense under the influence of ice

  9. South African antarctic biological research programme

    CSIR Research Space (South Africa)

    SASCAR

    1981-07-01

    Full Text Available This document provides a description of the past, current and planned South African biological research activities in the sub-Antarctic and Antarctic regions. Future activities will fall under one of the five components of the research programme...

  10. Diatom-induced silicon isotopic fractionation in Antarctic sea ice

    Science.gov (United States)

    Francois, F.; Damien, C.; Jean-Louis, T.; Anthony, W.; Luc, A.

    2006-12-01

    We measured silicon-isotopic composition of dissolved silicon and biogenic silica collected by sequential melting from spring 2003 Antarctic pack ice (Australian sector). Sea ice is a key ecosystem in the Southern Ocean and its melting in spring has been often thought to have a seeding effect for the surface waters, triggering blooms in the mixed layer. This work is the first investigation of the silicon isotopes' proxy in sea ice and allows to estimate the activity of sea-ice diatoms in the different brine structures and the influence of sea- ice diatoms on the spring ice edge blooms. The relative use of the dissolved silicon pool by sea-ice diatoms is usually assessed by calculating nutrient:salinity ratios in the brines. However such an approach is biased by difficulties in evaluating the initial nutrient concentrations in the different brines structures, and by the impossibility to account for late sporadic nutrient replenishments. The silicon-isotopic composition of biogenic silica is a convenient alternative since it integrates an average Si utilization on all generations of diatoms. Measurements were performed on a MC-ICP-MS, in dry plasma mode using external Mg doping. Results are expressed as delta29Si relative to the NBS28 standard. From three sea ice cores with contrasted physico-chemical characteristics, we report significant isotopic fractionations linked to the diatoms activity, with distinct silicon biogeochemical dynamics between different brine structure. The diatoms in snow ice and in brine pockets of frazil or congelation ice have the most positive silicon-isotopic composition (+0.53 to +0.86 p.mil), indicating that they grow in a closed system and use a significant part of the small dissolved silicon pool. In the brine channels and skeletal layer, diatoms display a relatively less positive Si-isotopic composition (+0.41 to +0.70 p.mil), although it is still heavier compared to equilibrium fractionation (+0.38 p.mil). This suggests that they have

  11. Snow depth retrieval from L-band satellite measurements on Arctic and Antarctic sea ice

    Science.gov (United States)

    Maaß, N.; Kaleschke, L.; Wever, N.; Lehning, M.; Nicolaus, M.; Rossmann, H. L.

    2017-12-01

    The passive microwave mission SMOS provides daily coverage of the polar regions and measures at a low frequency of 1.4 GHz (L-band). SMOS observations have been used to operationally retrieve sea ice thickness up to 1 m and to estimate snow depth in the Arctic for thicker ice. Here, we present how SMOS-retrieved snow depths compare with airborne measurements from NASA's Operation IceBridge mission (OIB) and with AMSR-2 satellite retrievals at higher frequencies, and we show first applications to Antarctic sea ice. In previous studies, SMOS and OIB snow depths showed good agreement on spatial scales from 50 to 1000 km for some days and disagreement for other days. Here, we present a more comprehensive comparison of OIB and SMOS snow depths in the Arctic for 2011 to 2015. We find that the SMOS retrieval works best for cold conditions and depends on auxiliary information on ice surface temperature, here provided by MODIS thermal imagery satellite data. However, comparing SMOS and OIB snow depths is difficult because of the different spatial resolutions (SMOS: 40 km, OIB: 40 m). Spatial variability within the SMOS footprint can lead to different snow conditions as seen from SMOS and OIB. Ideally the comparison is made for uniform conditions: Low lead and open water fraction, low spatial and temporal variability of ice surface temperature, no mixture of multi- and first-year ice. Under these conditions and cold temperatures (surface temperatures below -25°C), correlation coefficients between SMOS and OIB snow depths increase from 0.3 to 0.6. A finding from the comparison with AMSR-2 snow depths is that the SMOS-based maps depend less on the age of the sea ice than the maps derived from higher frequencies. Additionally, we show first results of SMOS snow depths for Antarctic sea ice. SMOS observations are compared to measurements of autonomous snow buoys drifting in the Weddell Sea since 2014. For a better comparability of these point measurements with SMOS data, we use

  12. Could the acid-base status of Antarctic sea urchins indicate a better-than-expected resilience to near-future ocean acidification?

    Science.gov (United States)

    Collard, Marie; De Ridder, Chantal; David, Bruno; Dehairs, Frank; Dubois, Philippe

    2015-02-01

    Increasing atmospheric carbon dioxide concentration alters the chemistry of the oceans towards more acidic conditions. Polar oceans are particularly affected due to their low temperature, low carbonate content and mixing patterns, for instance upwellings. Calcifying organisms are expected to be highly impacted by the decrease in the oceans' pH and carbonate ions concentration. In particular, sea urchins, members of the phylum Echinodermata, are hypothesized to be at risk due to their high-magnesium calcite skeleton. However, tolerance to ocean acidification in metazoans is first linked to acid-base regulation capacities of the extracellular fluids. No information on this is available to date for Antarctic echinoderms and inference from temperate and tropical studies needs support. In this study, we investigated the acid-base status of 9 species of sea urchins (3 cidaroids, 2 regular euechinoids and 4 irregular echinoids). It appears that Antarctic regular euechinoids seem equipped with similar acid-base regulation systems as tropical and temperate regular euechinoids but could rely on more passive ion transfer systems, minimizing energy requirements. Cidaroids have an acid-base status similar to that of tropical cidaroids. Therefore Antarctic cidaroids will most probably not be affected by decreasing seawater pH, the pH drop linked to ocean acidification being negligible in comparison of the naturally low pH of the coelomic fluid. Irregular echinoids might not suffer from reduced seawater pH if acidosis of the coelomic fluid pH does not occur but more data on their acid-base regulation are needed. Combining these results with the resilience of Antarctic sea urchin larvae strongly suggests that these organisms might not be the expected victims of ocean acidification. However, data on the impact of other global stressors such as temperature and of the combination of the different stressors needs to be acquired to assess the sensitivity of these organisms to global

  13. A model study of the effect of climate and sea-level change on the evolution of the Antarctic Ice Sheet from the Last Glacial Maximum to 2100

    NARCIS (Netherlands)

    Maris, M. N. A.; Van Wessem, J. M.; Van De Berg, W. J.; De Boer, B.; Oerlemans, J.

    2014-01-01

    Due to a scarcity of observations and its long memory of uncertain past climate, the Antarctic Ice Sheet remains a largely unknown factor in the prediction of global sea level change. As the history of the ice sheet plays a key role in its future evolution, in this study we model the Antarctic Ice

  14. Forecast of Antarctic Sea Ice and Meteorological Fields

    Science.gov (United States)

    Barreira, S.; Orquera, F.

    2017-12-01

    Since 2001, we have been forecasting the climatic fields of the Antarctic sea ice (SI) and surface air temperature, surface pressure and precipitation anomalies for the Southern Hemisphere at the Meteorological Department of the Argentine Naval Hydrographic Service with different techniques that have evolved with the years. Forecast is based on the results of Principal Components Analysis applied to SI series (S-Mode) that gives patterns of temporal series with validity areas (these series are important to determine which areas in Antarctica will have positive or negative SI anomalies based on what happen in the atmosphere) and, on the other hand, to SI fields (T-Mode) that give us the form of the SI fields anomalies based on a classification of 16 patterns. Each T-Mode pattern has unique atmospheric fields associated to them. Therefore, it is possible to forecast whichever atmosphere variable we decide for the Southern Hemisphere. When the forecast is obtained, each pattern has a probability of occurrence and sometimes it is necessary to compose more than one of them to obtain the final result. S-Mode and T-Mode are monthly updated with new data, for that reason the forecasts improved with the increase of cases since 2001. We used the Monthly Polar Gridded Sea Ice Concentrations database derived from satellite information generated by NASA Team algorithm provided monthly by the National Snow and Ice Data Center of USA that begins in November 1978. Recently, we have been experimenting with multilayer Perceptron (neuronal network) with supervised learning and a back-propagation algorithm to improve the forecast. The Perceptron is the most common Artificial Neural Network topology dedicated to image pattern recognition. It was implemented through the use of temperature and pressure anomalies field images that were associated with a the different sea ice anomaly patterns. The variables analyzed included only composites of surface air temperature and pressure anomalies

  15. Do pelagic grazers benefit from sea ice? Insights from the Antarctic sea ice proxy IPSO25

    Directory of Open Access Journals (Sweden)

    K. Schmidt

    2018-04-01

    Full Text Available Sea ice affects primary production in polar regions in multiple ways. It can dampen water column productivity by reducing light or nutrient supply, provide a habitat for ice algae and condition the marginal ice zone (MIZ for phytoplankton blooms on its seasonal retreat. The relative importance of three different carbon sources (sea ice derived, sea ice conditioned, non-sea-ice associated for the polar food web is not well understood, partly due to the lack of methods that enable their unambiguous distinction. Here we analysed two highly branched isoprenoid (HBI biomarkers to trace sea-ice-derived and sea-ice-conditioned carbon in Antarctic krill (Euphausia superba and relate their concentrations to the grazers' body reserves, growth and recruitment. During our sampling in January–February 2003, the proxy for sea ice diatoms (a di-unsaturated HBI termed IPSO25, δ13C  =  −12.5 ± 3.3 ‰ occurred in open waters of the western Scotia Sea, where seasonal ice retreat was slow. In suspended matter from surface waters, IPSO25 was present at a few stations close to the ice edge, but in krill the marker was widespread. Even at stations that had been ice-free for several weeks, IPSO25 was found in krill stomachs, suggesting that they gathered the ice-derived algae from below the upper mixed layer. Peak abundances of the proxy for MIZ diatoms (a tri-unsaturated HBI termed HBI III, δ13C  =  −42.2 ± 2.4 ‰ occurred in regions of fast sea ice retreat and persistent salinity-driven stratification in the eastern Scotia Sea. Krill sampled in the area defined by the ice edge bloom likewise contained high amounts of HBI III. As indicators for the grazer's performance we used the mass–length ratio, size of digestive gland and growth rate for krill, and recruitment for the biomass-dominant calanoid copepods Calanoides acutus and Calanus propinquus. These indices consistently point to blooms in the MIZ as an important feeding

  16. Do pelagic grazers benefit from sea ice? Insights from the Antarctic sea ice proxy IPSO25

    Science.gov (United States)

    Schmidt, Katrin; Brown, Thomas A.; Belt, Simon T.; Ireland, Louise C.; Taylor, Kyle W. R.; Thorpe, Sally E.; Ward, Peter; Atkinson, Angus

    2018-04-01

    Sea ice affects primary production in polar regions in multiple ways. It can dampen water column productivity by reducing light or nutrient supply, provide a habitat for ice algae and condition the marginal ice zone (MIZ) for phytoplankton blooms on its seasonal retreat. The relative importance of three different carbon sources (sea ice derived, sea ice conditioned, non-sea-ice associated) for the polar food web is not well understood, partly due to the lack of methods that enable their unambiguous distinction. Here we analysed two highly branched isoprenoid (HBI) biomarkers to trace sea-ice-derived and sea-ice-conditioned carbon in Antarctic krill (Euphausia superba) and relate their concentrations to the grazers' body reserves, growth and recruitment. During our sampling in January-February 2003, the proxy for sea ice diatoms (a di-unsaturated HBI termed IPSO25, δ13C = -12.5 ± 3.3 ‰) occurred in open waters of the western Scotia Sea, where seasonal ice retreat was slow. In suspended matter from surface waters, IPSO25 was present at a few stations close to the ice edge, but in krill the marker was widespread. Even at stations that had been ice-free for several weeks, IPSO25 was found in krill stomachs, suggesting that they gathered the ice-derived algae from below the upper mixed layer. Peak abundances of the proxy for MIZ diatoms (a tri-unsaturated HBI termed HBI III, δ13C = -42.2 ± 2.4 ‰) occurred in regions of fast sea ice retreat and persistent salinity-driven stratification in the eastern Scotia Sea. Krill sampled in the area defined by the ice edge bloom likewise contained high amounts of HBI III. As indicators for the grazer's performance we used the mass-length ratio, size of digestive gland and growth rate for krill, and recruitment for the biomass-dominant calanoid copepods Calanoides acutus and Calanus propinquus. These indices consistently point to blooms in the MIZ as an important feeding ground for pelagic grazers. Even though ice

  17. Quantitative measures of sexual selection reveal no evidence for sex-role reversal in a sea spider with prolonged paternal care

    OpenAIRE

    Barreto, Felipe S.; Avise, John C.

    2010-01-01

    Taxa in which males alone invest in postzygotic care of offspring are often considered good models for investigating the proffered relationships between sexual selection and mating systems. In the pycnogonid sea spider Pycnogonum stearnsi, males carry large egg masses on their bodies for several weeks, so this species is a plausible candidate for sex-role reversal (greater intensity of sexual selection on females than on males). Here, we couple a microsatellite-based assessment of the mating ...

  18. Application of remotely piloted aircraft systems in observing the atmospheric boundary layer over Antarctic sea ice in winter

    Directory of Open Access Journals (Sweden)

    Marius O. Jonassen

    2015-10-01

    Full Text Available The main aim of this paper is to explore the potential of combining measurements from fixed- and rotary-wing remotely piloted aircraft systems (RPAS to complement data sets from radio soundings as well as ship and sea-ice-based instrumentation for atmospheric boundary layer (ABL profiling. This study represents a proof-of-concept of RPAS observations in the Antarctic sea-ice zone. We present first results from the RV Polarstern Antarctic winter expedition in the Weddell Sea in June–August 2013, during which three RPAS were operated to measure temperature, humidity and wind; a fixed-wing small unmanned meteorological observer (SUMO, a fixed-wing meteorological mini-aerial vehicle, and an advanced mission and operation research quadcopter. A total of 86 RPAS flights showed a strongly varying ABL structure ranging from slightly unstable temperature stratification near the surface to conditions with strong surface-based temperature inversions. The RPAS observations supplement the regular upper air soundings and standard meteorological measurements made during the campaign. The SUMO and quadcopter temperature profiles agree very well and, excluding cases with strong temperature inversions, 70% of the variance in the difference between the SUMO and quadcopter temperature profiles can be explained by natural, temporal, temperature fluctuations. Strong temperature inversions cause the largest differences, which are induced by SUMO's high climb rates and slow sensor response. Under such conditions, the quadcopter, with its slower climb rate and faster sensor, is very useful in obtaining accurate temperature profiles in the lowest 100 m above the sea ice.

  19. Observations of sea-ice conditions in the Antarctic coastal region using ship-board video cameras

    Directory of Open Access Journals (Sweden)

    Haruhito Shimoda

    1997-03-01

    Full Text Available During the 30th, 31st, and 32nd Japanese Antarctic Research Expeditions (JARE-30,JARE-31,and JARE-32, sea-ice conditions were recorded by video camera on board the SHIRASE. Then, the sea-ice images were used to estimate compactness and thickness quantitatively. Analyzed legs are those toward Breid Bay and from Breid Bay to Syowa Station during JARE-30 and JARE-31,and those toward the Prince Olav Coast, from the Prince Olav Coast to Breid Bay, and from Breid Bay to Syowa Station during JARE-32. The results show yearly variations of ice compactness and thickness, latitudinal variations of thickness, and differences in thickness histograms between JARE-30 and JARE-32 in Lutzow-Holm Bay. Albedo values were measured simultaneously by a shortwave radiometer. These values are proportional to those of ice compactness. Finally, we examined the relationship between ice compactness and vertical gradient of air temperature above sea ice.

  20. First records of aphid-pathogenic Entomophthorales in the sub-Antarctic archipelagos of Crozet and Kerguelen

    Directory of Open Access Journals (Sweden)

    Bernard Papierok

    2016-07-01

    Full Text Available Since the 20th century, the sub-Antarctic islands have suffered an increasing number of biological invasions. Despite the large number of publications on this topic, there is a lack of knowledge on parasitism rates of invasive species and on the role of parasites and pathogens to regulate their populations. Six aphid species have been introduced in the archipelagos of Crozet (Île de la Possession, 46° 25’ S–51° 51’ E and Kerguelen (49° 21’ S–70° 13’ E. Five of these species were found infected by entomopathogenic fungi of the order Entomophthorales. All these fungal species are cosmopolitan. Conidiobolus obscurus and Entomophthora planchoniana were the most frequently observed on Île de la Possession and in Archipel des Kerguelen, respectively. This is the first report of pathogenic fungi of aphids on the sub-Antarctic islands. We discuss these results in the light of our current knowledge of these insect pathogens. Their introduction by aphids surviving on plants during transportation is the most likely hypothesis to explain their presence on these remote islands.

  1. Spider Movement, UV Reflectance and Size, but Not Spider Crypsis, Affect the Response of Honeybees to Australian Crab Spiders

    Science.gov (United States)

    Llandres, Ana L.; Rodríguez-Gironés, Miguel A.

    2011-01-01

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees. PMID:21359183

  2. Spider movement, UV reflectance and size, but not spider crypsis, affect the response of honeybees to Australian crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Rodríguez-Gironés, Miguel A

    2011-02-16

    According to the crypsis hypothesis, the ability of female crab spiders to change body colour and match the colour of flowers has been selected because flower visitors are less likely to detect spiders that match the colour of the flowers used as hunting platform. However, recent findings suggest that spider crypsis plays a minor role in predator detection and some studies even showed that pollinators can become attracted to flowers harbouring Australian crab spider when the UV contrast between spider and flower increases. Here we studied the response of Apis mellifera honeybees to the presence of white or yellow Thomisus spectabilis Australian crab spiders sitting on Bidens alba inflorescences and also the response of honeybees to crab spiders that we made easily detectable painting blue their forelimbs or abdomen. To account for the visual systems of crab spider's prey, we measured the reflectance properties of the spiders and inflorescences used for the experiments. We found that honeybees did not respond to the degree of matching between spiders and inflorescences (either chromatic or achromatic contrast): they responded similarly to white and yellow spiders, to control and painted spiders. However spider UV reflection, spider size and spider movement determined honeybee behaviour: the probability that honeybees landed on spider-harbouring inflorescences was greatest when the spiders were large and had high UV reflectance or when spiders were small and reflected little UV, and honeybees were more likely to reject inflorescences if spiders moved as the bee approached the inflorescence. Our study suggests that only the large, but not the small Australian crab spiders deceive their preys by reflecting UV light, and highlights the importance of other cues that elicited an anti-predator response in honeybees.

  3. [History of Polish botanical and mycological researches on sheets of land of Antarctic and Sub-Antarctic in the years 1977-2009].

    Science.gov (United States)

    Köhler, Piotr; Olech, Maria

    2011-01-01

    Antarctic from the late Cretaceous period to the beginning of Melville's continental glaciation. One singled out three floristic stages and were reconstructed their peculiarities in the development of flora. There was also described an early Jurassic flora of Hope Bay (Półwysep Antarktyczny - Antarctic Peninsula) that turned out to be the richest Jurassic flora in the world. From that point of view were analyzed new species of mineral plants. Ecological researches concentrated on the problems connected with several issues and, among others, with the processes of settlement and succession, distribution and ecology of land biotopes, changes in their spatial structure, and state of biotopes' biological mass. The second group of issues concerned the anthropogenous impacts. One also analyzed early stages of synanthropization of flora. Another important issue was recognizing an extent of the pollution of the environment, particularly with base metals. In the years 1977-2009 were published, at least, 426 notes, articles and monographs that were a result of botanical and mycological researches on sheets of land of Antarctic and Sub-Antarctic.

  4. Attentional bias to moving spiders in spider fearful individuals.

    Science.gov (United States)

    Vrijsen, Janna N; Fleurkens, Pascal; Nieuwboer, Wieteke; Rinck, Mike

    2009-05-01

    We investigated if an attentional bias for spiders in spider fearful individuals (SFs) can also be found for moving spiders, rather than static images. In Study 1, 28 SFs and 33 non-anxious controls (NACs) participated in a modified version of the dot probe paradigm: they had to react to a probe that appeared either in the next, previous, or side position of a spider's or a wheel's path. 24 SFs and 29 NACs participated in Study 2, in which a fourth, highly predictable, probe position was added. We expected that moving spiders would capture the attention of SFs. In addition, we tested whether SFs try to predict the movement of the spider to make it less threatening. As expected, SFs showed an attentional bias towards moving spiders. However, both groups reacted fastest to unpredictable movements, indicating that SFs and NACs alike anticipate unpredictable spider movements.

  5. Last Interglacial climate and sea-level evolution from a coupled ice sheet-climate model

    Science.gov (United States)

    Goelzer, Heiko; Huybrechts, Philippe; Loutre, Marie-France; Fichefet, Thierry

    2016-12-01

    As the most recent warm period in Earth's history with a sea-level stand higher than present, the Last Interglacial (LIG, ˜ 130 to 115 kyr BP) is often considered a prime example to study the impact of a warmer climate on the two polar ice sheets remaining today. Here we simulate the Last Interglacial climate, ice sheet, and sea-level evolution with the Earth system model of intermediate complexity LOVECLIM v.1.3, which includes dynamic and fully coupled components representing the atmosphere, the ocean and sea ice, the terrestrial biosphere, and the Greenland and Antarctic ice sheets. In this setup, sea-level evolution and climate-ice sheet interactions are modelled in a consistent framework.Surface mass balance change governed by changes in surface meltwater runoff is the dominant forcing for the Greenland ice sheet, which shows a peak sea-level contribution of 1.4 m at 123 kyr BP in the reference experiment. Our results indicate that ice sheet-climate feedbacks play an important role to amplify climate and sea-level changes in the Northern Hemisphere. The sensitivity of the Greenland ice sheet to surface temperature changes considerably increases when interactive albedo changes are considered. Southern Hemisphere polar and sub-polar ocean warming is limited throughout the Last Interglacial, and surface and sub-shelf melting exerts only a minor control on the Antarctic sea-level contribution with a peak of 4.4 m at 125 kyr BP. Retreat of the Antarctic ice sheet at the onset of the LIG is mainly forced by rising sea level and to a lesser extent by reduced ice shelf viscosity as the surface temperature increases. Global sea level shows a peak of 5.3 m at 124.5 kyr BP, which includes a minor contribution of 0.35 m from oceanic thermal expansion. Neither the individual contributions nor the total modelled sea-level stand show fast multi-millennial timescale variations as indicated by some reconstructions.

  6. Seabed images from Southern Ocean shelf regions off the northern Antarctic Peninsula and in the southeastern Weddell Sea

    Science.gov (United States)

    Piepenburg, Dieter; Buschmann, Alexander; Driemel, Amelie; Grobe, Hannes; Gutt, Julian; Schumacher, Stefanie; Segelken-Voigt, Alexandra; Sieger, Rainer

    2017-07-01

    Recent advances in underwater imaging technology allow for the gathering of invaluable scientific information on seafloor ecosystems, such as direct in situ views of seabed habitats and quantitative data on the composition, diversity, abundance, and distribution of epibenthic fauna. The imaging approach has been extensively used within the research project DynAMo (Dynamics of Antarctic Marine Shelf Ecosystems) at the Alfred Wegener Institute, Helmholtz Centre for Polar and Marine Research Bremerhaven (AWI), which aimed to comparatively assess the pace and quality of the dynamics of Southern Ocean benthos. Within this framework, epibenthic spatial distribution patterns have been comparatively investigated in two regions in the Atlantic sector of the Southern Ocean: the shelf areas off the northern tip of the Antarctic Peninsula, representing a region with above-average warming of surface waters and sea-ice reduction, and the shelves of the eastern Weddell Sea as an example of a stable high-Antarctic marine environment that is not (yet) affected by climate change. The AWI Ocean Floor Observation System (OFOS) was used to collect seabed imagery during two cruises of the German research vessel Polarstern, ANT-XXIX/3 (PS81) to the Antarctic Peninsula from January to March 2013 and ANT-XXXI/2 (PS96) to the Weddell Sea from December 2015 to February 2016. Here, we report on the image and data collections gathered during these cruises. During PS81, OFOS was successfully deployed at a total of 31 stations at water depths between 29 and 784 m. At most stations, series of 500 to 530 pictures ( > 15 000 in total, each depicting a seabed area of approximately 3.45 m2 or 2.3 × 1.5 m) were taken along transects approximately 3.7 km in length. During PS96, OFOS was used at a total of 13 stations at water depths between 200 and 754 m, yielding series of 110 to 293 photos (2670 in total) along transects 0.9 to 2.6 km in length. All seabed images taken during the two cruises

  7. The effect of millennial-scale changes in Arabian Sea denitrification on atmospheric CO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Altabet, M.A.; Higginson, M.J. [University of Massachusetts, New Bedford, MA (United States). School for Marine Science and Technology; Murray, D.W. [Brown University, Providence, RI (United States). Center for Environmental Studies

    2002-07-01

    Most global biogeochemical processes are known to respond to climate change, some of which have the capacity to produce feedbacks through the regulation of atmospheric greenhouse gases. Marine denitrification - the reduction of nitrate to gaseous nitrogen - is an important process in this regard, affecting greenhouse gas concentrations directly through the incidental production of nitrous oxide, and indirectly through modification of the marine nitrogen inventory and hence the biological pump for C0{sub 2}. Although denitrification has been shown to vary with glacial-interglacial cycles, its response to more rapid climate change has not yet been well characterized. Here we present nitrogen isotope ratio, nitrogen content and chlorin abundance data from sediment cores with high accumulation rates on the Oman continental margin that reveal substantial millennial-scale variability in Arabian Sea denitrification and productivity during the last glacial period. The detailed correspondence of these changes with Dansgaard-Oeschger events recorded in Greenland ice cores indicates rapid, century-scale reorganization of the Arabian Sea ecosystem in response to climate excursions, mediated through the intensity of summer monsoonal upwelling. Considering the several-thousand-year residence time of fixed nitrogen in the ocean, the response of global marine productivity to changes in denitrification would have occurred at lower frequency and appears to be related to climatic and atmospheric C0{sub 2} oscillations observed in Antarctic ice cores between 20 and A kyr ago. (author)

  8. Antarctic contribution to sea level rise observed by GRACE with improved GIA correction

    Science.gov (United States)

    Ivins, Erik R.; James, Thomas S.; Wahr, John; Schrama, Ernst J. O.; Landerer, Felix W.; Simon, Karen M.

    2013-06-01

    Antarctic volume changes during the past 21 thousand years are smaller than previously thought, and here we construct an ice sheet history that drives a forward model prediction of the glacial isostatic adjustment (GIA) gravity signal. The new model, in turn, should give predictions that are constrained with recent uplift data. The impact of the GIA signal on a Gravity Recovery and Climate Experiment (GRACE) Antarctic mass balance estimate depends on the specific GRACE analysis method used. For the method described in this paper, the GIA contribution to the apparent surface mass change is re-evaluated to be +55±13 Gt/yr by considering a revised ice history model and a parameter search for vertical motion predictions that best fit the GPS observations at 18 high-quality stations. Although the GIA model spans a range of possible Earth rheological structure values, the data are not yet sufficient for solving for a preferred value of upper and lower mantle viscosity nor for a preferred lithospheric thickness. GRACE monthly solutions from the Center for Space Research Release 04 (CSR-RL04) release time series from January 2003 to the beginning of January 2012, uncorrected for GIA, yield an ice mass rate of +2.9± 29 Gt/yr. The new GIA correction increases the solved-for ice mass imbalance of Antarctica to -57±34 Gt/yr. The revised GIA correction is smaller than past GRACE estimates by about 50 to 90 Gt/yr. The new upper bound to the sea level rise from the Antarctic ice sheet, averaged over the time span 2003.0-2012.0, is about 0.16±0.09 mm/yr.

  9. Increased West Antarctic and unchanged East Antarctic ice discharge over the last 7 years

    Science.gov (United States)

    Gardner, Alex S.; Moholdt, Geir; Scambos, Ted; Fahnstock, Mark; Ligtenberg, Stefan; van den Broeke, Michiel; Nilsson, Johan

    2018-02-01

    Ice discharge from large ice sheets plays a direct role in determining rates of sea-level rise. We map present-day Antarctic-wide surface velocities using Landsat 7 and 8 imagery spanning 2013-2015 and compare to earlier estimates derived from synthetic aperture radar, revealing heterogeneous changes in ice flow since ˜ 2008. The new mapping provides complete coastal and inland coverage of ice velocity north of 82.4° S with a mean error of image pairs acquired during the daylight period. Using an optimized flux gate, ice discharge from Antarctica is 1929 ± 40 Gigatons per year (Gt yr-1) in 2015, an increase of 36 ± 15 Gt yr-1 from the time of the radar mapping. Flow accelerations across the grounding lines of West Antarctica's Amundsen Sea Embayment, Getz Ice Shelf and Marguerite Bay on the western Antarctic Peninsula, account for 88 % of this increase. In contrast, glaciers draining the East Antarctic Ice Sheet have been remarkably constant over the period of observation. Including modeled rates of snow accumulation and basal melt, the Antarctic ice sheet lost ice at an average rate of 183 ± 94 Gt yr-1 between 2008 and 2015. The modest increase in ice discharge over the past 7 years is contrasted by high rates of ice sheet mass loss and distinct spatial patters of elevation lowering. The West Antarctic Ice Sheet is experiencing high rates of mass loss and displays distinct patterns of elevation lowering that point to a dynamic imbalance. We find modest increase in ice discharge over the past 7 years, which suggests that the recent pattern of mass loss in Antarctica is part of a longer-term phase of enhanced glacier flow initiated in the decades leading up to the first continent-wide radar mapping of ice flow.

  10. The Quarantine Protection of Sub-Antarctic Australia: Two Islands, Two Regimes

    Directory of Open Access Journals (Sweden)

    Sandra Potter

    2007-11-01

    Full Text Available Sub-Antarctic Heard Island and Macquarie Island are among Australia’s offshore properties susceptible to colonization by species introduced by humans. While both islands share World Heritage status and are IUCN Category Ia Protected Areas (Strict Nature Reserves, different quarantine protection regimes are in operation. Macquarie Island’s biosecurity appears to be less catered for while the means and likelihood of introductions are greater. The administrative, political, practical and geographical contexts within which quarantine management planning takes place variously impact on the level of quarantine protection provided to both islands. These and other remote sites of high conservation value are unlikely to receive heightened protection until the issues associated with such management contexts receive greater attention.

  11. Arctic and Antarctic Oscillation signatures in tropical coral proxies over the South China Sea

    Directory of Open Access Journals (Sweden)

    D.-Y. Gong

    2009-05-01

    Full Text Available Arctic Oscillation (AO and Antarctic Oscillation (AAO are the leading modes of atmospheric circulation in mid-high latitudes. Previous studies have revealed that the climatic influences of the two modes are dominant in extra-tropical regions. This study finds that AO and AAO signals are also well recorded in coral proxies in the tropical South China Sea. There are significant interannual signals of AO and AAO in the strontium (Sr content, which represents the sea surface temperature (SST. Among all the seasons, the most significant correlation occurs during winter in both hemispheres: the strongest AO-Sr and AAO-Sr coral correlations occur in January and August, respectively. This study also determined that the Sr content lags behind AO and AAO by 1–3 months. Large-scale anomalies in sea level pressure and horizontal wind at 850 hPa level support the strength of AO/AAO-coral teleconnections. In addition, a comparison with oxygen isotope records from two coral sites in neighboring oceans yields significant AO and AAO signatures with similar time lags. These results help to better understand monsoon climates and their teleconnection to high-latitude climate changes.

  12. Combustion of available fossil-fuel resources sufficient to eliminate the Antarctic Ice Sheet

    Science.gov (United States)

    Winkelmann, R.; Levermann, A.; Ridgwell, A.; Caldeira, K.

    2015-12-01

    The Antarctic Ice Sheet stores water equivalent to 58 meters in global sea-level rise. Here we show in simulations with the Parallel Ice Sheet Model that burning the currently attainable fossil-fuel resources is sufficient to eliminate the ice sheet. With cumulative fossil-fuel emissions of 10 000 GtC, Antarctica is projected to become almost ice-free with an average contribution to sea-level rise exceeding 3 meters per century during the first millennium. Consistent with recent observations and simulations, the West Antarctic Ice Sheet becomes unstable with 600 to 800 GtC of additional carbon emissions. Beyond this additional carbon release, the destabilization of ice basins in both West- and East Antarctica results in a threshold-increase in global sea level. Unabated carbon emissions thus threaten the Antarctic Ice Sheet in its entirety with associated sea-level rise that far exceeds that of all other possible sources.

  13. Rapid extraction of uranium from sea water using Fe{sub 3}O{sub 4} and humic acid coated Fe{sub 3}O{sub 4} nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Singhal, Pallavi, E-mail: psinghal@barc.gov.in [Homi Bhabha National Institute, Mumbai 400094 (India); Health Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Jha, Sanjay K. [Homi Bhabha National Institute, Mumbai 400094 (India); Health Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Pandey, Shailaja P. [Analytical Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Neogy, Suman [Mechanical Metallurgy Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2017-08-05

    Highlights: • Uranium extraction using Fe{sub 3}O{sub 4} and HA coated Fe{sub 3}O{sub 4} NPs has been demonstrated. • Result indicates uranium extraction from both water and sea water matrix. • With increase in HA coating uranium extraction increases. • Fe{sub 3}O{sub 4}/HA 1 is the best material among synthesized one for uranium extraction. - Abstract: Uranium is one of the most toxic elements present in the environment and a number of methods have been developed for its extraction. Herein we have demonstrated a new method using magnetic nanoparticles (NPs) that can be used for uranium extraction from water and sea water matrix. Fe{sub 3}O{sub 4} and humic acid (HA) coated Fe{sub 3}O{sub 4} NPs with different amount of HA coating were synthesized and uranium sorption from water and sea water matrix was demonstrated. It was observed that sorption increases with increase in amount of HA coating. NPs settlement in presence of magnetic field was monitored where only bare Fe{sub 3}O{sub 4} and Fe{sub 3}O{sub 4}/HA 1 NPs settles while no settlement was observed for Fe{sub 3}O{sub 4}/HA 2 and Fe{sub 3}O{sub 4}/HA 3 NPs. Considering both sorption and particle separation from the matrix Fe{sub 3}O{sub 4}/HA 1 NPs are the best among synthesized ones with maximum sorption capacity of 10.5 mg of U/g of NPs. The results presented here reveal the exceptional potential of magnetic NPs and functionalized magnetic NPs for environmental remediation of uranium and to extract uranium from sea water on which to the best of our knowledge no report is available till now.

  14. Estimation of Antarctic Land-Fast Sea Ice Algal Biomass and Snow Thickness From Under-Ice Radiance Spectra in Two Contrasting Areas

    Science.gov (United States)

    Wongpan, P.; Meiners, K. M.; Langhorne, P. J.; Heil, P.; Smith, I. J.; Leonard, G. H.; Massom, R. A.; Clementson, L. A.; Haskell, T. G.

    2018-03-01

    Fast ice is an important component of Antarctic coastal marine ecosystems, providing a prolific habitat for ice algal communities. This work examines the relationships between normalized difference indices (NDI) calculated from under-ice radiance measurements and sea ice algal biomass and snow thickness for Antarctic fast ice. While this technique has been calibrated to assess biomass in Arctic fast ice and pack ice, as well as Antarctic pack ice, relationships are currently lacking for Antarctic fast ice characterized by bottom ice algae communities with high algal biomass. We analyze measurements along transects at two contrasting Antarctic fast ice sites in terms of platelet ice presence: near and distant from an ice shelf, i.e., in McMurdo Sound and off Davis Station, respectively. Snow and ice thickness, and ice salinity and temperature measurements support our paired in situ optical and biological measurements. Analyses show that NDI wavelength pairs near the first chlorophyll a (chl a) absorption peak (≈440 nm) explain up to 70% of the total variability in algal biomass. Eighty-eight percent of snow thickness variability is explained using an NDI with a wavelength pair of 648 and 567 nm. Accounting for pigment packaging effects by including the ratio of chl a-specific absorption coefficients improved the NDI-based algal biomass estimation only slightly. Our new observation-based algorithms can be used to estimate Antarctic fast ice algal biomass and snow thickness noninvasively, for example, by using moored sensors (time series) or mapping their spatial distributions using underwater vehicles.

  15. Geology and geochronology of the sub-Antarctic Snares Islands/Tini Heke, New Zealand

    International Nuclear Information System (INIS)

    Scott, J.M.; Turnbull, I.M.; Sagar, M.W.; Tulloch, A.J.; Waight, T.E.; Palin, J.M.

    2015-01-01

    The first comprehensive geological map, a summary of lithologies and new radiogenic isotope data (U-Pb, Rb-Sr) are presented for crystalline rocks of the Sub-Antarctic Snares Islands/Tini Heke, 150 km south of Stewart Island. The main lithology is Snares Granite (c. 109 Ma from U-Pb dating of zircon), which intrudes Broughton Granodiorite (c. 114 Ma from U-Pb zircon) on Broughton Island. Rafts of schist within Snares Granite are common on the outlying Western Chain islets, and rare on North East and Broughton islands. Zircon grains extracted from one schistose raft on Broughton Island are prismatic and yield an essentially unimodal age population of c. 116 Ma that is within error of the granodiorite. These properties suggest that the dated raft represents a meta-igneous rock despite its mica-rich nature. Some schistose rocks on the Western Chain contain coarse relict plagioclase phenocrysts and appear to have an igneous protolith. No conclusive metasedimentary rocks have been identified, although sillimanite-bearing mica-rich schist occurs on Rua. Deformation of the crystalline rocks occurred after Snares Granite intrusion and before cooling below muscovite K-Ar closure at 400 ± 50 degrees C at 95 Ma. This period overlaps the age of extensional ductile shear zones on Stewart Island. The discovery of several basaltic dykes, which cut across fabrics and are unmetamorphosed, indicates that volcanic rocks are associated with all Sub-Antarctic island groups. The larger of the islands are overlain by peat, which on North East Island also contains gravel deposits. (author).

  16. Increased West Antarctic and unchanged East Antarctic ice discharge over the last 7 years

    NARCIS (Netherlands)

    Gardner, Alex S.; Moholdt, Geir; Scambos, Ted; Fahnstock, Mark; Ligtenberg, Stefan; van den Broeke, Michiel; Nilsson, Johan

    2018-01-01

    Ice discharge from large ice sheets plays a direct role in determining rates of sea-level rise. We map present-day Antarctic-wide surface velocities using Landsat 7 and 8 imagery spanning 2013–2015 and compare to earlier estimates derived from synthetic aperture radar, revealing heterogeneous

  17. Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

    DEFF Research Database (Denmark)

    Pekár, Stanislav; Martisová, Martina; Bilde, T.

    2011-01-01

    lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

  18. Observation of hydro-acoustic signal from the Balleny Islands, Ross Sea, Antarctic: Seasonal ice activities and earthquakes from Pacific-Antarctic ridge

    Science.gov (United States)

    Hong, J. K.; Kang, S. G.; Dziak, R. P.; Park, Y.; Lau, T. K. A.; Haxel, J.; Matsumoto, H.

    2017-12-01

    From January 2015 to March 2016, five hydrophone moorings were deployed near the Balleny Islands to obtain the long-term hydroacoustic record as a collaborative effort between the NOAA/Pacific Marine Environmental Laboratory and the Korea Polar Research Institute. The goal of this hydro-acoustic project is to understand seasonal sea-ice activities and identify potential underwater volcanic sources within the Balleny seamounts. All five of the hydrophone moorings were recovered in March 2016, however only three of them recorded 14 months of continuous, broadband (1 kHz sample rate) hydro-acoustic data successfully. In spite of coordinating problem by partial recovery, recorded data contain valuable information for seasonal sea-ice activities and earthquakes from Pacific-Antarctic Ridge. We analyzed events from ice-quakes and earthquakes statistically. The number of ice-quakes is maximum in the austral summer while minimum in the austral winter which shows a clear seasonal pattern consistent with freeze-thaw cycles. Comparing with global earthquakes catalogue, number of earthquake events are correlated well with the catalogue. Because the austral winter is more calm by ice-quakes, however, we can detect more earthquakes in this season.

  19. The Impacts of 3-D Earth Structure on GIA-Induced Crustal Deformation and Future Sea-Level Change in the Antarctic

    Science.gov (United States)

    Powell, E. M.; Hay, C.; Latychev, K.; Gomez, N. A.; Mitrovica, J. X.

    2017-12-01

    Glacial Isostatic Adjustment (GIA) models used to constrain the extent of past ice sheets and viscoelastic Earth structure, or to correct geodetic and geological observables for ice age effects, generally only consider depth-dependent variations in Earth viscosity and lithospheric structure. A et al. [2013] argued that 3-D Earth structure could impact GIA observables in Antarctica, but concluded that the presence of such structure contributes less to GIA uncertainty than do differences in Antarctic deglaciation histories. New seismic and geological evidence, however, indicates the Antarctic is underlain by complex, high amplitude variability in viscoelastic structure, including a low viscosity zone (LVZ) under West Antarctica. Hay et al. [2016] showed that sea-level fingerprints of modern melting calculated using such Earth models differ from those based on elastic or 1-D viscoelastic Earth models within decades of melting. Our investigation is motivated by two questions: (1) How does 3-D Earth structure, especially this LVZ, impact observations of GIA-induced crustal deformation associated with the last deglaciation? (2) How will 3-D Earth structure affect predictions of future sea-level rise in Antarctica? We compute the gravitationally self-consistent sea level, uplift, and gravity changes using the finite volume treatment of Latychev et al. [2005]. We consider four viscoelastic Earth models: a global 1-D model; a regional, West Antarctic-like 1-D model; a 3-D model where the lithospheric thickness varies laterally; and a 3-D model where both viscosity and lithospheric thickness vary laterally. For our Last Glacial Maximum to present investigations we employ ICE6g [Peltier et al., 2015]. For our present-future investigations we consider a melt scenario consistent with GRACE satellite gravity derived solutions [Harig et al., 2015]. Our calculations indicate that predictions of crustal deformations due to both GIA and ongoing melting are strongly influenced by 3-D

  20. Combustion of available fossil fuel resources sufficient to eliminate the Antarctic Ice Sheet.

    Science.gov (United States)

    Winkelmann, Ricarda; Levermann, Anders; Ridgwell, Andy; Caldeira, Ken

    2015-09-01

    The Antarctic Ice Sheet stores water equivalent to 58 m in global sea-level rise. We show in simulations using the Parallel Ice Sheet Model that burning the currently attainable fossil fuel resources is sufficient to eliminate the ice sheet. With cumulative fossil fuel emissions of 10,000 gigatonnes of carbon (GtC), Antarctica is projected to become almost ice-free with an average contribution to sea-level rise exceeding 3 m per century during the first millennium. Consistent with recent observations and simulations, the West Antarctic Ice Sheet becomes unstable with 600 to 800 GtC of additional carbon emissions. Beyond this additional carbon release, the destabilization of ice basins in both West and East Antarctica results in a threshold increase in global sea level. Unabated carbon emissions thus threaten the Antarctic Ice Sheet in its entirety with associated sea-level rise that far exceeds that of all other possible sources.

  1. WHISPERS Project on the easternmost slope of the Ross Sea (Antarctica): preliminary results.

    Science.gov (United States)

    Olivo, E.; De Santis, L.; Bergamasco, A.; Colleoni, F.; Gales, J. A.; Florindo-Lopez, C.; Kim, S.; Kovacevic, V.; Rebesco, M.

    2017-12-01

    The advance and retreat of the West Antarctic Ice Sheet from the outer continental shelf and the oceanic circulation are the main causes of the depositional processes on the Ross Sea continental slope, at present time and during the most of the Cenozoic. Currently the Antarctic Bottom Water formation is directly linked to the relatively warm Circumpolar Deep Water that, encroaching the continental shelf, mixes with the colder Ross Sea Bottom Water. Detailed multibeam and geological surveys useful to locate and characterize peculiar morphological structures on the bottom are essential to study how the glacial and oceanographic processes interact with the seabed sediments. In the framework of the PNRA-WHISPERS project (XXXIIth Italian Antarctic expedition - January/March 2017), new multibeam bathymetric, sub-bottom chirp, were acquired from the easternmost margin of the Ross Sea, on the southeastern side of the Hayes Bank, usually covered by sea ice. We observed on the upper slope erosional features (incised gullies of likely glacial meltwater origin). A broad scar in the upper slope is characterized by an elongated SSW-NNE ridge (10 km long, 850-1200 m water depth, 2 km wide), that may be a remnants of previous glacial or debris flow deposits, eroded by meltwater outwash discharge at the beginning of grounding ice retreat and by RSBW cascading along the slope, as documented by Expandable Bathy-Thermograph and Acoustic Depth Current Profile data. Sub-bottom chirp profiles crossing this ridge show a very low amplitude reflective sea bed, supporting the hypothesis of its soft sediment nature, in good agreement with a very low acoustic velocity obtained by multichannel seismic data reprocessing. The occurrence of internal stratification on 2D multichannel seismic profiles would discount a gas-fluids related mud volcano origin. No sediment cores were collected, due to bad sea conditions and limited ship time, further data collection would be needed to fully understand

  2. Seasonal variations and vertical features of aerosol particles in the Antarctic troposphere

    Directory of Open Access Journals (Sweden)

    Keiichiro Hara

    2010-12-01

    Full Text Available Tethered balloon-borne aerosol measurements were carried out at Syowa Station, Antarctica during the 46th Japanese Antarctic Research Expedition. CN concentration had a maximum in the summer, whereas the number concentrations of fine particles (D_p>0.3 μm and coarse particles (D_p>2.0 μm increased during the winter-spring. The range of CN concentration was 30-2200 cm^ near the surface (surface-500 m and 7-7250 cm^ in the lower free troposphere (>1500 m. During the austral summer, higher CN concentration was often observed in the lower free troposphere. Frequent appearance of higher CN concentration in the free troposphere relative to the surface measurements strongly suggests that new particle formation in the Antarctic regions occurs in the lower free troposphere. Single particle analysis indicated that most of the aerosol particles during the winter were composed of Mg-enriched sea-salt particles originated from sea-salt fractionation on the sea-ice and their modified particles by NO_3^ and SO_4^. This suggests that sea-salt fractionation on sea-ice and modification of sea-salt particles were affected greatly by aerosol hygroscopicity during the winter. Antarctic haze layer was observed not only in the boundary layer but also in the lower free troposphere.

  3. The seasonal cycle of mixed layer dynamics and phytoplankton biomass in the Sub-Antarctic Zone: A high-resolution glider experiment

    CSIR Research Space (South Africa)

    Swart, S

    2014-06-01

    Full Text Available -resolution glider data (3 hourly, 2 km horizontal resolution), from~6 months of sampling (spring through summer) in the Sub-Antarctic Zone, is used to assess 1) the different forcing mechanisms driving variability in upper ocean physics and 2) how thesemay...

  4. Mapping molecular orientation in dry and wet Nephila clavipes dragline spider silk

    Energy Technology Data Exchange (ETDEWEB)

    Lefevre, Thierry; Pezolet, Michel [Departement de Chimie, Universite Laval, Quebec, QC, G1V 0A6 (Canada); Cooper, Glyn; Cruz, Daniel Hernandez; West, Marcia M; Obst, Martin; Hitchcock, Adam P [BIMR, McMaster University, Hamilton, ON L8S 4M1 (Canada); Karunakaran, Chithra; Kaznatcheev, Konstantine, E-mail: aph@mcmaster.c [Canadian Light Source, University of Saskatchewan, Saskatoon, SK S7N 0X4 (Canada)

    2009-09-01

    The alignment of {beta}-sheets within spider dragline silk fibers is an important factor in their tensile strength and extensibility. We are using linear dichroism of the C 1s {yields} {pi}*{sub amide} transition measured using scanning transmission X-ray microscopy (STXM) to generate quantitative maps of the sub 2}> orientation parameters with 30 nm spatial resolution. Here we have extended these measurements from dry samples to samples with partial or full hydration. A device for monitoring and controlling the humidity of a sample in the STXM is described and used to measure the effect of saturated humidity on a section of N. clavipes dragline spider silk. The microstructure and distributions of molecular orientation change considerably with hydration in ways consistent with the supercontraction observed in free standing dragline spider silk. The STXM results are compared to infrared and Raman microscopy results.

  5. The Effects of Interactive Stratospheric Chemistry on Antarctic and Southern Ocean Climate Change in an AOGCM

    Science.gov (United States)

    Li, Feng; Newman, Paul; Pawson, Steven; Waugh, Darryn

    2014-01-01

    Stratospheric ozone depletion has played a dominant role in driving Antarctic climate change in the last decades. In order to capture the stratospheric ozone forcing, many coupled atmosphere-ocean general circulation models (AOGCMs) prescribe the Antarctic ozone hole using monthly and zonally averaged ozone field. However, the prescribed ozone hole has a high ozone bias and lacks zonal asymmetry. The impacts of these biases on model simulations, particularly on Southern Ocean and the Antarctic sea ice, are not well understood. The purpose of this study is to determine the effects of using interactive stratospheric chemistry instead of prescribed ozone on Antarctic and Southern Ocean climate change in an AOGCM. We compare two sets of ensemble simulations for the 1960-2010 period using different versions of the Goddard Earth Observing System 5 - AOGCM: one with interactive stratospheric chemistry, and the other with prescribed monthly and zonally averaged ozone and 6 other stratospheric radiative species calculated from the interactive chemistry simulations. Consistent with previous studies using prescribed sea surface temperatures and sea ice concentrations, the interactive chemistry runs simulate a deeper Antarctic ozone hole and consistently larger changes in surface pressure and winds than the prescribed ozone runs. The use of a coupled atmosphere-ocean model in this study enables us to determine the impact of these surface changes on Southern Ocean circulation and Antarctic sea ice. The larger surface wind trends in the interactive chemistry case lead to larger Southern Ocean circulation trends with stronger changes in northerly and westerly surface flow near the Antarctica continent and stronger upwelling near 60S. Using interactive chemistry also simulates a larger decrease of sea ice concentrations. Our results highlight the importance of using interactive chemistry in order to correctly capture the influences of stratospheric ozone depletion on climate

  6. Extraction and characterization of collagen from Antarctic and Sub-Antarctic squid and its potential application in hybrid scaffolds for tissue engineering.

    Science.gov (United States)

    Coelho, Rui C G; Marques, Ana L P; Oliveira, Sara M; Diogo, Gabriela S; Pirraco, Rogério P; Moreira-Silva, Joana; Xavier, José C; Reis, Rui L; Silva, Tiago H; Mano, João F

    2017-09-01

    Collagen is the most abundant protein found in mammals and it exhibits a low immunogenicity, high biocompatibility and biodegradability when compared with others natural polymers. For this reason, it has been explored for the development of biologically instructive biomaterials with applications for tissue substitution and regeneration. Marine origin collagen has been pursued as an alternative to the more common bovine and porcine origins. This study focused on squid (Teuthoidea: Cephalopoda), particularly the Antarctic squid Kondakovia longimana and the Sub-Antarctic squid Illex argentinus as potential collagen sources. In this study, collagen has been isolated from the skins of the squids using acid-based and pepsin-based protocols, with the higher yield being obtained from I. argentinus in the presence of pepsin. The produced collagen has been characterized in terms of physicochemical properties, evidencing an amino acid profile similar to the one of calf collagen, but exhibiting a less preserved structure, with hydrolyzed portions and a lower melting temperature. Pepsin-soluble collagen isolated from I. argentinus was selected for further evaluation of biomedical potential, exploring its incorporation on poly-ε-caprolactone (PCL) 3D printed scaffolds for the development of hybrid scaffolds for tissue engineering, exhibiting hierarchical features. Copyright © 2017 Elsevier B.V. All rights reserved.

  7. Determination of the torsion angles of alanine and glycine residues of model compounds of spider silk (AGG){sub 10} using solid-state NMR methods

    Energy Technology Data Exchange (ETDEWEB)

    Ashida, Jun; Ohgo, Kosuke; Komatsu, Kohei; Kubota, Ayumi; Asakura, Tetsuo [Tokyo University of Agriculture and Technology, Department of Biotechnology (Japan)], E-mail: asakura@cc.tuat.ac.jp

    2003-02-15

    Spiders synthesize several kinds of silk fibers. In the primary structure of spider silk, one of the major ampullate (dragline, frame) silks, spidroin 1, and flagelliform silk (core fibers of adhesive spiral), there are common repeated X-Gly-Gly (X = Ala, Leu, Pro, Tyr, Glu, and Arg) sequences, which are considered to be related to the elastic character of these fibers. In this paper, two dimensional spin diffusion solid-state NMR under off magic angle spinning (OMAS), {sup 13}C chemical shift contour plots, and Rotational Echo DOuble Resonance (REDOR) were applied to determine the torsion angles of one Ala and two kinds of Gly residues in the Ala-Gly-Gly sequence of {sup 13}C=O isotope-labeled (Ala-Gly-Gly){sub 10}. The torsion angles were determined to be ({phi}, {psi}) = (-90 deg., 150 deg.) within an experimental error of {+-}10 deg. for each residue. This conformation is characterized as 3{sub 1} helix which is in agreement with the structure proposed from the X-ray powder diffraction pattern of poly(Ala-Gly-Gly). The 3{sub 1} helix of (Ala-Gly-Gly){sub 10} does not change by formic acid treatment although (Ala-Gly){sub 15} easily changes from the silk I conformation (the structure of Bombyx mori silk fibroin before spinning in the solid state) to silk II conformation (the structure of the silk fiber after spinning) by such treatment. Thus, the 3{sub 1} helix conformation of (Ala-Gly-Gly){sub 10} is considered very stable. Furthermore, the torsion angles of the 16th Leu residue of (Leu-Gly-Gly){sub 10} were also determined as ({phi}, {psi}) = (-90 deg., 150 deg.) and this peptide is also considered to take 3{sub 1} helix conformation.

  8. Spiders in dermatology.

    Science.gov (United States)

    Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

    2014-09-01

    Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

  9. Ice-sheet model sensitivities to environmental forcing and their use in projecting future sea level (the SeaRISE project)

    OpenAIRE

    Bindschadler, Robert A.; Nowicki, Sophie; Abe-Ouchi, Ayako; Aschwanden, Andy; Choi, Hyeungu; Fastook, Jim; Granzow, Glen; Greve, Ralf; Gutowski, Gail; Herzfeld, Ute; Jackson, Charles; Johnson, Jesse; Khroulev, Constantine; Levermann, Anders; Lipscomb, William H.

    2013-01-01

    Ten ice-sheet models are used to study sensitivity of the Greenland and Antarctic ice sheets to prescribed changes of surface mass balance, sub-ice-shelf melting and basal sliding. Results exhibit a large range in projected contributions to sea-level change. In most cases, the ice volume above flotation lost is linearly dependent on the strength of the forcing. Combinations of forcings can be closely approximated by linearly summing the contributions from single forcing experiments, suggestin...

  10. Increased West Antarctic and unchanged East Antarctic ice discharge over the last 7 years

    Directory of Open Access Journals (Sweden)

    A. S. Gardner

    2018-02-01

    Full Text Available Ice discharge from large ice sheets plays a direct role in determining rates of sea-level rise. We map present-day Antarctic-wide surface velocities using Landsat 7 and 8 imagery spanning 2013–2015 and compare to earlier estimates derived from synthetic aperture radar, revealing heterogeneous changes in ice flow since ∼ 2008. The new mapping provides complete coastal and inland coverage of ice velocity north of 82.4° S with a mean error of < 10 m yr−1, resulting from multiple overlapping image pairs acquired during the daylight period. Using an optimized flux gate, ice discharge from Antarctica is 1929 ± 40 Gigatons per year (Gt yr−1 in 2015, an increase of 36 ± 15 Gt yr−1 from the time of the radar mapping. Flow accelerations across the grounding lines of West Antarctica's Amundsen Sea Embayment, Getz Ice Shelf and Marguerite Bay on the western Antarctic Peninsula, account for 88 % of this increase. In contrast, glaciers draining the East Antarctic Ice Sheet have been remarkably constant over the period of observation. Including modeled rates of snow accumulation and basal melt, the Antarctic ice sheet lost ice at an average rate of 183 ± 94 Gt yr−1 between 2008 and 2015. The modest increase in ice discharge over the past 7 years is contrasted by high rates of ice sheet mass loss and distinct spatial patters of elevation lowering. The West Antarctic Ice Sheet is experiencing high rates of mass loss and displays distinct patterns of elevation lowering that point to a dynamic imbalance. We find modest increase in ice discharge over the past 7 years, which suggests that the recent pattern of mass loss in Antarctica is part of a longer-term phase of enhanced glacier flow initiated in the decades leading up to the first continent-wide radar mapping of ice flow.

  11. Contribution of sea ice microbial production to Antarctic benthic communities is driven by sea ice dynamics and composition of functional guilds.

    Science.gov (United States)

    Wing, Stephen R; Leichter, James J; Wing, Lucy C; Stokes, Dale; Genovese, Sal J; McMullin, Rebecca M; Shatova, Olya A

    2018-04-28

    Organic matter produced by the sea ice microbial community (SIMCo) is an important link between sea ice dynamics and secondary production in near-shore food webs of Antarctica. Sea ice conditions in McMurdo Sound were quantified from time series of MODIS satellite images for Sept. 1 through Feb. 28 of 2007-2015. A predictable sea ice persistence gradient along the length of the Sound and evidence for a distinct change in sea ice dynamics in 2011 were observed. We used stable isotope analysis (δ 13 C and δ 15 N) of SIMCo, suspended particulate organic matter (SPOM) and shallow water (10-20 m) macroinvertebrates to reveal patterns in trophic structure of, and incorporation of organic matter from SIMCo into, benthic communities at eight sites distributed along the sea ice persistence gradient. Mass-balance analysis revealed distinct trophic architecture among communities and large fluxes of SIMCo into the near-shore food web, with the estimates ranging from 2 to 84% of organic matter derived from SIMCo for individual species. Analysis of patterns in density, and biomass of macroinvertebrate communities among sites allowed us to model net incorporation of organic matter from SIMCo, in terms of biomass per unit area (g/m 2 ), into benthic communities. Here, organic matter derived from SIMCo supported 39 to 71 per cent of total biomass. Furthermore, for six species, we observed declines in contribution of SIMCo between years with persistent sea ice (2008-2009) and years with extensive sea ice breakout (2012-2015). Our data demonstrate the vital role of SIMCo in ecosystem function in Antarctica and strong linkages between sea ice dynamics and near-shore secondary productivity. These results have important implications for our understanding of how benthic communities will respond to changes in sea ice dynamics associated with climate change and highlight the important role of shallow water macroinvertebrate communities as sentinels of change for the Antarctic marine

  12. The characteristics of dissolved organic matter (DOM) and chromophoric dissolved organic matter (CDOM) in Antarctic sea ice

    Science.gov (United States)

    Norman, Louiza; Thomas, David N.; Stedmon, Colin A.; Granskog, Mats A.; Papadimitriou, Stathys; Krapp, Rupert H.; Meiners, Klaus M.; Lannuzel, Delphine; van der Merwe, Pier; Dieckmann, Gerhard S.

    2011-05-01

    An investigation of coloured dissolved organic matter (CDOM) and its relationships to physical and biogeochemical parameters in Antarctic sea ice and oceanic water have indicated that ice melt may both alter the spectral characteristics of CDOM in Antarctic surface waters and serve as a likely source of fresh autochthonous CDOM and labile DOC. Samples were collected from melted bulk sea ice, sea ice brines, surface gap layer waters, and seawater during three expeditions: one during the spring to summer and two during the winter to spring transition period. Variability in both physical (temperature and salinity) and biogeochemical parameters (dissolved and particulate organic carbon and nitrogen, as well as chlorophyll a) was observed during and between studies, but CDOM absorption coefficients measured at 375 nm (a 375) did not differ significantly. Distinct peaked absorption spectra were consistently observed for bulk ice, brine, and gap water, but were absent in the seawater samples. Correlation with the measured physical and biogeochemical parameters could not resolve the source of these peaks, but the shoulders and peaks observed between 260 and 280 nm and between 320 to 330 nm respectively, particularly in the samples taken from high light-exposed gap layer environment, suggest a possible link to aromatic and mycosporine-like amino acids. Sea ice CDOM susceptibility to photo-bleaching was demonstrated in an in situ 120 hour exposure, during which we observed a loss in CDOM absorption of 53% at 280 nm, 58% at 330 nm, and 30% at 375 nm. No overall coincidental loss of DOC or DON was measured during the experimental period. A relationship between the spectral slope (S) and carbon-specific absorption (a *375) indicated that the characteristics of CDOM can be described by the mixing of two broad end-members; and aged material, present in brine and seawater samples characterised by high S values and low a *375; and a fresh material, due to elevated in situ

  13. Specialised use of working memory by Portia africana, a spider-eating salticid.

    Science.gov (United States)

    Cross, Fiona R; Jackson, Robert R

    2014-03-01

    Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

  14. Variability and Trends in Sea Ice Extent and Ice Production in the Ross Sea

    Science.gov (United States)

    Comiso, Josefino; Kwok, Ronald; Martin, Seelye; Gordon, Arnold L.

    2011-01-01

    Salt release during sea ice formation in the Ross Sea coastal regions is regarded as a primary forcing for the regional generation of Antarctic Bottom Water. Passive microwave data from November 1978 through 2008 are used to examine the detailed seasonal and interannual characteristics of the sea ice cover of the Ross Sea and the adjacent Bellingshausen and Amundsen seas. For this period the sea ice extent in the Ross Sea shows the greatest increase of all the Antarctic seas. Variability in the ice cover in these regions is linked to changes in the Southern Annular Mode and secondarily to the Antarctic Circumpolar Wave. Over the Ross Sea shelf, analysis of sea ice drift data from 1992 to 2008 yields a positive rate of increase in the net ice export of about 30,000 sq km/yr. For a characteristic ice thickness of 0.6 m, this yields a volume transport of about 20 cu km/yr, which is almost identical, within error bars, to our estimate of the trend in ice production. The increase in brine rejection in the Ross Shelf Polynya associated with the estimated increase with the ice production, however, is not consistent with the reported Ross Sea salinity decrease. The locally generated sea ice enhancement of Ross Sea salinity may be offset by an increase of relatively low salinity of the water advected into the region from the Amundsen Sea, a consequence of increased precipitation and regional glacial ice melt.

  15. Spatial variability and trends of seasonal snowmelt processes over Antarctic sea ice observed by satellite scatterometers

    Science.gov (United States)

    Arndt, S.; Haas, C.

    2017-12-01

    Snow is one of the key drivers determining the seasonal energy and mass budgets of sea ice in the Southern Ocean. Here, we analyze radar backscatter time series from the European Remote Sensing Satellites (ERS)-1 and-2 scatterometers, from the Quick Scatterometer (QSCAT), and from the Advanced Scatterometer (ASCAT) in order to observe the regional and inter-annual variability of Antarctic snowmelt processes from 1992 to 2014. On perennial ice, seasonal backscatter changes show two different snowmelt stages: A weak backscatter rise indicating the initial warming and metamorphosis of the snowpack (pre-melt), followed by a rapid rise indicating the onset of internal snowmelt and thaw-freeze cycles (snowmelt). In contrast, similar seasonal backscatter cycles are absent on seasonal ice, preventing the periodic retrieval of spring/summer transitions. This may be due to the dominance of ice bottom melt over snowmelt, leading to flooding and ice disintegration before strong snowmelt sets in. Resulting snowmelt onset dates on perennial sea ice show the expected latitudinal gradient from early melt onsets (mid-November) in the northern Weddell Sea towards late (end-December) or even absent snowmelt conditions further south. This result is likely related to seasonal variations in solar shortwave radiation (absorption). In addition, observations with different microwave frequencies allow to detect changing snow properties at different depths. We show that short wavelengths of passive microwave observations indicate earlier pre-melt and snowmelt onset dates than longer wavelength scatterometer observations, in response to earlier warming of upper snow layers compared to lower snow layers. Similarly, pre-melt and snowmelt onset dates retrieved from Ku-Band radars were earlier by an average of 11 and 23 days, respectively, than those retrieved from C-Band. This time difference was used to correct melt onset dates retrieved from Ku-Band to compile a consistent time series from

  16. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min

    2016-01-01

    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  17. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    OpenAIRE

    Jiang Min

    2016-01-01

    Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  18. Antarctic krill under sea ice: elevated abundance in a narrow band just south of ice edge.

    Science.gov (United States)

    Brierley, Andrew S; Fernandes, Paul G; Brandon, Mark A; Armstrong, Frederick; Millard, Nicholas W; McPhail, Steven D; Stevenson, Peter; Pebody, Miles; Perrett, James; Squires, Mark; Bone, Douglas G; Griffiths, Gwyn

    2002-03-08

    We surveyed Antarctic krill (Euphausia superba) under sea ice using the autonomous underwater vehicle Autosub-2. Krill were concentrated within a band under ice between 1 and 13 kilometers south of the ice edge. Within this band, krill densities were fivefold greater than that of open water. The under-ice environment has long been considered an important habitat for krill, but sampling difficulties have previously prevented direct observations under ice over the scale necessary for robust krill density estimation. Autosub-2 enabled us to make continuous high-resolution measurements of krill density under ice reaching 27 kilometers beyond the ice edge.

  19. Spider Vein Removal

    Science.gov (United States)

    Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

  20. Early spawning of Antarctic krill in the Scotia Sea is fuelled by “superfluous” feeding on non-ice associated phytoplankton blooms

    Science.gov (United States)

    Schmidt, Katrin; Atkinson, Angus; Venables, Hugh J.; Pond, David W.

    2012-01-01

    The spawning success of Antarctic krill ( Euphausia superba) is generally assumed to depend on substantial winter sea ice extent, as ice biota can serve as a food source during winter/spring and the seasonal ice melt conditions the upper water column for extensive phytoplankton blooms. However, direct observations during spring are rare. Here we studied krill body condition and maturity stage in relation to feeding (i.e. stomach fullness, diet, absorption of individual fatty acids and defecation rate) across the Scotia Sea in November 2006. The phytoplankton concentrations were low at the marginal ice zone (MIZ) in the southern Scotia Sea (Stn. 1, 2, and 3), high in open waters of the Southern Antarctic Circumpolar Current Front (SACCF) in the central Scotia Sea (Stn. 5), and moderate further north (Stn. 6 and 7). Krill had low lipid reserves (˜6.5% of dry mass, DM), low mass:length ratios (˜1.7 mg DM mm -1), and small digestive glands (˜7% of total DM) near the ice edge. The stomachs contained lithogenic particles, diatom debris, and bacterial fatty acids, but low proportions of diatom-indicating fatty acids, which suggest that these krill were feeding on detritus rather than on fresh ice algae. In the SACCF, krill had higher lipid reserves (˜10% of DM), high mass:length ratios (˜2.2 mg DM mm -1), and large digestive glands (˜16% of total DM). Stomach content and tissue composition indicate feeding on diatoms. In the north, moderate food concentrations co-occurred with low lipid reserves in krill, and moderate mass:length ratios and digestive gland sizes. Only in the phytoplankton bloom in the SACCF had the mating season already started and some females were about to spawn. Based on the way krill processed their food at the different stations, we indicate two mechanisms that can lead to fast regeneration of body reserves and oocyte maturation in E. superba. One is "superfluous" feeding at high food concentrations, which maximises the overall nutrient gain

  1. Antarctic and Southern Ocean influences on Late Pliocene global cooling

    NARCIS (Netherlands)

    McKay, R.; Naish, T.; Carter, L.; Riesselman, C.; Dunbar, R.; Sjunneskog, C.; Winter, D.; Sangiorgi, F.; Warren, C.; Pagani, M.; Schouten, S.; Willmott, V.; Levy, R.; DeConto , R.M.; Powell, R.D.

    2012-01-01

    The influence of Antarctica and the Southern Ocean on Late Pliocene global climate reconstructions has remained ambiguous due to a lack of well-dated Antarctic-proximal, paleoenvironmental records. Here we present ice sheet, sea-surface temperature, and sea ice reconstructions from the ANDRILL

  2. East Weddell Sea echinoids from the JR275 expedition

    Directory of Open Access Journals (Sweden)

    Thomas Saucède

    2015-05-01

    Full Text Available Information regarding the echinoids in this dataset is based on the Agassiz Trawl (AGT and epibenthic sledge (EBS samples collected during the British Antarctic Survey cruise JR275 on the RRS James Clark Ross in the austral summer 2012. A total of 56 (1 at the South Orkneys and 55 in the Eastern Weddell Sea Agassiz Trawl and 18 (2 at the South Orkneys and 16 in the Eastern Weddell Sea epibenthic sledge deployments were performed at depths ranging from ~280 to ~2060 m. This presents a unique collection for the Antarctic benthic biodiversity assessment of an important group of benthic invertebrates. In total 487 specimens belonging to six families, 15 genera, and 22 morphospecies were collected. The species richness per station varied between one and six. Total species richness represents 27% of the 82 echinoid species ever recorded in the Southern Ocean (David et al. 2005b, Pierrat et al. 2012, Saucède et al. 2014. The Cidaridae (sub-family Ctenocidarinae and Schizasteridae are the two most speciose families in the dataset. They comprise seven and nine species respectively. This is illustrative of the overall pattern of echinoid diversity in the Southern Ocean where 65% of Antarctic species belong to the families Schizasteridae and Cidaridae (Pierrat et al. 2012.

  3. Past penguin colony responses to explosive volcanism on the Antarctic Peninsula

    Science.gov (United States)

    Roberts, Stephen J.; Monien, Patrick; Foster, Louise C.; Loftfield, Julia; Hocking, Emma P.; Schnetger, Bernhard; Pearson, Emma J.; Juggins, Steve; Fretwell, Peter; Ireland, Louise; Ochyra, Ryszard; Haworth, Anna R.; Allen, Claire S.; Moreton, Steven G.; Davies, Sarah J.; Brumsack, Hans-Jürgen; Bentley, Michael J.; Hodgson, Dominic A.

    2017-04-01

    Changes in penguin populations on the Antarctic Peninsula have been linked to several environmental factors, but the potentially devastating impact of volcanic activity has not been considered. Here we use detailed biogeochemical analyses to track past penguin colony change over the last 8,500 years on Ardley Island, home to one of the Antarctic Peninsula's largest breeding populations of gentoo penguins. The first sustained penguin colony was established on Ardley Island c. 6,700 years ago, pre-dating sub-fossil evidence of Peninsula-wide occupation by c. 1,000 years. The colony experienced five population maxima during the Holocene. Overall, we find no consistent relationships with local-regional atmospheric and ocean temperatures or sea-ice conditions, although the colony population maximum, c. 4,000-3,000 years ago, corresponds with regionally elevated temperatures. Instead, at least three of the five phases of penguin colony expansion were abruptly ended by large eruptions from the Deception Island volcano, resulting in near-complete local extinction of the colony, with, on average, 400-800 years required for sustainable recovery.

  4. Biological invasions in the Antarctic: extent, impacts and implications.

    Science.gov (United States)

    Frenot, Yves; Chown, Steven L; Whinam, Jennie; Selkirk, Patricia M; Convey, Peter; Skotnicki, Mary; Bergstrom, Dana M

    2005-02-01

    Alien microbes, fungi, plants and animals occur on most of the sub-Antarctic islands and some parts of the Antarctic continent. These have arrived over approximately the last two centuries, coincident with human activity in the region. Introduction routes have varied, but are largely associated with movement of people and cargo in connection with industrial, national scientific program and tourist operations. The large majority of aliens are European in origin. They have both direct and indirect impacts on the functioning of species-poor Antarctic ecosystems, in particular including substantial loss of local biodiversity and changes to ecosystem processes. With rapid climate change occurring in some parts of Antarctica, elevated numbers of introductions and enhanced success of colonization by aliens are likely, with consequent increases in impacts on ecosystems. Mitigation measures that will substantially reduce the risk of introductions to Antarctica and the sub-Antarctic must focus on reducing propagule loads on humans, and their food, cargo, and transport vessels.

  5. A new bed elevation model for the Weddell Sea sector of the West Antarctic Ice Sheet

    Directory of Open Access Journals (Sweden)

    H. Jeofry

    2018-04-01

    Full Text Available We present a new digital elevation model (DEM of the bed, with a 1 km gridding, of the Weddell Sea (WS sector of the West Antarctic Ice Sheet (WAIS. The DEM has a total area of ∼ 125 000 km2 covering the Institute, Möller and Foundation ice streams, as well as the Bungenstock ice rise. In comparison with the Bedmap2 product, our DEM includes new aerogeophysical datasets acquired by the Center for Remote Sensing of Ice Sheets (CReSIS through the NASA Operation IceBridge (OIB program in 2012, 2014 and 2016. We also improve bed elevation information from the single largest existing dataset in the region, collected by the British Antarctic Survey (BAS Polarimetric radar Airborne Science Instrument (PASIN in 2010–2011, from the relatively crude measurements determined in the field for quality control purposes used in Bedmap2. While the gross form of the new DEM is similar to Bedmap2, there are some notable differences. For example, the position and size of a deep subglacial trough (∼ 2 km below sea level between the ice-sheet interior and the grounding line of the Foundation Ice Stream have been redefined. From the revised DEM, we are able to better derive the expected routing of basal water and, by comparison with that calculated using Bedmap2, we are able to assess regions where hydraulic flow is sensitive to change. Given the potential vulnerability of this sector to ocean-induced melting at the grounding line, especially in light of the improved definition of the Foundation Ice Stream trough, our revised DEM will be of value to ice-sheet modelling in efforts to quantify future glaciological changes in the region and, from this, the potential impact on global sea level. The new 1 km bed elevation product of the WS sector can be found at https://doi.org/10.5281/zenodo.1035488.

  6. A new bed elevation model for the Weddell Sea sector of the West Antarctic Ice Sheet

    Science.gov (United States)

    Jeofry, Hafeez; Ross, Neil; Corr, Hugh F. J.; Li, Jilu; Morlighem, Mathieu; Gogineni, Prasad; Siegert, Martin J.

    2018-04-01

    We present a new digital elevation model (DEM) of the bed, with a 1 km gridding, of the Weddell Sea (WS) sector of the West Antarctic Ice Sheet (WAIS). The DEM has a total area of ˜ 125 000 km2 covering the Institute, Möller and Foundation ice streams, as well as the Bungenstock ice rise. In comparison with the Bedmap2 product, our DEM includes new aerogeophysical datasets acquired by the Center for Remote Sensing of Ice Sheets (CReSIS) through the NASA Operation IceBridge (OIB) program in 2012, 2014 and 2016. We also improve bed elevation information from the single largest existing dataset in the region, collected by the British Antarctic Survey (BAS) Polarimetric radar Airborne Science Instrument (PASIN) in 2010-2011, from the relatively crude measurements determined in the field for quality control purposes used in Bedmap2. While the gross form of the new DEM is similar to Bedmap2, there are some notable differences. For example, the position and size of a deep subglacial trough (˜ 2 km below sea level) between the ice-sheet interior and the grounding line of the Foundation Ice Stream have been redefined. From the revised DEM, we are able to better derive the expected routing of basal water and, by comparison with that calculated using Bedmap2, we are able to assess regions where hydraulic flow is sensitive to change. Given the potential vulnerability of this sector to ocean-induced melting at the grounding line, especially in light of the improved definition of the Foundation Ice Stream trough, our revised DEM will be of value to ice-sheet modelling in efforts to quantify future glaciological changes in the region and, from this, the potential impact on global sea level. The new 1 km bed elevation product of the WS sector can be found at https://doi.org/10.5281/zenodo.1035488" target="_blank">https://doi.org/10.5281/zenodo.1035488.

  7. Spider Bites: First Aid

    Science.gov (United States)

    ... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

  8. First records of aphid-pathogenic Entomophthorales in the sub-Antarctic archipelagos of Crozet and Kerguelen

    OpenAIRE

    Bernard Papierok; Charles-Antoine Dedryver; Maurice Hullé

    2016-01-01

    Since the 20th century, the sub-Antarctic islands have suffered an increasing number of biological invasions. Despite the large number of publications on this topic, there is a lack of knowledge on parasitism rates of invasive species and on the role of parasites and pathogens to regulate their populations. Six aphid species have been introduced in the archipelagos of Crozet (Île de la Possession, 46° 25’ S–51° 51’ E) and Kerguelen (49° 21’ S–70° 13’ E). Five of these species were found infec...

  9. Seasonal variation and volatility of ultra-fine particles in coastal Antarctic troposphere

    Directory of Open Access Journals (Sweden)

    Keiichiro Hara

    2010-12-01

    Full Text Available The Size distribution and volatility of ultrafine aerosol particles were measured at Syowa Station during the 46-47 Japanese Antarctic Research Expeditions. During the summer, most of the ultrafine particles were volatile particles, which were composed of H_2SO_4, CH_3SO_3H and sulfates bi-sulfates. The abundance of non-volatile particles was ~ 20% during the summer, increasing to>90% in winter-spring. Non-volatile particles in winter were dominantly sea-salt particles. Some ultrafine sea-salt particles might be released from sea-ice. When air mass was transported from the free troposphere over the Antarctic continent, the abundance of non-volatile particles dropped to<30% even in winter.

  10. Congener-specific accumulation and trophic transfer of polychlorinated biphenyls in spider crab food webs revealed by stable isotope analysis

    Energy Technology Data Exchange (ETDEWEB)

    Bodin, N. [IFREMER, DCN-BE, Technopole Brest-Iroise, Pointe du Diable, 29280 Plouzane (France); LPTC-UMR 5472 CNRS, Universite de Bordeaux 1, 351 cours de la Liberation, 33400 Talence (France)], E-mail: bodin.nathalie@caramail.com; Le Loc' h, F. [IRD, UR 070 RAP, Centre de Recherche Halieutique, Avenue Jean Monnet, B.P. 171, 34203 Sete Cedex (France); Caisey, X.; Le Guellec, A.-M.; Abarnou, A.; Loizeau, V. [IFREMER, DCN-BE, Technopole Brest-Iroise, Pointe du Diable, 29280 Plouzane (France); Latrouite, D. [IFREMER, DCB-STH, Technopole Brest-Iroise, Pointe du Diable, 29280 Plouzane (France)

    2008-01-15

    Polychlorobiphenyls (PCB) and stable isotopes ({delta}{sup 15}N and {delta}{sup 13}C) were analyzed in the spider crab (Maja brachydactyla) food web from the Iroise Sea (Western Brittany) and the Seine Bay (Eastern English Channel). PCB concentrations were all significantly higher in organisms from the Seine Bay than those from the Iroise Sea. PCB patterns were strongly related to the feeding mode of the species, and increased influence of higher chlorinated congeners was highlighted with trophic position of the organisms. PCB concentrations (lipid normalized) were significantly related to the isotopically derived trophic level (TL) in spider crab food webs. The highest trophic magnification factors (TMFs) were calculated for the congeners with 2,4,5-substitution, and were lower in the Seine Bay compared to the Iroise Sea. The confrontation of PCB and TL data also revealed biotransformation capacity of decapod crustaceans for specific congeners based on structure-activity relations. - The influence of feeding mode and trophic position on the fate of PCBs in spider crab food webs is discussed by using a stable isotopic approach.

  11. Spiders in caves.

    Science.gov (United States)

    Mammola, Stefano; Isaia, Marco

    2017-04-26

    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  12. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison

    2016-02-01

    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  13. Spider phylogenomics: untangling the Spider Tree of Life

    Science.gov (United States)

    Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

    2016-01-01

    Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

  14. Evolving Understanding of Antarctic Ice-Sheet Physics and Ambiguity in Probabilistic Sea-Level Projections

    Science.gov (United States)

    Kopp, Robert E.; DeConto, Robert M.; Bader, Daniel A.; Hay, Carling C.; Horton, Radley M.; Kulp, Scott; Oppenheimer, Michael; Pollard, David; Strauss, Benjamin H.

    2017-12-01

    Mechanisms such as ice-shelf hydrofracturing and ice-cliff collapse may rapidly increase discharge from marine-based ice sheets. Here, we link a probabilistic framework for sea-level projections to a small ensemble of Antarctic ice-sheet (AIS) simulations incorporating these physical processes to explore their influence on global-mean sea-level (GMSL) and relative sea-level (RSL). We compare the new projections to past results using expert assessment and structured expert elicitation about AIS changes. Under high greenhouse gas emissions (Representative Concentration Pathway [RCP] 8.5), median projected 21st century GMSL rise increases from 79 to 146 cm. Without protective measures, revised median RSL projections would by 2100 submerge land currently home to 153 million people, an increase of 44 million. The use of a physical model, rather than simple parameterizations assuming constant acceleration of ice loss, increases forcing sensitivity: overlap between the central 90% of simulations for 2100 for RCP 8.5 (93-243 cm) and RCP 2.6 (26-98 cm) is minimal. By 2300, the gap between median GMSL estimates for RCP 8.5 and RCP 2.6 reaches >10 m, with median RSL projections for RCP 8.5 jeopardizing land now occupied by 950 million people (versus 167 million for RCP 2.6). The minimal correlation between the contribution of AIS to GMSL by 2050 and that in 2100 and beyond implies current sea-level observations cannot exclude future extreme outcomes. The sensitivity of post-2050 projections to deeply uncertain physics highlights the need for robust decision and adaptive management frameworks.

  15. Evolving Understanding of Antarctic Ice-Sheet Physics and Ambiguity in Probabilistic Sea-Level Projections

    Science.gov (United States)

    Kopp, Robert E.; DeConto, Robert M.; Bader, Daniel A.; Hay, Carling C.; Horton, Radley M.; Kulp, Scott; Oppenheimer, Michael; Pollard, David; Strauss, Benjamin

    2017-01-01

    Mechanisms such as ice-shelf hydrofracturing and ice-cliff collapse may rapidly increase discharge from marine-based ice sheets. Here, we link a probabilistic framework for sea-level projections to a small ensemble of Antarctic ice-sheet (AIS) simulations incorporating these physical processes to explore their influence on global-mean sea-level (GMSL) and relative sea-level (RSL). We compare the new projections to past results using expert assessment and structured expert elicitation about AIS changes. Under high greenhouse gas emissions (Representative Concentration Pathway [RCP] 8.5), median projected 21st century GMSL rise increases from 79 to 146 cm. Without protective measures, revised median RSL projections would by 2100 submerge land currently home to 153 million people, an increase of 44 million. The use of a physical model, rather than simple parameterizations assuming constant acceleration of ice loss, increases forcing sensitivity: overlap between the central 90% of simulations for 2100 for RCP 8.5 (93-243 cm) and RCP 2.6 (26-98 cm) is minimal. By 2300, the gap between median GMSL estimates for RCP 8.5 and RCP 2.6 reaches >10 m, with median RSL projections for RCP 8.5 jeopardizing land now occupied by 950 million people (versus 167 million for RCP 2.6). The minimal correlation between the contribution of AIS to GMSL by 2050 and that in 2100 and beyond implies current sea-level observations cannot exclude future extreme outcomes. The sensitivity of post-2050 projections to deeply uncertain physics highlights the need for robust decision and adaptive management frameworks.

  16. Oceanographic and topographic conditions structure benthic meiofauna communities in the Weddell Sea, Bransfield Strait and Drake Passage (Antarctic)

    Science.gov (United States)

    Veit-Köhler, Gritta; Durst, Stephan; Schuckenbrock, Jan; Hauquier, Freija; Durán Suja, Laura; Dorschel, Boris; Vanreusel, Ann; Martínez Arbizu, Pedro

    2018-03-01

    The marine environment of the tip of the Antarctic Peninsula is characterised by three oceanographically distinct regions for which we linked continental-slope meiofaunal patterns and environmental drivers on a large scale (100-300 km among ecoregions). Samples for meiofauna communities and sediment analyses were collected with a multicorer, water-column data were derived from water samples and CTD recordings. Meiofauna communities including individuals from 19 higher taxa were compared to a set of 16 environmental variables. We detected significant differences between the communities of Weddell Sea and those of Bransfield Strait and Drake Passage. The amount of phytopigments in the sediment, their freshness and the silt and clay content were driving factors for this separation. The highest meiofauna abundances were found at slopes in the Weddell Sea. Food banks may facilitate high standing stocks. There, the highest ever recorded copepod percentages for the Antarctic were related to the highest phytopigment contents while nematodes were extremely abundant even in deeper sediment layers at stations with fresh organic material. For Bransfield Strait and Drake Passage a sampling scheme of slopes and adjacent troughs was applied. The two regions were divided into three geographical "areas" with the two "habitat" types investigated for each area. Multivariate non-parametric permutational analysis of variance (PERMANOVA) showed that in Bransfield Strait slope and trough meiofauna communities differed significantly in all geographical areas while in Drake Passage this was only the case in the East. These differences were explained best by the regionally and topographically distinct characteristics of 7 out of 11 water-column and sediment-bound factors related to sediment grain size, food quantity and quality, water temperature and salinity. Environmental drivers of the benthic habitat are dependent on large-scale oceanographic conditions and are thus sensitive to changes

  17. Modelling the effects of environmental conditions on the acoustic occurrence and behaviour of Antarctic blue whales.

    Directory of Open Access Journals (Sweden)

    Fannie W Shabangu

    Full Text Available Harvested to perilously low numbers by commercial whaling during the past century, the large scale response of Antarctic blue whales Balaenoptera musculus intermedia to environmental variability is poorly understood. This study uses acoustic data collected from 586 sonobuoys deployed in the austral summers of 1997 through 2009, south of 38°S, coupled with visual observations of blue whales during the IWC SOWER line-transect surveys. The characteristic Z-call and D-call of Antarctic blue whales were detected using an automated detection template and visual verification method. Using a random forest model, we showed the environmental preferences pattern, spatial occurrence and acoustic behaviour of Antarctic blue whales. Distance to the southern boundary of the Antarctic Circumpolar Current (SBACC, latitude and distance from the nearest Antarctic shores were the main geographic predictors of blue whale call occurrence. Satellite-derived sea surface height, sea surface temperature, and productivity (chlorophyll-a were the most important environmental predictors of blue whale call occurrence. Call rates of D-calls were strongly predicted by the location of the SBACC, latitude and visually detected number of whales in an area while call rates of Z-call were predicted by the SBACC, latitude and longitude. Satellite-derived sea surface height, wind stress, wind direction, water depth, sea surface temperatures, chlorophyll-a and wind speed were important environmental predictors of blue whale call rates in the Southern Ocean. Blue whale call occurrence and call rates varied significantly in response to inter-annual and long term variability of those environmental predictors. Our results identify the response of Antarctic blue whales to inter-annual variability in environmental conditions and highlighted potential suitable habitats for this population. Such emerging knowledge about the acoustic behaviour, environmental and habitat preferences of

  18. Modelling the effects of environmental conditions on the acoustic occurrence and behaviour of Antarctic blue whales.

    Science.gov (United States)

    Shabangu, Fannie W; Yemane, Dawit; Stafford, Kathleen M; Ensor, Paul; Findlay, Ken P

    2017-01-01

    Harvested to perilously low numbers by commercial whaling during the past century, the large scale response of Antarctic blue whales Balaenoptera musculus intermedia to environmental variability is poorly understood. This study uses acoustic data collected from 586 sonobuoys deployed in the austral summers of 1997 through 2009, south of 38°S, coupled with visual observations of blue whales during the IWC SOWER line-transect surveys. The characteristic Z-call and D-call of Antarctic blue whales were detected using an automated detection template and visual verification method. Using a random forest model, we showed the environmental preferences pattern, spatial occurrence and acoustic behaviour of Antarctic blue whales. Distance to the southern boundary of the Antarctic Circumpolar Current (SBACC), latitude and distance from the nearest Antarctic shores were the main geographic predictors of blue whale call occurrence. Satellite-derived sea surface height, sea surface temperature, and productivity (chlorophyll-a) were the most important environmental predictors of blue whale call occurrence. Call rates of D-calls were strongly predicted by the location of the SBACC, latitude and visually detected number of whales in an area while call rates of Z-call were predicted by the SBACC, latitude and longitude. Satellite-derived sea surface height, wind stress, wind direction, water depth, sea surface temperatures, chlorophyll-a and wind speed were important environmental predictors of blue whale call rates in the Southern Ocean. Blue whale call occurrence and call rates varied significantly in response to inter-annual and long term variability of those environmental predictors. Our results identify the response of Antarctic blue whales to inter-annual variability in environmental conditions and highlighted potential suitable habitats for this population. Such emerging knowledge about the acoustic behaviour, environmental and habitat preferences of Antarctic blue whales is

  19. Respiration in spiders (Araneae).

    Science.gov (United States)

    Schmitz, Anke

    2016-05-01

    Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

  20. Long-Term Patterns in Production and Export of Fecal Pellets by Krill and Salps along the Western Antarctic Peninsula

    Science.gov (United States)

    Steinberg, D. K.; Ruck, K. E.; Cope, J. S.

    2016-02-01

    The Western Antarctic Peninsula (WAP) is one of the most rapidly warming regions on Earth, and where climate-induced changes in zooplankton abundance and species composition could dramatically affect the pelagic food web and biogeochemical cycling. We examined long-term (1993 to the present) and spatial trends in summer abundance of, and fecal pellet production (FPP) by, Antarctic krill (Euphausia superba) and gelatinous salps (Salpa thompsoni) and their relationship with physical and other environmental parameters. Zooplankton were collected as part of the Palmer, Antarctica Long-Term Ecological Research Program (PAL LTER) from the epipelagic zone in a region divided into latitudinal (North, South, and Far South) and cross-shelf (coastal, shelf, slope) sub-regions. Beginning in 2009, FPP and sinking rate experiments were conducted at representative stations along these gradients. FPP peaks occurred every 4-6 years in both species in the north and south, but alternated such that some years were characterized by high krill-mediated export, and others by high salp-mediated export. In the far south (where perennial sea ice still persists), and in both coastal and shelf sub-regions, krill FFP exceeded that of salps. Conversely, off the slope, salp FPP exceeded that of krill. Variability in krill FPP was strongly and positively influenced by primary production 2-years prior, and negatively correlated with sea surface temperature (no lag). Salp FPP was most significantly correlated with sea ice parameters, with highest FPP in years of lowest sea-ice extent, duration, and area. Warmer water and ice-free conditions favored salps over krill, which also increased overall potential export of fecal pellet carbon to depth. We discuss the implications of this potential increase in biological pump efficiency as the climate warms.

  1. Tarantula spider

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  2. Antarctic aerosols - A review

    Science.gov (United States)

    Shaw, Glenn E.

    1988-02-01

    Tropospheric aerosols with the diameter range of half a micron reside in the atmosphere for tens of days and teleconnect Antarctica with other regions by transport that reaches planetary scales of distances; thus, the aerosol on the Antarctic ice represents 'memory modules' of events that took place at regions separated from Antarctica by tens of thousands of kilometers. In terms of aerosol mass, the aerosol species include insoluble crustal products (less than 5 percent), transported sea-salt residues (highly variable but averaging about 10 percent), Ni-rich meteoric material, and anomalously enriched material with an unknown origin. Most (70-90 percent by mass) of the aerosol over the Antarctic ice shield, however, is the 'natural acid sulfate aerosol', apparently deriving from biological processes taking place in the surrounding oceans.

  3. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.

    2012-07-01

    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  4. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  5. Influence of Sea Ice Crack Formation on the Spatial Distribution of Nutrients and Microalgae in Flooded Antarctic Multiyear Ice

    Science.gov (United States)

    Nomura, Daiki; Aoki, Shigeru; Simizu, Daisuke; Iida, Takahiro

    2018-02-01

    Cracks are common and natural features of sea ice formed in the polar oceans. In this study, a sea ice crack in flooded, multiyear, land-fast Antarctic sea ice was examined to assess its influence on biological productivity and the transport of nutrients and microalgae into the upper layers of neighboring sea ice. The water inside the crack and the surrounding host ice were characterized by a strong discoloration (brown color), an indicator of a massive algal bloom. Salinity and oxygen isotopic ratio measurements indicated that 64-84% of the crack water consisted of snow meltwater supplied during the melt season. Measurements of nutrient and chlorophyll a concentrations within the slush layer pool (the flooded layer at the snow-ice interface) revealed the intrusion of water from the crack, likely forced by mixing with underlying seawater during the tidal cycle. Our results suggest that sea ice crack formation provides conditions favorable for algal blooms by directly exposing the crack water to sunlight and supplying nutrients from the under-ice water. Subsequently, constituents of the crack water modified by biological activity were transported into the upper layer of the flooded sea ice. They were then preserved in the multiyear ice column formed by upward growth of sea ice caused by snow ice formation in areas of significant snow accumulation.

  6. Stable water isotopes of precipitation and firn cores from the northern Antarctic Peninsula region as a proxy for climate reconstruction

    Directory of Open Access Journals (Sweden)

    F. Fernandoy

    2012-03-01

    Full Text Available In order to investigate the climate variability in the northern Antarctic Peninsula region, this paper focuses on the relationship between stable isotope content of precipitation and firn, and main meteorological variables (air temperature, relative humidity, sea surface temperature, and sea ice extent. Between 2008 and 2010, we collected precipitation samples and retrieved firn cores from several key sites in this region. We conclude that the deuterium excess oscillation represents a robust indicator of the meteorological variability on a seasonal to sub-seasonal scale. Low absolute deuterium excess values and the synchronous variation of both deuterium excess and air temperature imply that the evaporation of moisture occurs in the adjacent Southern Ocean. The δ18O-air temperature relationship is complicated and significant only at a (multiseasonal scale. Backward trajectory calculations show that air-parcels arriving at the region during precipitation events predominantly originate at the South Pacific Ocean and Bellingshausen Sea. These investigations will be used as a calibration for ongoing and future research in the area, suggesting that appropriate locations for future ice core research are located above 600 m a.s.l. We selected the Plateau Laclavere, Antarctic Peninsula as the most promising site for a deeper drilling campaign.

  7. Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

    Science.gov (United States)

    McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

    2014-06-01

    This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

  8. An unusual early Holocene diatom event north of the Getz Ice Shelf (Amundsen Sea): Implications for West Antarctic Ice Sheet development

    Science.gov (United States)

    Esper, O.; Gersonde, R.; Hillenbrand, C.; Kuhn, G.; Smith, J.

    2011-12-01

    Modern global change affects not only the polar north but also, and to increasing extent, the southern high latitudes, especially the Antarctic regions covered by the West Antarctic Ice Sheet (WAIS). Consequently, knowledge of the mechanisms controlling past WAIS dynamics and WAIS behaviour at the last deglaciation is critical to predict its development in a future warming world. Geological and palaeobiological information from major drainage areas of the WAIS, like the Amundsen Sea Embayment, shed light on the history of the WAIS glaciers. Sediment records obtained from a deep inner shelf basin north of Getz Ice Shelf document a deglacial warming in three phases. Above a glacial diamicton and a sediment package barren of microfossils that document sediment deposition by grounded ice and below an ice shelf or perennial sea ice cover (possibly fast ice), respectively, a sediment section with diatom assemblages dominated by sea ice taxa indicates ice shelf retreat and seasonal ice-free conditions. This conclusion is supported by diatom-based summer temperature reconstructions. The early retreat was followed by a phase, when exceptional diatom ooze was deposited around 12,500 cal. years B.P. [1]. Microscopical inspection of this ooze revealed excellent preservation of diatom frustules of the species Corethron pennatum together with vegetative Chaetoceros, thus an assemblage usually not preserved in the sedimentary record. Sediments succeeding this section contain diatom assemblages indicating rather constant Holocene cold water conditions with seasonal sea ice. The deposition of the diatom ooze can be related to changes in hydrographic conditions including strong advection of nutrients. However, sediment focussing in the partly steep inner shelf basins cannot be excluded as a factor enhancing the thickness of the ooze deposits. It is not only the presence of the diatom ooze but also the exceptional preservation and the species composition of the diatom assemblage

  9. Meltwater produced by wind–albedo interaction stored in an East Antarctic ice shelf

    NARCIS (Netherlands)

    Lenaerts, JTM; Lhermitte, S.L.M.; Drews, R.; Ligtenberg, SRM; Berger, S.; Helm, V.; Smeets, C.J.P.P.; van den Broeke, MR; van de Berg, W.J.; van Meijgaard, E; Eijkelboom, M.; Eisen, O.; Pattyn, F.

    2017-01-01

    Surface melt and subsequent firn air depletion can ultimately lead to disintegration of Antarctic ice shelves1, 2 causing grounded glaciers to accelerate3 and sea level to rise. In the Antarctic Peninsula, foehn winds enhance melting near the grounding line4, which in the recent past has led to the

  10. Funnel-web spider bite

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  11. Dynamic Antarctic ice sheet during the early to mid-Miocene

    Science.gov (United States)

    Gasson, Edward; DeConto, Robert M.; Pollard, David; Levy, Richard H.

    2016-03-01

    Geological data indicate that there were major variations in Antarctic ice sheet volume and extent during the early to mid-Miocene. Simulating such large-scale changes is problematic because of a strong hysteresis effect, which results in stability once the ice sheets have reached continental size. A relatively narrow range of atmospheric CO2 concentrations indicated by proxy records exacerbates this problem. Here, we are able to simulate large-scale variability of the early to mid-Miocene Antarctic ice sheet because of three developments in our modeling approach. (i) We use a climate-ice sheet coupling method utilizing a high-resolution atmospheric component to account for ice sheet-climate feedbacks. (ii) The ice sheet model includes recently proposed mechanisms for retreat into deep subglacial basins caused by ice-cliff failure and ice-shelf hydrofracture. (iii) We account for changes in the oxygen isotopic composition of the ice sheet by using isotope-enabled climate and ice sheet models. We compare our modeling results with ice-proximal records emerging from a sedimentological drill core from the Ross Sea (Andrill-2A) that is presented in a companion article. The variability in Antarctic ice volume that we simulate is equivalent to a seawater oxygen isotope signal of 0.52-0.66‰, or a sea level equivalent change of 30-36 m, for a range of atmospheric CO2 between 280 and 500 ppm and a changing astronomical configuration. This result represents a substantial advance in resolving the long-standing model data conflict of Miocene Antarctic ice sheet and sea level variability.

  12. Spider Bites (For Parents)

    Science.gov (United States)

    ... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

  13. The delta18O composition of Antarctic coastal current waters

    International Nuclear Information System (INIS)

    Frew, R.; Heywood, K.; Dennis, P.

    1997-01-01

    The varying proportions of 18 O to 16 O in sea water provide an oceanographic trace like salinity, but with an extra degree of freedom: salt is a tracer for the oceanic fluid, whereas the isotopic composition is a tracer specifically for the water component of that fluid. Hydrogen and oxygen isotopes are the variables most intimately related to the water component in the sea, therefore thay furnish a direct link to the water in the atmosphere and on continents and to the precipitation cycle which caused the salinity changes. The ratio of 18 O to 16 O (delta 18 O) ot waters is a powerful tracer in polar regions where sea and glacial ice processes decouple delta 18 O from salinity. Here we present observations from a significant but relatively unexplored component of the Southern Ocean current system, the Antarctic Coastal Current, and its associated Antarctic Slope Front. (author)

  14. Investigation into the impact of storms on sustaining summer primary productivity in the Sub-Antarctic Ocean

    CSIR Research Space (South Africa)

    Nicholson, Sarah-Anne

    2016-09-01

    Full Text Available ]. Observations of chlorophyll a show that summer blooms are widespread and occur annually [Carranza and Gille, 2015], are prominent within the Sub-Antarctic Zone (SAZ), and may be several months in duration (e.g., ~16weeks in Racault et al. [2012]), typically... al., 2005; Bowie et al., 2009] and is consistent with observations of low fe ratios during summer (i.e., the proportion of dissolved iron (DFe) uptake from “new” sources [Boyd et al., 2005]). In this seasonal scenario, after a “once-off” winter...

  15. Standardization and optimization of arthropod inventories-the case of Iberian spiders

    DEFF Research Database (Denmark)

    Bondoso Cardoso, Pedro Miguel

    2009-01-01

    and optimization of sampling protocols, especially for mega-diverse arthropod taxa. This study had two objectives: (1) propose guidelines and statistical methods to improve the standardization and optimization of arthropod inventories, and (2) to propose a standardized and optimized protocol for Iberian spiders......, by finding common results between the optimal options for the different sites. The steps listed were successfully followed in the determination of a sampling protocol for Iberian spiders. A protocol with three sub-protocols of varying degrees of effort (24, 96 and 320 h of sampling) is proposed. I also...

  16. Distribution and abundance of Antarctic krill (Euphausia superba) along the Antarctic Peninsula

    Science.gov (United States)

    Siegel, Volker; Reiss, Christian S.; Dietrich, Kimberly S.; Haraldsson, Matilda; Rohardt, Gerhard

    2013-07-01

    Net-based data on the abundance, distribution, and demographic patterns of Antarctic krill are quantified from a contemporaneous two ship survey of the Antarctic Peninsula during austral summer 2011. Two survey areas were sampled focussed on Marguerite Bay in the south, and the tip of the Antarctic Peninsula in the north. Data from 177 stations showed that the highest concentrations of krill were found in the southern sampling area. Differences between areas were associated with a few large catches of one year old krill found in anomalously warm and productive waters in Marguerite Bay, and small krill catches in the less-productive, offshore waters in the north. Estimated krill density across the survey area was 3.4 krill m-2, and was low compared to the long-term average of 45 krill m-2 for the Elephant Island area. Overall recruitment between the two survey regions was similar, but per capita recruitment was about 60% lower than historical mean recruitment levels measured at Elephant Island since the late 1970s. Demographic patterns showed small krill concentrated near the coast, and large krill concentrated offshore on the shelf and slope all along the survey area. The offshore distribution of adult krill was delineated by the warm (˜1 °C), low salinity (33.8) water at 30 m, suggesting that most krill were present shoreward of the southern boundary of Antarctic Circumpolar Current Front. Distributions of larvae indicated that three hotspot areas were important for the production of krill: slope areas outside Marguerite Bay and north of the South Shetland Islands, and near the coast around Antarctic Sound. Successful spawning, as inferred from larval abundance, was roughly coincident with the shelf break and not with inshore waters. Given the rapid changes in climate along the Antarctic Peninsula and the lower per capita recruitment observed in recent years, studies comparing and contrasting production, growth, and recruitment across the Peninsula will be

  17. Sympagic occurrence of Eusirid and Lysianassoid amphipods under Antarctic pack ice

    NARCIS (Netherlands)

    Krapp, Rupert H.; Berge, Jorgen; Flores, Hauke; Gulliksen, Bjorn; Werner, Iris

    2008-01-01

    During three Antarctic expeditions (2004, ANT XXI-4 and XXII-2; 2006, ANT XXIII-6) with the German research icebreaker R/V Polarstern, six different amphipod species were recorded under the pack ice of the Weddell Sea and the Lazarev Sea. These cruises covered Austral autumn (April), summer

  18. Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

    Science.gov (United States)

    Uma, Divya B; Weiss, Martha R

    2012-12-01

    An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

  19. Mass balance of the Antarctic ice sheet.

    Science.gov (United States)

    Wingham, D J; Shepherd, A; Muir, A; Marshall, G J

    2006-07-15

    The Antarctic contribution to sea-level rise has long been uncertain. While regional variability in ice dynamics has been revealed, a picture of mass changes throughout the continental ice sheet is lacking. Here, we use satellite radar altimetry to measure the elevation change of 72% of the grounded ice sheet during the period 1992-2003. Depending on the density of the snow giving rise to the observed elevation fluctuations, the ice sheet mass trend falls in the range -5-+85Gtyr-1. We find that data from climate model reanalyses are not able to characterise the contemporary snowfall fluctuation with useful accuracy and our best estimate of the overall mass trend-growth of 27+/-29Gtyr-1-is based on an assessment of the expected snowfall variability. Mass gains from accumulating snow, particularly on the Antarctic Peninsula and within East Antarctica, exceed the ice dynamic mass loss from West Antarctica. The result exacerbates the difficulty of explaining twentieth century sea-level rise.

  20. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  1. Basin-scale heterogeneity in Antarctic precipitation and its impact on surface mass variability

    Directory of Open Access Journals (Sweden)

    J. Fyke

    2017-11-01

    Full Text Available Annually averaged precipitation in the form of snow, the dominant term of the Antarctic Ice Sheet surface mass balance, displays large spatial and temporal variability. Here we present an analysis of spatial patterns of regional Antarctic precipitation variability and their impact on integrated Antarctic surface mass balance variability simulated as part of a preindustrial 1800-year global, fully coupled Community Earth System Model simulation. Correlation and composite analyses based on this output allow for a robust exploration of Antarctic precipitation variability. We identify statistically significant relationships between precipitation patterns across Antarctica that are corroborated by climate reanalyses, regional modeling and ice core records. These patterns are driven by variability in large-scale atmospheric moisture transport, which itself is characterized by decadal- to centennial-scale oscillations around the long-term mean. We suggest that this heterogeneity in Antarctic precipitation variability has a dampening effect on overall Antarctic surface mass balance variability, with implications for regulation of Antarctic-sourced sea level variability, detection of an emergent anthropogenic signal in Antarctic mass trends and identification of Antarctic mass loss accelerations.

  2. On the Antarctic Slope Front and Current crossing of the South Scotia Ridge

    Science.gov (United States)

    Orsi, A. H.; Palmer, M.; Gomis, D.; Flexas, M. M.; Kim, Y.-S.; Jordà, G.; Wiederwohl, C.; Álvarez, M.

    2012-04-01

    To unveil the contorted path followed by the Antarctic Slope Current connecting the Weddell and Scotia Seas, hydrographic stations with unprecedented spatial resolution were occupied on a series of sections across the slope and multiple channels in the double-pronged western portion of the South Scotia Ridge. Fieldwork consisted of two cruises from the ESASSI (January 2008) and ACROSS (February 2009) programs, the Spanish and USA/Argentina components of the International Polar Year core project SASSI (Synoptic Antarctic Shelf-Slope Interaction study). In this region the Antarctic Slope Current can be located by the pronounced in-shore deepening of isopycnals over the continental slope, rendering the strong subsurface temperature and salinity gradients characteristic of the Antarctic Slope Front. Before reaching the gaps in the southern Ridge near 51°W and 50°W, the ASC carries about 3 Sv of upper layer waters, but it splits into shallow and deep branches upon turning north through these two gaps. The shallower branch enters the Hesperides Trough at 51°W, then shows a tight cyclonic loop back to that longitude roughly following the slope's 700-m isobath, and turns again westward through a similar gap in the northern Ridge. In the Scotia Sea the westward-flowing Antarctic Slope Current is found as far west as the Elephant Island along slightly deeper levels of slope (1100 m) before it is blocked by the Antarctic Circumpolar Current south of the Shackleton Fracture Zone (56°W). The deeper branch of the ASC in the Powell Basin crosses the southern Ridge near 50°W and roughly follows the 1600-m isobath before entering the Scotia Sea through the Hesperides Gap farther to the east (49°W). Thereafter the deeper waters carried westward by this branch become undistinguishable from those circulating farther offshore. Repeat cross-slope sections at both southern and northern flanks of the South Scotia Ridge showed significant temporal variability in the characteristics

  3. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  4. Bat predation by spiders.

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

  5. Accumulation of fossil CO/sub 2/ in the atmosphere and the sea

    Energy Technology Data Exchange (ETDEWEB)

    Fairhall, A W

    1973-09-07

    A model is presented which accounts quantitatively for the buildup of fossil CO/sub 2/ in the atmosphere. The model also predicts something not previously recognized: a significant uptake of fossil CO/sub 2/ by the sea. The sea is presently supersaturated with respect to aragonite and calcite, which calcareous organisms form in building their shells. Should the sea become unsaturated in CaCO/sub 3/ the shells of these organisms would tend to dissolve, as would the ocean's coral reefs. One test of the model would be afforded by careful monitoring of total CO/sub 2/ levels in the mixed layer over the next few years. The model predicts an increase in the mixed layer of about 1.4 per cent in the next decade. Because this is about double the accuracy of the present methods for measuring total CO/sub 2/ in seawater, this trend, if present, should be detectable within 3 to 5 years. (MFB)

  6. New Tools for Sea Ice Data Analysis and Visualization: NSIDC's Arctic Sea Ice News and Analysis

    Science.gov (United States)

    Vizcarra, N.; Stroeve, J.; Beam, K.; Beitler, J.; Brandt, M.; Kovarik, J.; Savoie, M. H.; Skaug, M.; Stafford, T.

    2017-12-01

    Arctic sea ice has long been recognized as a sensitive climate indicator and has undergone a dramatic decline over the past thirty years. Antarctic sea ice continues to be an intriguing and active field of research. The National Snow and Ice Data Center's Arctic Sea Ice News & Analysis (ASINA) offers researchers and the public a transparent view of sea ice data and analysis. We have released a new set of tools for sea ice analysis and visualization. In addition to Charctic, our interactive sea ice extent graph, the new Sea Ice Data and Analysis Tools page provides access to Arctic and Antarctic sea ice data organized in seven different data workbooks, updated daily or monthly. An interactive tool lets scientists, or the public, quickly compare changes in ice extent and location. Another tool allows users to map trends, anomalies, and means for user-defined time periods. Animations of September Arctic and Antarctic monthly average sea ice extent and concentration may also be accessed from this page. Our tools help the NSIDC scientists monitor and understand sea ice conditions in near real time. They also allow the public to easily interact with and explore sea ice data. Technical innovations in our data center helped NSIDC quickly build these tools and more easily maintain them. The tools were made publicly accessible to meet the desire from the public and members of the media to access the numbers and calculations that power our visualizations and analysis. This poster explores these tools and how other researchers, the media, and the general public are using them.

  7. Investigating the turbulence response of a 1-D idealized water column located in the sub-Antarctic zone with focus on the upper ocean dynamics

    CSIR Research Space (South Africa)

    Boodhraj, Kirodh

    2017-09-01

    Full Text Available A one-dimensional ocean physical model was implemented in the sub-Antarctic Southern Ocean using the Nucleus for the European Modelling of the Ocean (NEMO) model. It was used to examine the effects of the turbulence response of the simulation...

  8. Polonium-210 and lead-210 in the Southern Polar Ocean: Naturally occurring tracers of biological and hydrographical processes in the surface waters of the Antarctic Circumpolar Current and the Weddell Sea

    International Nuclear Information System (INIS)

    Friedrich, J.

    1997-01-01

    In this thesis the distribution of 210 Po and 210 Pb in the upper 600 m of the Antarctic Circumpolar Current and the Weddell Sea was investigated along north-south transects in austral spring and autumn. 210 Po and 210 Pb can serve as sensitive tracers for the special hydrographic conditions of the Antarctic Circumpolar Current and the Weddell Sea as well as for biological processes during phytoplankton blooms. The 210 Po/ 210 Pb disequilibrium was used as a tracer for particle export. This tracer integrates export on a timescale of 276 days because of the 138 day half-life of 210 Po and complements the 234 Th/ 238 U disequilibrium as another tracer for plankton production and export on a shorter timescale of several weeks. (orig.) [de

  9. Balance of the West Antarctic Ice Sheet

    Science.gov (United States)

    2002-01-01

    For several decades, measurements of the West Antarctic Ice Sheet showed it to be retreating rapidly. But new data derived from satellite-borne radar sensors show the ice sheet to be growing. Changing Antarctic ice sheets remains an area of high scientific interest, particularly in light of recent global warming concerns. These new findings are significant because scientists estimate that sea level would rise 5-6 meters (16-20 feet) if the ice sheet collapsed into the sea. Do these new measurements signal the end of the ice sheet's 10,000-year retreat? Or, are these new satellite data simply much more accurate than the sparse ice core and surface measurements that produced the previous estimates? Another possibility is that the ice accumulation may simply indicate that the ice sheet naturally expands and retreats in regular cycles. Cryologists will grapple with these questions, and many others, as they examine the new data. The image above depicts the region of West Antarctica where scientists measured ice speed. The fast-moving central ice streams are shown in red. Slower tributaries feeding the ice streams are shown in blue. Green areas depict slow-moving, stable areas. Thick black lines depict the areas that collect snowfall to feed their respective ice streams. Reference: Ian Joughin and Slawek Tulaczyk Science Jan 18 2002: 476-480. Image courtesy RADARSAT Antarctic Mapping Project

  10. Flapping, wobbling, and zig-zagging: Tomographic PIV measurements of Antarctic sea butterfly ``flying'' underwater

    Science.gov (United States)

    Adhikari, D.; Webster, D. R.; Yen, J.

    2015-11-01

    A portable tomographic PIV technique was used to study the fluid dynamics and kinematics of sea butterflies in Antarctica. Antarctic pteropods (or sea butterflies), which are currently threatened by ocean acidification, swim in seawater with a pair of gelatinous parapodia (or ``wings'') via a unique propulsion mechanism. Both power and recovery strokes propel the organism (1.5 - 5 mm in size) upward in a sawtooth-like trajectory with average speed of 14 - 30 mm/s and pitch the shell forwards-and-backwards at 1.9 - 3 Hz. The pitching motion effectively positions the parapodia such that they stroke downward during both the power and recovery strokes. Reynolds numbers defined for flapping, translating, and pitching (i.e. Ref, ReU, and ReΩ) characterize the motion of the pteropod. For Ref <50, the shell does not pitch and the pteropod swims abnormally. We present a detailed comparison of the volumetric fluid velocity fields induced by pteropods swimming upwards with Ref = 80 and 180. The pteropod at the lower Ref creates an attached shear flow along the parapodia and pushes fluid in a method analogous to a paddle. In contrast, at higher Ref, the flow along the parapodia separates and generates complex vortex structures.

  11. Spatial Patterns of Variability in Antarctic Surface Temperature: Connections to the Southern Hemisphere Annular Mode and the Southern Oscillation

    Science.gov (United States)

    Kwok, Ron; Comiso, Josefino C.; Koblinsky, Chester J. (Technical Monitor)

    2002-01-01

    The 17-year (1982-1998) trend in surface temperature shows a general cooling over the Antarctic continent, warming of the sea ice zone, with moderate changes over the oceans. Warming of the peripheral seas is associated with negative trends in the regional sea ice extent. Effects of the Southern Hemisphere Annular Mode (SAM) and the extrapolar Southern Oscillation (SO) on surface temperature are quantified through regression analysis. Positive polarities of the SAM are associated with cold anomalies over most of Antarctica, with the most notable exception of the Antarctic Peninsula. Positive temperature anomalies and ice edge retreat in the Pacific sector are associated with El Nino episodes. Over the past two decades, the drift towards high polarity in the SAM and negative polarity in the SO indices couple to produce a spatial pattern with warmer temperatures in the Antarctic Peninsula and peripheral seas, and cooler temperatures over much of East Antarctica.

  12. Spatially Extensive Standardized Surveys Reveal Widespread, Multi-Decadal Increase in East Antarctic Adélie Penguin Populations.

    Science.gov (United States)

    Southwell, Colin; Emmerson, Louise; McKinlay, John; Newbery, Kym; Takahashi, Akinori; Kato, Akiko; Barbraud, Christophe; DeLord, Karine; Weimerskirch, Henri

    2015-01-01

    Seabirds are considered to be useful and practical indicators of the state of marine ecosystems because they integrate across changes in the lower trophic levels and the physical environment. Signals from this key group of species can indicate broad scale impacts or response to environmental change. Recent studies of penguin populations, the most commonly abundant Antarctic seabirds in the west Antarctic Peninsula and western Ross Sea, have demonstrated that physical changes in Antarctic marine environments have profound effects on biota at high trophic levels. Large populations of the circumpolar-breeding Adélie penguin occur in East Antarctica, but direct, standardized population data across much of this vast coastline have been more limited than in other Antarctic regions. We combine extensive new population survey data, new population estimation methods, and re-interpreted historical survey data to assess decadal-scale change in East Antarctic Adélie penguin breeding populations. We show that, in contrast to the west Antarctic Peninsula and western Ross Sea where breeding populations have decreased or shown variable trends over the last 30 years, East Antarctic regional populations have almost doubled in abundance since the 1980's and have been increasing since the earliest counts in the 1960's. The population changes are associated with five-year lagged changes in the physical environment, suggesting that the changing environment impacts primarily on the pre-breeding age classes. East Antarctic marine ecosystems have been subject to a number of changes over the last 50 years which may have influenced Adélie penguin population growth, including decadal-scale climate variation, an inferred mid-20th century sea-ice contraction, and early-to-mid 20th century exploitation of fish and whale populations.

  13. Spatially Extensive Standardized Surveys Reveal Widespread, Multi-Decadal Increase in East Antarctic Adélie Penguin Populations.

    Directory of Open Access Journals (Sweden)

    Colin Southwell

    Full Text Available Seabirds are considered to be useful and practical indicators of the state of marine ecosystems because they integrate across changes in the lower trophic levels and the physical environment. Signals from this key group of species can indicate broad scale impacts or response to environmental change. Recent studies of penguin populations, the most commonly abundant Antarctic seabirds in the west Antarctic Peninsula and western Ross Sea, have demonstrated that physical changes in Antarctic marine environments have profound effects on biota at high trophic levels. Large populations of the circumpolar-breeding Adélie penguin occur in East Antarctica, but direct, standardized population data across much of this vast coastline have been more limited than in other Antarctic regions. We combine extensive new population survey data, new population estimation methods, and re-interpreted historical survey data to assess decadal-scale change in East Antarctic Adélie penguin breeding populations. We show that, in contrast to the west Antarctic Peninsula and western Ross Sea where breeding populations have decreased or shown variable trends over the last 30 years, East Antarctic regional populations have almost doubled in abundance since the 1980's and have been increasing since the earliest counts in the 1960's. The population changes are associated with five-year lagged changes in the physical environment, suggesting that the changing environment impacts primarily on the pre-breeding age classes. East Antarctic marine ecosystems have been subject to a number of changes over the last 50 years which may have influenced Adélie penguin population growth, including decadal-scale climate variation, an inferred mid-20th century sea-ice contraction, and early-to-mid 20th century exploitation of fish and whale populations.

  14. Did You Say Spiders?

    Science.gov (United States)

    Campbell, Alene

    This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

  15. Solvothermal synthesis and high optical performance of three-dimensional sea-urchin-like TiO{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Yi, E-mail: zhouyihn@163.com; Wang, Yutang; Li, Mengyao; Li, Xuzhi; Yi, Qin; Deng, Pan; Wu, Hongyan

    2015-06-15

    Graphical abstract: I–V characteristics of different TiO{sub 2} microspheres based DSSCs (a) 3D sphere-like, (b) 3D flower-like, (c) 3D sea-urchin-like. - Highlights: • 3D sea-urchin-like TiO{sub 2} was synthesized by solvothermal method. • The effects of preparation parameters on the microstructure of the microspheres were investigated. • The photoelectric properties of 3D sea-urchin-like TiO{sub 2} were studied upon DSSCs. • The PCE of the 3D sea-urchin-like TiO{sub 2} was higher than that of other morphologies. - Abstract: Three-dimensional (3D) sea-urchin-like TiO{sub 2} microspheres were successfully synthesised by solvothermal method. The effects of preparation parameters including reaction temperature, concentration and mass fraction of precursor, and solvent volume on the microstructure of the microspheres were investigated. Results of scanning electron microscopy showed that the preparation parameters played a critical role in the morphology of 3D sea-urchin-like TiO{sub 2}. In addition, when the sea-urchin-like TiO{sub 2} nanostructures were used as the dye-sensitized solar cells (DSSCs) anode, the power-conversion efficiency was higher than that of other morphologies, which was due to the special 3D hierarchical nanostructure, large specific surface area, and enhanced absorption of UV–vis of the TiO{sub 2} nanostructures.

  16. Poles apart: the "bipolar" pteropod species Limacina helicina is genetically distinct between the Arctic and Antarctic oceans.

    Science.gov (United States)

    Hunt, Brian; Strugnell, Jan; Bednarsek, Nina; Linse, Katrin; Nelson, R John; Pakhomov, Evgeny; Seibel, Brad; Steinke, Dirk; Würzberg, Laura

    2010-03-23

    The shelled pteropod (sea butterfly) Limacina helicina is currently recognised as a species complex comprising two sub-species and at least five "forma". However, at the species level it is considered to be bipolar, occurring in both the Arctic and Antarctic oceans. Due to its aragonite shell and polar distribution L. helicina is particularly vulnerable to ocean acidification. As a key indicator of the acidification process, and a major component of polar ecosystems, L. helicina has become a focus for acidification research. New observations that taxonomic groups may respond quite differently to acidification prompted us to reassess the taxonomic status of this important species. We found a 33.56% (+/-0.09) difference in cytochrome c oxidase subunit I (COI) gene sequences between L. helicina collected from the Arctic and Antarctic oceans. This degree of separation is sufficient for ordinal level taxonomic separation in other organisms and provides strong evidence for the Arctic and Antarctic populations of L. helicina differing at least at the species level. Recent research has highlighted substantial physiological differences between the poles for another supposedly bipolar pteropod species, Clione limacina. Given the large genetic divergence between Arctic and Antarctic L. helicina populations shown here, similarly large physiological differences may exist between the poles for the L. helicina species group. Therefore, in addition to indicating that L. helicina is in fact not bipolar, our study demonstrates the need for acidification research to take into account the possibility that the L. helicina species group may not respond in the same way to ocean acidification in Arctic and Antarctic ecosystems.

  17. Observation Impact over the Antarctic During the Concordiasi Field Campaign

    Science.gov (United States)

    Boullot, Nathalie; Rabier, Florence; Langland, Rolf; Gelaro, Ron; Cardinali, Carla; Guidard, Vincent; Bauer, Peter; Doerenbecher, Alexis

    2014-01-01

    The impact of observations on analysis uncertainty and forecast performance was investigated for Austral Spring 2010 over the Southern polar area for four different systems (NRL, GMAO, ECMWF and Meteo-France), at the time of the Concordiasi field experiment. The largest multi model variance in 500 hPa height analyses is found in the southern sub-Antarctic oceanic region, where there are strong atmospheric dynamics, rapid forecast error growth, and fewer upper air wind observation data to constrain the analyses. In terms of data impact the most important observation components are shown to be AMSU, IASI, AIRS, GPS-RO, radiosonde, surface and atmospheric motion vector observations. For sounding data, radiosondes and dropsondes, one can note a large impact of temperature at low levels and a large impact of wind at high levels. Observing system experiments using the Concordiasi dropsondes show a large impact of the observations over the Antarctic plateau extending to lower latitudes with the forecast range, with a large impact around 50 to 70deg South. These experiments indicate there is a potential benefit of better using radiance data over land and sea-ice and innovative atmospheric motion vectors obtained from a combination of various satellites to fill the current data gaps and improve NWP in this region.

  18. Vigorous lateral export of the meltwater outflow from beneath an Antarctic ice shelf.

    Science.gov (United States)

    Garabato, Alberto C Naveira; Forryan, Alexander; Dutrieux, Pierre; Brannigan, Liam; Biddle, Louise C; Heywood, Karen J; Jenkins, Adrian; Firing, Yvonne L; Kimura, Satoshi

    2017-02-09

    The instability and accelerated melting of the Antarctic Ice Sheet are among the foremost elements of contemporary global climate change. The increased freshwater output from Antarctica is important in determining sea level rise, the fate of Antarctic sea ice and its effect on the Earth's albedo, ongoing changes in global deep-ocean ventilation, and the evolution of Southern Ocean ecosystems and carbon cycling. A key uncertainty in assessing and predicting the impacts of Antarctic Ice Sheet melting concerns the vertical distribution of the exported meltwater. This is usually represented by climate-scale models as a near-surface freshwater input to the ocean, yet measurements around Antarctica reveal the meltwater to be concentrated at deeper levels. Here we use observations of the turbulent properties of the meltwater outflows from beneath a rapidly melting Antarctic ice shelf to identify the mechanism responsible for the depth of the meltwater. We show that the initial ascent of the meltwater outflow from the ice shelf cavity triggers a centrifugal overturning instability that grows by extracting kinetic energy from the lateral shear of the background oceanic flow. The instability promotes vigorous lateral export, rapid dilution by turbulent mixing, and finally settling of meltwater at depth. We use an idealized ocean circulation model to show that this mechanism is relevant to a broad spectrum of Antarctic ice shelves. Our findings demonstrate that the mechanism producing meltwater at depth is a dynamically robust feature of Antarctic melting that should be incorporated into climate-scale models.

  19. Environmental contamination in Antarctic ecosystems.

    Science.gov (United States)

    Bargagli, R

    2008-08-01

    Although the remote continent of Antarctica is perceived as the symbol of the last great wilderness, the human presence in the Southern Ocean and the continent began in the early 1900s for hunting, fishing and exploration, and many invasive plant and animal species have been deliberately introduced in several sub-Antarctic islands. Over the last 50 years, the development of research and tourism have locally affected terrestrial and marine coastal ecosystems through fuel combustion (for transportation and energy production), accidental oil spills, waste incineration and sewage. Although natural "barriers" such as oceanic and atmospheric circulation protect Antarctica from lower latitude water and air masses, available data on concentrations of metals, pesticides and other persistent pollutants in air, snow, mosses, lichens and marine organisms show that most persistent contaminants in the Antarctic environment are transported from other continents in the Southern Hemisphere. At present, levels of most contaminants in Antarctic organisms are lower than those in related species from other remote regions, except for the natural accumulation of Cd and Hg in several marine organisms and especially in albatrosses and petrels. The concentrations of organic pollutants in the eggs of an opportunistic top predator such as the south polar skua are close to those that may cause adverse health effects. Population growth and industrial development in several countries of the Southern Hemisphere are changing the global pattern of persistent anthropogenic contaminants and new classes of chemicals have already been detected in the Antarctic environment. Although the Protocol on Environmental Protection to the Antarctic Treaty provides strict guidelines for the protection of the Antarctic environment and establishes obligations for all human activity in the continent and the Southern Ocean, global warming, population growth and industrial development in countries of the Southern

  20. Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

    Science.gov (United States)

    Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

    2011-10-01

    Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

  1. Past Penguin Colony Linkages to Climate Change and Catastrophic Volcanism on the Northern Antarctic Peninsula

    Science.gov (United States)

    Roberts, S. J.; Monien, P.; Foster, L. C.; Loftfield, J.; Schnetger, B.; Pearson, E. J.; Hocking, E. P.; Fretwell, P.; Ireland, L.; Ochyra, R.; Haworth, A.; Allen, C. S.; Brumsack, H. J.; Bentley, M.; Hodgson, D.

    2016-12-01

    Recent warming and reductions in sea-ice in some parts of Antarctica are thought to be having a negative impact on populations of `ice-dependent' penguin species (e.g., Emperor, Adélie) that feed at the sea-ice edge because populations of `ice-avoiding'/more `adaptable' species (e.g., Gentoo, Chinstrap) have remained stable or increased, and some Adélie colonies located in areas of sea-ice expansion have increased. This hypothesis is based on short observational records and limited subfossil evidence, but has not been tested over longer, mid-late Holocene, timescales on the Antarctic Peninsula. Between 1950-1997, the northern Antarctic Peninsula was one of the most rapidly warming regions in the Southern Hemisphere and, over the last 30 years, the largest breeding population of Gentoo penguins in Antarctica on Ardley Island, north-western Antarctic Peninsula, has increased. We tracked past changes in the Ardley Island penguin colony size by comparing detailed biogeochemical analysis of an 8,500-year Ardley Lake sediment profile with past records of penguin presence, climate and sea-ice extent across the Antarctic Peninsula and found that the colony also responded positively during some local-regionally warmer parts of the late Holocene. However, at least three large volcanic eruptions from nearby Deception Island had a devastating impact on the colony between 7000-2000 years ago, with colony recovery taking up to 800 years following the most disruptive period of volcanic activity c. 5500-5000 years ago.

  2. Southern Ocean CO2 sink: the contribution of the sea ice

    DEFF Research Database (Denmark)

    Delille, B.; Vancoppenolle, Martin; Geilfus, Nicolas-Xavier

    2014-01-01

    at the air-sea ice interface. The sea ice changes from a transient source to a sink for atmospheric CO2. We upscale these observations to the whole Antarctic sea ice cover using the NEMO-LIM3 large-scale sea ice-ocean and provide first esti- mates of spring and summer CO2 uptake from the atmosphere...... by Antarctic sea ice. Over the spring- summer period, the Antarctic sea ice cover is a net sink of atmospheric CO2 of 0.029 Pg C, about 58% of the estimated annual uptake from the Southern Ocean. Sea ice then contributes significantly to the sink of CO2 of the Southern Ocean....... undersaturation while the underlying oceanic waters remains slightly oversaturated. The decrease from winter to summer of pCO2 in the brines is driven by dilution with melting ice, dissolution of carbonate crystals, and net primary production. As the ice warms, its permeability increases, allowing CO2 transfer...

  3. Black widow spider

    Science.gov (United States)

    ... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

  4. Impacts of marine instability across the East Antarctic Ice Sheet on Southern Ocean dynamics

    Directory of Open Access Journals (Sweden)

    S. J. Phipps

    2016-09-01

    Full Text Available Recent observations and modelling studies have demonstrated the potential for rapid and substantial retreat of large sectors of the East Antarctic Ice Sheet (EAIS. This has major implications for ocean circulation and global sea level. Here we examine the effects of increasing meltwater from the Wilkes Basin, one of the major marine-based sectors of the EAIS, on Southern Ocean dynamics. Climate model simulations reveal that the meltwater flux rapidly stratifies surface waters, leading to a dramatic decrease in the rate of Antarctic Bottom Water (AABW formation. The surface ocean cools but, critically, the Southern Ocean warms by more than 1 °C at depth. This warming is accompanied by a Southern Ocean-wide “domino effect”, whereby the warming signal propagates westward with depth. Our results suggest that melting of one sector of the EAIS could result in accelerated warming across other sectors, including the Weddell Sea sector of the West Antarctic Ice Sheet. Thus, localised melting of the EAIS could potentially destabilise the wider Antarctic Ice Sheet.

  5. Phase and amplitude Variation of Weddell Sea Anomaly at King Sejong Station in Antarctic between 2005 and 2009

    Science.gov (United States)

    Chung, J.; Lee, C.; Jee, G.

    2011-12-01

    The Weddell Sea Anomaly (WSA) in ionosphere has been defined by higher electron density at nighttime than during the daytime on summer season near the region of the Weddell Sea.Recent studies show the WSA is an extreme case of longitudinal variation and occurrs all of season except for winter when F10.7 is high. We examine the temporal variation of the WSA using the ground-based GPS TEC measured King Sejong station (geographic latitude 62.2°S, longitude 58.5°W, corrected geomagnetic latitude 48°S) in Antarctic between 2005 and 2009 in condition of solar minimum. We analyze the characteristics of diurnal and semi-diurnal variation for all of years and examine the yearly and seasonal variation of phase and amplitude of the WSA. Our results of local time GPS TEC variation show the amplitudes of the WSA are significant in the summer and its phases appear to be changed according to the season.

  6. What you fear will appear: detection of schematic spiders in spider fear.

    Science.gov (United States)

    Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

    2010-01-01

    Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

  7. Brown Recluse Spider

    Science.gov (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  8. Regional Antarctic snow accumulation over the past 1000 years

    Directory of Open Access Journals (Sweden)

    E. R. Thomas

    2017-11-01

    Full Text Available Here we present Antarctic snow accumulation variability at the regional scale over the past 1000 years. A total of 79 ice core snow accumulation records were gathered and assigned to seven geographical regions, separating the high-accumulation coastal zones below 2000 m of elevation from the dry central Antarctic Plateau. The regional composites of annual snow accumulation were evaluated against modelled surface mass balance (SMB from RACMO2.3p2 and precipitation from ERA-Interim reanalysis. With the exception of the Weddell Sea coast, the low-elevation composites capture the regional precipitation and SMB variability as defined by the models. The central Antarctic sites lack coherency and either do not represent regional precipitation or indicate the model inability to capture relevant precipitation processes in the cold, dry central plateau. Our results show that SMB for the total Antarctic Ice Sheet (including ice shelves has increased at a rate of 7 ± 0.13 Gt decade−1 since 1800 AD, representing a net reduction in sea level of ∼ 0.02 mm decade−1 since 1800 and ∼ 0.04 mm decade−1 since 1900 AD. The largest contribution is from the Antarctic Peninsula (∼ 75 % where the annual average SMB during the most recent decade (2001–2010 is 123 ± 44 Gt yr−1 higher than the annual average during the first decade of the 19th century. Only four ice core records cover the full 1000 years, and they suggest a decrease in snow accumulation during this period. However, our study emphasizes the importance of low-elevation coastal zones, which have been under-represented in previous investigations of temporal snow accumulation.

  9. The late Cainozoic East Antarctic ice sheet

    International Nuclear Information System (INIS)

    Colhoun, E.A.

    1999-01-01

    A review, mainly of East Antarctic late Cainozoic (post 40 Ma) geological and geomorphological evidence, supports the hypothesis of the continuous presence of an ice sheet, of about the present size, since the late Miocene. Evidence is presented and the view advanced that, during the late Wisconsin maximum of isotope stage 2, ice was not nearly as thick or extensive over the continental shelf as required by the model of 'maximum' Antarctic glaciation. Some of the factors influencing the contribution of Antarctica to post-glacial sea-level rise are discussed. It is considered that Antarctica's contribution was probably considerably less than previously estimated. The dating of marine and freshwater sequences in the Vestfold and Bunger Hills is consistent with deglaciation around the Pleistocene Holocene boundary, after the Late Wisconsin maximum. A date of ∼25 ka BP from permafrost in the Larsemann Hills means that either the Larsemann Hills were not glaciated during the Late Wisconsin or the ice failed to erode much of the permafrost surface. The degree of weathering of rock and glacial drifts in the Vestfold, Larsemann and Bunger Hills suggests a long time for formation, perhaps considerably longer than indicated by the dated marine and freshwater sediment sequences. Cosmogenic isotope dating in the Vestfold Hills has provided equivocal ages for deglaciation. While the results could indicate deglaciation before 80 ka BP, they do not confirm such early deglaciation. If the ice cover was thin and failed to remove the previous rock exposure profile, then the assays could predate the last ice advance. Weathered iron crust fragments in the till suggest little erosion. The raised beaches of the oases are Holocene. Assuming they have been produced by post Late Wisconsin isostatic uplift and by the Holocene transgression, calculations show that the Antarctic continental ice sheet could not have been more than ∼500 m thicker in the inner shelf-coastal zone. The

  10. Ecuadorian antarctic act

    International Nuclear Information System (INIS)

    1998-02-01

    To develop research in this continent involves to take communion with earth where the cold pole of the planet is located, the stormiest sea of the world surround it and where the capricious continental and geographical distribution permits the pass of meteorological violent and continuous systems. The Ecuador, in execution of the acquired commitments like Full Member of the System of the Antarctic Treaty, carried out the VII Expedition to the White Continent with an extensive program of scientific investigation in the field of: Sciences of Life, Sciences of the Earth and Atmospheric Sciences, so much in the environment of the Pacific Southeast, the Drake Pass, Bransfield Strait and the nearby ecosystems antarctic to Point Fort William in the Greenwich Island, site where the Ecuadorian station Pedro Vicente Maldonado is located. The scientific articles, result of the fruitful work of national investigator is consigned in this fourth edition. This publication constitutes our contribution to the world in the knowledge, understanding and handling of the marvelous White Continent from the middle of our planet, Ecuador

  11. Advective pathways near the tip of the Antarctic Peninsula: Trends, variability and ecosystem implications

    Science.gov (United States)

    Renner, Angelika H. H.; Thorpe, Sally E.; Heywood, Karen J.; Murphy, Eugene J.; Watkins, Jon L.; Meredith, Michael P.

    2012-05-01

    Pathways and rates of ocean flow near the Antarctic Peninsula are strongly affected by frontal features, forcings from the atmosphere and the cryosphere. In the surface mixed layer, the currents advect material from the northwestern Weddell Sea on the eastern side of the Peninsula around the tip of the Peninsula to its western side and into the Scotia Sea, connecting populations of Antarctic krill (Euphausia superba) and supporting the ecosystem of the region. Modelling of subsurface drifters using a particle tracking algorithm forced by the velocity fields of a coupled sea ice-ocean model (ORCA025-LIM2) allows analysis of the seasonal and interannual variability of drifter pathways over 43 years. The results show robust and persistent connections from the Weddell Sea both to the west into the Bellingshausen Sea and across the Scotia Sea towards South Georgia, reproducing well the observations. The fate of the drifters is sensitive to their deployment location, in addition to other factors. From the shelf of the eastern Antarctic Peninsula, the majority enter the Bransfield Strait and subsequently the Bellingshausen Sea. When originating further offshore over the deeper Weddell Sea, drifters are more likely to cross the South Scotia Ridge and reach South Georgia. However, the wind field east and southeast of Elephant Island, close to the tip of the Peninsula, is crucial for the drifter trajectories and is highly influenced by the Southern Annular Mode (SAM). Increased advection and short travel times to South Georgia, and reduced advection to the western Antarctic Peninsula can be linked to strong westerlies, a signature of the positive phase of the SAM. The converse is true for the negative phase. Strong westerlies and shifts of ocean fronts near the tip of the Peninsula that are potentially associated with both the SAM and the El Niño-Southern Oscillation restrict the connection from the Weddell Sea to the west, and drifters then predominantly follow the open

  12. Relative sea level in the Western Mediterranean basin: A regional test of the ICE-7G_NA (VM7) model and a constraint on late Holocene Antarctic deglaciation

    Science.gov (United States)

    Roy, Keven; Peltier, W. R.

    2018-03-01

    The Mediterranean Basin is a region of special interest in the study of past and present relative sea level evolution, given its location south of the ice sheets that covered large fractions of Northern Europe during the last glaciation, the large number of biological, geological and archaeological sea level indicators that have been retrieved from its coastal regions, as well as its high density of modern coastal infrastructure. Models of the Glacial Isostatic Adjustment (GIA) process provide reconstructions of past relative sea level evolution, and can be tested for validity against past sea level indicators from the region. It is demonstrated herein that the latest ICE-7G_NA (VM7) model of the GIA process, the North American component of which was refined using a full suite of geophysical observables, is able to reconcile the vast majority of uniformly analyzed relative sea level constraints available for the Western part of the Mediterranean basin, a region to which it was not tuned. We also revisit herein the previously published interpretations of relative sea level information obtained from Roman-era coastal Mediterranean "fish tanks", analyze the far-field influence of the rate of late Holocene Antarctic ice sheet melting history on the exceptionally detailed relative sea level history available from southern Tunisia, and extend the analysis to complementary constraints on the history of Antarctic ice-sheet melting available from islands in the equatorial Pacific Ocean. The analyses reported herein provide strong support for the global "exportability" of the ICE-7G_NA (VM7) model, a result that speaks directly to the ability of spherically symmetric models of the internal viscoelastic structure to explain globally distributed observations, while also identifying isolated regions of remaining misfit which will benefit from further study.

  13. Chemical evidence of the changes of the Antarctic Bottom Water ventilation in the western Ross Sea between 1997 and 2003

    Science.gov (United States)

    Rivaro, Paola; Massolo, Serena; Bergamasco, Andrea; Castagno, Pasquale; Budillon, Giorgio

    2010-05-01

    Data from three Italian CLIMA project cruises between 1997 and 2003 were used to obtain sections of the hydrographic and chemical properties of the main water masses across the shelf break off Cape Adare (western Ross Sea, Antarctica). Dissolved oxygen, nitrate and phosphate data were combined on the basis of the Redfield ratio to obtain the quasi-conservative tracers NO (9[NO 3]+[O 2]), PO (135[PO 4]+[O 2]) and phosphate star PO4* ( PO4*=[PO 4]+[O 2]/175-1.95). In 1997 and 2003 the presence of the High Salinity Shelf Water at the bottom depth near the sill was traced by both physical and chemical measurements. In 2001 the Modified Shelf Water, characterized by warmer temperature and by a lower dissolved oxygen content than High Salinity Shelf Water, was observed at the shelf edge. The distribution of the chemical tracers together with the hydrographic observations showed recently formed Antarctic Bottom Water on the continental slope during all of the cruises. These observations were confirmed by the extended optimum multiparameter analysis. The calculated thickness of the new Antarctic Bottom Water, as well as the tracer content, were variable in time and in space. The estimated volume of the new Antarctic Bottom Water and the export of dissolved oxygen and nutrient associated with the overflowing water were different over the examined period. In particular, a lower (˜55%) export was evidenced in 2001 compared to 1997.

  14. Law 16.518 Antarctic Treaty: approve the protocols about Environment protection and annex s

    International Nuclear Information System (INIS)

    1994-01-01

    The treaty Antarctic in their appendix C in its articles is about the elimination of residuals by means of its removal of the area of having Treated Antarctic among them radioactive materials, planning of the wastes, communication treatment and exam of the plans of treatment of wastes, treatment proceeding prevention of sea contamination ,discharge of hydrocarbons petroliferous, discharge of liquid noxious substances [es

  15. The paradox of a long grounding during West Antarctic Ice Sheet retreat in Ross Sea.

    Science.gov (United States)

    Bart, Philip J; Krogmeier, Benjamin J; Bart, Manon P; Tulaczyk, Slawek

    2017-04-28

    Marine geological data show that the West Antarctic Ice Sheet (WAIS) advanced to the eastern Ross Sea shelf edge during the Last Glacial Maximum (LGM) and eventually retreated ~1000 km to the current grounding-line position on the inner shelf. During the early deglacial, the WAIS deposited a voluminous stack of overlapping grounding zone wedges (GZWs) on the outer shelf of the Whales Deep Basin. The large sediment volume of the GZW cluster suggests that the grounding-line position of the paleo-Bindschadler Ice Stream was relatively stationary for a significant time interval. We used an upper bound estimate of paleo-sediment flux to investigate the lower bound duration over which the ice stream would have deposited sediment to account for the GZW volume. Our calculations show that the cluster represents more than three millennia of ice-stream sedimentation. This long duration grounding was probably facilitated by rapid GZW growth. The subsequent punctuated large-distance (~200 km) grounding-line retreat may have been a highly non-linear ice sheet response to relatively continuous external forcing such as gradual climate warming or sea-level rise. These findings indicate that reliable predictions of future WAIS retreat may require incorporation of realistic calculations of sediment erosion, transport and deposition.

  16. Mapping Sub-Antarctic Cushion Plants Using Random Forests to Combine Very High Resolution Satellite Imagery and Terrain Modelling

    Science.gov (United States)

    Bricher, Phillippa K.; Lucieer, Arko; Shaw, Justine; Terauds, Aleks; Bergstrom, Dana M.

    2013-01-01

    Monitoring changes in the distribution and density of plant species often requires accurate and high-resolution baseline maps of those species. Detecting such change at the landscape scale is often problematic, particularly in remote areas. We examine a new technique to improve accuracy and objectivity in mapping vegetation, combining species distribution modelling and satellite image classification on a remote sub-Antarctic island. In this study, we combine spectral data from very high resolution WorldView-2 satellite imagery and terrain variables from a high resolution digital elevation model to improve mapping accuracy, in both pixel- and object-based classifications. Random forest classification was used to explore the effectiveness of these approaches on mapping the distribution of the critically endangered cushion plant Azorella macquariensis Orchard (Apiaceae) on sub-Antarctic Macquarie Island. Both pixel- and object-based classifications of the distribution of Azorella achieved very high overall validation accuracies (91.6–96.3%, κ = 0.849–0.924). Both two-class and three-class classifications were able to accurately and consistently identify the areas where Azorella was absent, indicating that these maps provide a suitable baseline for monitoring expected change in the distribution of the cushion plants. Detecting such change is critical given the threats this species is currently facing under altering environmental conditions. The method presented here has applications to monitoring a range of species, particularly in remote and isolated environments. PMID:23940805

  17. THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

    Science.gov (United States)

    Cross, Fiona R.; Jackson, Robert R.

    2016-01-01

    Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

  18. South African Antarctic research programme 1978-1982

    CSIR Research Space (South Africa)

    SASCAR

    1978-12-01

    Full Text Available This document provides a comprehensive review of the planned South African scientific activities in Antarctica and on the sub-Antarctic islands in the five year period starting in 1978. The scientific programmes are classified under five headings...

  19. Initiation and long-term instability of the East Antarctic Ice Sheet.

    Science.gov (United States)

    Gulick, Sean P S; Shevenell, Amelia E; Montelli, Aleksandr; Fernandez, Rodrigo; Smith, Catherine; Warny, Sophie; Bohaty, Steven M; Sjunneskog, Charlotte; Leventer, Amy; Frederick, Bruce; Blankenship, Donald D

    2017-12-13

    Antarctica's continental-scale ice sheets have evolved over the past 50 million years. However, the dearth of ice-proximal geological records limits our understanding of past East Antarctic Ice Sheet (EAIS) behaviour and thus our ability to evaluate its response to ongoing environmental change. The EAIS is marine-terminating and grounded below sea level within the Aurora subglacial basin, indicating that this catchment, which drains ice to the Sabrina Coast, may be sensitive to climate perturbations. Here we show, using marine geological and geophysical data from the continental shelf seaward of the Aurora subglacial basin, that marine-terminating glaciers existed at the Sabrina Coast by the early to middle Eocene epoch. This finding implies the existence of substantial ice volume in the Aurora subglacial basin before continental-scale ice sheets were established about 34 million years ago. Subsequently, ice advanced across and retreated from the Sabrina Coast continental shelf at least 11 times during the Oligocene and Miocene epochs. Tunnel valleys associated with half of these glaciations indicate that a surface-meltwater-rich sub-polar glacial system existed under climate conditions similar to those anticipated with continued anthropogenic warming. Cooling since the late Miocene resulted in an expanded polar EAIS and a limited glacial response to Pliocene warmth in the Aurora subglacial basin catchment. Geological records from the Sabrina Coast shelf indicate that, in addition to ocean temperature, atmospheric temperature and surface-derived meltwater influenced East Antarctic ice mass balance under warmer-than-present climate conditions. Our results imply a dynamic EAIS response with continued anthropogenic warming and suggest that the EAIS contribution to future global sea-level projections may be under-estimated.

  20. Explicit representation and parametrised impacts of under ice shelf seas in the z∗ coordinate ocean model NEMO 3.6

    Directory of Open Access Journals (Sweden)

    P. Mathiot

    2017-07-01

    Full Text Available Ice-shelf–ocean interactions are a major source of freshwater on the Antarctic continental shelf and have a strong impact on ocean properties, ocean circulation and sea ice. However, climate models based on the ocean–sea ice model NEMO (Nucleus for European Modelling of the Ocean currently do not include these interactions in any detail. The capability of explicitly simulating the circulation beneath ice shelves is introduced in the non-linear free surface model NEMO. Its implementation into the NEMO framework and its assessment in an idealised and realistic circum-Antarctic configuration is described in this study. Compared with the current prescription of ice shelf melting (i.e. at the surface, inclusion of open sub-ice-shelf cavities leads to a decrease in sea ice thickness along the coast, a weakening of the ocean stratification on the shelf, a decrease in salinity of high-salinity shelf water on the Ross and Weddell sea shelves and an increase in the strength of the gyres that circulate within the over-deepened basins on the West Antarctic continental shelf. Mimicking the overturning circulation under the ice shelves by introducing a prescribed meltwater flux over the depth range of the ice shelf base, rather than at the surface, is also assessed. It yields similar improvements in the simulated ocean properties and circulation over the Antarctic continental shelf to those from the explicit ice shelf cavity representation. With the ice shelf cavities opened, the widely used three equation ice shelf melting formulation, which enables an interactive computation of melting, is tested. Comparison with observational estimates of ice shelf melting indicates realistic results for most ice shelves. However, melting rates for the Amery, Getz and George VI ice shelves are considerably overestimated.

  1. Dynamic thinning of glaciers on the Southern Antarctic Peninsula

    NARCIS (Netherlands)

    Wouters, B.; Martin-Espanol, A.; Helm, V.; Flament, T.; van Wessem, J. M.; Ligtenberg, S. R. M.; van den Broeke, M. R.; Bamber, J. L.

    2015-01-01

    Growing evidence has demonstrated the importance of ice shelf buttressing on the inland grounded ice, especially if it is resting on bedrock below sea level. Much of the Southern Antarctic Peninsula satisfies this condition and also possesses a bed slope that deepens inland. Such ice sheet geometry

  2. Time series analysis of the Antarctic Circumpolar Wave via symbolic transfer entropy

    Science.gov (United States)

    Oh, Mingi; Kim, Sehyun; Lim, Kyuseong; Kim, Soo Yong

    2018-06-01

    An attempt to interpret a large-scale climate phenomenon in the Southern Ocean (SO), the Antarctic Circumpolar Wave (ACW), has been made using an information entropy method, symbolic transfer entropy (STE). Over the areas of 50-60∘S latitude belt, information flow for four climate variables, sea surface temperature (SST), sea-ice edge (SIE), sea level pressure (SLP) and meridional wind speed (MWS) is examined. We found a tendency that eastward flow of information is preferred only for oceanic variables, which is a main characteristic of the ACW, an eastward wave making a circuit around the Antarctica. Since the ACW is the coherent pattern in both ocean and atmosphere it is reasonable to infer that the tendency reflects the Antarctic Circumpolar Current (ACC) encircling the Antarctica, rather than an evidence of the ACW. We observed one common feature for all four variables, a strong information flow over the area of the eastern Pacific Ocean, which suggest a signature of El Nino Southern Oscillation (ENSO).

  3. Geology and geochronology of the Sub-Antarctic Snares Islands/Tini Heke, New Zealand

    DEFF Research Database (Denmark)

    Scott, JM; Turnbull, IM; Sagar, MW

    2015-01-01

    are prismatic and yield an essentially unimodal age population of c. 116 Ma that is within error of the granodiorite. These properties suggest that the dated raft represents a meta-igneous rock despite its mica-rich nature. Some schistose rocks on the Western Chain contain coarse relict plagioclase phenocrysts...... and appear to have an igneous protolith. No conclusive metasedimentary rocks have been identified, although sillimanite-bearing mica-rich schist occurs on Rua. Deformation of the crystalline rocks occurred after Snares Granite intrusion and before cooling below muscovite K–Ar closure at 400 ± 50 °C at 95 Ma......The first comprehensive geological map, a summary of lithologies and new radiogenic isotope data (U–Pb, Rb–Sr) are presented for crystalline rocks of the Sub-Antarctic Snares Islands/Tini Heke, 150 km south of Stewart Island. The main lithology is Snares Granite (c. 109 Ma from U–Pb dating...

  4. Under Sea Ice phytoplankton bloom detection and contamination in Antarctica

    Science.gov (United States)

    Zeng, C.; Zeng, T.; Xu, H.

    2017-12-01

    Previous researches reported compelling sea ice phytoplankton bloom in Arctic, while seldom reports studied about Antarctic. Here, lab experiment showed sea ice increased the visible light albedo of the water leaving radiance. Even a new formed sea ice of 10cm thickness increased water leaving radiance up to 4 times of its original bare water. Given that phytoplankton preferred growing and accumulating under the sea ice with thickness of 10cm-1m, our results showed that the changing rate of OC4 estimated [Chl-a] varied from 0.01-0.5mg/m3 to 0.2-0.3mg/m3, if the water covered by 10cm sea ice. Going further, varying thickness of sea ice modulated the changing rate of estimating [Chl-a] non-linearly, thus current routine OC4 model cannot estimate under sea ice [Chl-a] appropriately. Besides, marginal sea ice zone has a large amount of mixture regions containing sea ice, water and snow, where is favorable for phytoplankton. We applied 6S model to estimate the sea ice/snow contamination on sub-pixel water leaving radiance of 4.25km spatial resolution ocean color products. Results showed that sea ice/snow scale effectiveness overestimated [Chl-a] concentration based on routine band ratio OC4 model, which contamination increased with the rising fraction of sea ice/snow within one pixel. Finally, we analyzed the under sea ice bloom in Antarctica based on the [Chl-a] concentration trends during 21 days after sea ice retreating. Regardless of those overestimation caused by sea ice/snow sub scale contamination, we still did not see significant under sea ice blooms in Antarctica in 2012-2017 compared with Arctic. This research found that Southern Ocean is not favorable for under sea ice blooms and the phytoplankton bloom preferred to occur in at least 3 weeks after sea ice retreating.

  5. Exploring the data constrained phase space of the last Antarctic glacial cycle

    Science.gov (United States)

    Lecavalier, Benoit; Tarasov, Lev

    2017-04-01

    The evolution of the Antarctic Ice Sheet over the last two glacial cycles is studied using the Glacial Systems Model (GSM). Glaciological modelling is an effective tool to generate continental-scale reconstructions over glacial cycles, but the models depend on parameterizations to account for the deficiencies (e.g., missing physics, unresolved sub-grid processes, uncertain boundary conditions) inherent in any numerical model. These parameters, considered together, form a parameter phase space from which sets of parameters can be sampled; each set corresponds to an ice sheet reconstruction. The GSM has been updated with a number of recent developments: hybrid SIA-SSA physics, Schoof grounding line parameterization, broadened degrees of freedom in the climate forcing, sub-shelf melt explicitly dependent on ocean temperatures, improved hydrofracturing, cliff failure at the margins, basal topographic uncertainties, impact of basal drag roughness and subgrid statistics, and first order geoidal corrections in the coupled glacial isostatic adjustment component. Parametric uncertainties are defined in the GSM using >36 ensemble parameters. Prior to conducting a full Bayesian calibration, one must first validate the ability of the GSM to simulate a broad range of responses. We attempt this by latin hypercube sampling of the parameter phase space and comparing the model predictions against our constraint database consisting of past elevation, extent and relative sea level observations and the present day geometry. We document the capability of the GSM to envelope the observational constraints given the parametric uncertainties and discuss the implications for the evolution of the Antarctic Ice Sheet.

  6. Nature Study Tips. Spiders.

    Science.gov (United States)

    Mulaik, Stanley B.

    1990-01-01

    Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

  7. Intersexual trophic niche partitioning in an ant-eating spider (Araneae: Zodariidae.

    Directory of Open Access Journals (Sweden)

    Stano Pekár

    2011-01-01

    Full Text Available Divergence in trophic niche between the sexes may function to reduce competition between the sexes ("intersexual niche partitioning hypothesis", or may be result from differential selection among the sexes on maximizing reproductive output ("sexual selection hypothesis". The latter may lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning.Comparative analysis of trophic morphology (the chelicerae and body size of males, females and juveniles demonstrated highly female biased SSD (Sexual Size Dimorphism in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size, and larger than ants captured by juveniles and males. Female fecundity was highly positively correlated with female body mass, which reflects foraging success during the adult stage. Females in laboratory experiments preferred the large ant sub-castes and displayed higher capture efficiency. In contrast, males occupied a different trophic niche and showed reduced foraging effort and reduced prey capture and feeding efficiency compared with females and juveniles.Our data indicate that female-biased dimorphism in trophic morphology and body size correlate with sex-specific reproductive strategies. We propose that intersexual trophic niche partitioning is shaped primarily by fecundity selection in females, and results from sex-differences in the route to successful reproduction where females are

  8. Nutritional Immunity Triggers the Modulation of Iron Metabolism Genes in the Sub-Antarctic Notothenioid Eleginops maclovinus in Response to Piscirickettsia salmonis

    Directory of Open Access Journals (Sweden)

    Danixa Martínez

    2017-09-01

    Full Text Available Iron deprivation is a nutritional immunity mechanism through which fish can limit the amount of iron available to invading bacteria. The aim of this study was to evaluate the modulation of iron metabolism genes in the liver and brain of sub-Antarctic notothenioid Eleginops maclovinus challenged with Piscirickettsia salmonis. The specimens were inoculated with two P. salmonis strains: LF-89 (ATCC® VR-1361™ and Austral-005 (antibiotic resistant. Hepatic and brain samples were collected at intervals over a period of 35 days. Gene expression (by RT-qPCR of proteins involved in iron storage, transport, and binding were statistically modulated in infected fish when compared with control counterparts. Specifically, the expression profiles of the transferrin and hemopexin genes in the liver, as well as the expression profiles of ferritin-M, ferritin-L, and transferrin in the brain, were similar for both experimental groups. Nevertheless, the remaining genes such as ferritin-H, ceruloplasmin, hepcidin, and haptoglobin presented tissue-specific expression profiles that varied in relation to the injected bacterial strain and sampling time-point. These results suggest that nutritional immunity could be an important immune defense mechanism for E. maclovinus against P. salmonis injection. This study provides relevant information for understanding iron metabolism of a sub-Antarctic notothenioid fish.

  9. ARM West Antarctic Radiation Experiment (AWARE) Science Plan

    Energy Technology Data Exchange (ETDEWEB)

    Lubin, D [National Science Foundation; Bromwich, DH [Ohio State University; Russell, LM [Scripps Institution of Oceanography; Verlinde, J [The Pennsylvania State University; Vogelmann, AM [Brookhaven National Laboratory

    2015-10-01

    West Antarctica is one of the most rapidly warming regions on Earth, and this warming is closely connected with global sea level rise. The discovery of rapid climate change on the West Antarctic Ice Sheet (WAIS) has challenged previous explanations of Antarctic climate change that focused on strengthening of circumpolar westerlies in response to the positive polarity trend in the Southern Annular Mode. West Antarctic warming does not yet have a comprehensive explanation: dynamical mechanisms may vary from one season to the next, and these mechanisms very likely involve complex teleconnections with subtropical and tropical latitudes. The prime motivation for this proposal is that there has been no substantial atmospheric science or climatological field work on West Antarctica since the 1957 International Geophysical Year and that research continued for only a few years. Direct meteorological information on the WAIS has been limited to a few automatic weather stations for several decades, yet satellite imagery and meteorological reanalyses indicate that West Antarctica is highly susceptible to advection of warm and moist maritime air with related cloud cover, depending on the location and strength of low pressure cells in the Amundsen, Ross, and Bellingshausen Seas. There is a need to quantify the role of these changing air masses on the surface energy balance, including all surface energy components and cloud-radiative forcing. More generally, global climate model simulations are known to perform poorly over the Antarctic and Southern Oceans, and the marked scarcity of cloud information at southern high latitudes has so far inhibited significant progress. Fortunately, McMurdo Station, where the Atmospheric Radiation Measurement Facility’s (ARM’s) most advanced cloud and aerosol instrumentation is situated, has a meteorological relationship with the WAIS via circulation patterns in the Ross and Amundsen Seas. We can therefore gather sophisticated data with cloud

  10. Poles Apart: The “Bipolar” Pteropod Species Limacina helicina Is Genetically Distinct Between the Arctic and Antarctic Oceans

    Science.gov (United States)

    Bednarsek, Nina; Linse, Katrin; Nelson, R. John; Pakhomov, Evgeny; Seibel, Brad; Steinke, Dirk; Würzberg, Laura

    2010-01-01

    The shelled pteropod (sea butterfly) Limacina helicina is currently recognised as a species complex comprising two sub-species and at least five “forma”. However, at the species level it is considered to be bipolar, occurring in both the Arctic and Antarctic oceans. Due to its aragonite shell and polar distribution L. helicina is particularly vulnerable to ocean acidification. As a key indicator of the acidification process, and a major component of polar ecosystems, L. helicina has become a focus for acidification research. New observations that taxonomic groups may respond quite differently to acidification prompted us to reassess the taxonomic status of this important species. We found a 33.56% (±0.09) difference in cytochrome c oxidase subunit I (COI) gene sequences between L. helicina collected from the Arctic and Antarctic oceans. This degree of separation is sufficient for ordinal level taxonomic separation in other organisms and provides strong evidence for the Arctic and Antarctic populations of L. helicina differing at least at the species level. Recent research has highlighted substantial physiological differences between the poles for another supposedly bipolar pteropod species, Clione limacina. Given the large genetic divergence between Arctic and Antarctic L. helicina populations shown here, similarly large physiological differences may exist between the poles for the L. helicina species group. Therefore, in addition to indicating that L. helicina is in fact not bipolar, our study demonstrates the need for acidification research to take into account the possibility that the L. helicina species group may not respond in the same way to ocean acidification in Arctic and Antarctic ecosystems. PMID:20360985

  11. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  12. Non-webbuilding spiders: prey specialists or generalists?

    Science.gov (United States)

    Nentwig, Wolfgang

    1986-07-01

    Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

  13. Occurrence of sea spider Endeis mollis Carpenter (Arthropoda: Pycnogonida on the test panels submerged in Gulf of Mannar, southeast coast of India

    Directory of Open Access Journals (Sweden)

    S. Satheesh

    2012-06-01

    Full Text Available Sea spiders (Pycnogonids are exclusively marine arthropods with worldwide distribution. Pycnogonida remains one of the poorly investigated groups encountered in fouling communities. In the present study, distribution pycnogonid species Endeis mollis associated with the fouling community developed on test panels submerged at Kudankulam coast, Gulf of Mannar was studied for a period of two years. Throughout the period of investigation, Endeis mollis was observed on the test panels. A maximum of 55 individuals per square dm was observed during pre-monsoon season and a minimum of 9 individuals per square dm during monsoon season. Results of this study on seasonal distribution are of considerable interest because so little has been documented on the ecology of Pycnogonids in India.

  14. Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

    Science.gov (United States)

    Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

    2014-01-01

    In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

  15. Science Education Resources on the Web--Spiders.

    Science.gov (United States)

    Thirunarayanan, M. O.

    1997-01-01

    Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

  16. Decadal Trends in Abundance, Size and Condition of Antarctic Toothfish in McMurdo Sound, Antarctica, 1972-2010

    Science.gov (United States)

    Ainley, David G.; Nur, Nadav; Eastman, Joseph T.; Ballard. Grant; Parkinson, Claire L; Evans, Clive W.; DeVries, Arthur L.

    2012-01-01

    We report analyses of a dataset spanning 38 years of near-annual fishing for Antarctic toothfish Dissostichus mawsoni, using a vertical setline through the fast ice of McMurdo Sound, Antarctica, 1972-2010. This constitutes one of the longest biological time series in the Southern Ocean, and certainly the longest for any fish. Fish total length, condition and catch per unit effort (CPUE) were derived from the more than 5500 fish caught. Contrary to expectation, length-frequency was dominated by fish in the upper half of the industrial catch. The discrepancy may be due to biases in the sampling capabilities of vertical (this study) versus benthic (horizontal) fishing gear (industry long lines), related to the fact that only large Antarctic toothfish (more than 100 cm TL) are neutrally buoyant and occur in the water column. Fish length and condition increased from the early 1970s to the early 1990s and then decreased, related to sea ice cover, with lags of 8 months to 5 years, and may ultimately be related to the fishery (which targets large fish) and changes in the Southern Annular Mode through effects on toothfish main prey, Antarctic silverfish Pleuragramma antarcticum. CPUE was constant through 2001 and then decreased dramatically, likely related to the industrial fishery, which began in 1996 and which concentrates effort over the Ross Sea slope, where tagged McMurdo fish have been found. Due to limited prey choices and, therefore, close coupling among mesopredators of the Ross Sea, Antarctic toothfish included, the fishery may be altering the trophic structure of the Ross Sea.

  17. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    Energy Technology Data Exchange (ETDEWEB)

    Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

    2011-05-15

    Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  18. Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

    International Nuclear Information System (INIS)

    Akamatsu, Fumikazu; Toda, Hideshige

    2011-01-01

    Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

  19. Radiation effect onto biodiversity of spiders

    International Nuclear Information System (INIS)

    Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

    2010-01-01

    At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

  20. Antarctic Ice-Sheet Mass Balance from Satellite Altimetry 1992 to 2001

    Science.gov (United States)

    Zwally, H. Jay; Brenner, Anita C.; Cornejo, Helen; Giovinetto, Mario; Saba, Jack L.; Yi, Donghui

    2003-01-01

    A major uncertainty in understanding the causes of the current rate of sea level rise is the potential contributions from mass imbalances of the Greenland and Antarctic ice sheets. Estimates of the current mass balance of the Antarctic ice sheet are derived from surface- elevation changes obtained from 9 years of ERS - 1 & 2 radar altimeter data. Elevation time-series are created from altimeter crossovers among 90-day data periods on a 50 km grid to 81.5 S. The time series are fit with a multivariate linear/sinusoidal function to give the average rate of elevation change (dH/dt). On the major Rome-Filchner, Ross, and Amery ice shelves, the W d t are small or near zero. In contrast, the ice shelves of the Antarctic Peninsula and along the West Antarctic coast appear to be thinning significantly, with a 23 +/- 3 cm per year surface elevation decrease on the Larsen ice shelf and a 65 +/- 4 cm per year decrease on the Dotson ice shelf. On the grounded ice, significant elevation decreases are obtained over most of the drainage basins of the Pine Island and Thwaites glaciers in West Antarctica and inland of Law Dome in East Antarctica. Significant elevation increases are observed within about 200 km of the coast around much of the rest of the ice sheet. Farther inland, the changes are a mixed pattern of increases and decreases with increases of a few centimeters per year at the highest elevations of the East Antarctic plateau. The derived elevation changes are combined with estimates of the bedrock uplift from several models to provide maps of ice thickness change. The ice thickness changes enable estimates of the ice mass balances for the major drainage basins, the overall mass balance, and the current contribution of the ice sheet to global sea level change.

  1. Acid-sensing ion channel (ASIC) structure and function: Insights from spider, snake and sea anemone venoms.

    Science.gov (United States)

    Cristofori-Armstrong, Ben; Rash, Lachlan D

    2017-12-01

    Acid-sensing ion channels (ASICs) are proton-activated cation channels that are expressed in a variety of neuronal and non-neuronal tissues. As proton-gated channels, they have been implicated in many pathophysiological conditions where pH is perturbed. Venom derived compounds represent the most potent and selective modulators of ASICs described to date, and thus have been invaluable as pharmacological tools to study ASIC structure, function, and biological roles. There are now ten ASIC modulators described from animal venoms, with those from snakes and spiders favouring ASIC1, while the sea anemones preferentially target ASIC3. Some modulators, such as the prototypical ASIC1 modulator PcTx1 have been studied in great detail, while some of the newer members of the club remain largely unstudied. Here we review the current state of knowledge on venom derived ASIC modulators, with a particular focus on their molecular interaction with ASICs, what they have taught us about channel structure, and what they might still reveal about ASIC function and pathophysiological roles. This article is part of the Special Issue entitled 'Venom-derived Peptides as Pharmacological Tools.' Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Energetics, scaling and sexual size dimorphism of spiders.

    Science.gov (United States)

    Grossi, B; Canals, M

    2015-03-01

    The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

  3. Effect of different temperature regimes on the chlorophyll a concentration in four species of Antarctic macroalgae

    Digital Repository Service at National Institute of Oceanography (India)

    Dhargalkar, V.K.

    th Symp. on Polar Biology, Nat. Inst. Pf Polar Research. Tokyo. Mem. natn. lnst. polar Res. Tokyo(Spec.Issue).32: l12-116. Papenfuss, G. F. 1964. Catalogue and bibliography of Antarctic and sub- antarctic benthic marine algae. Am. Geophys. Union...

  4. Origin of spherule samples recovered from antarctic ice sheet-Terrestrial or extraterrestrial?

    Energy Technology Data Exchange (ETDEWEB)

    Sekimoto, Shun; Takamiya, Koichi; Shibata, Seiichi [Research Reactor Institute, Kyoto University, Osaka (Japan); Kobayashi, Takayuki [College of Humanities and Sciences, Nihon University, Tokyo (Japan); Ebihara, Mitsuru [Dept. of Chemistry, Tokyo Metropolitan University, Tokyo (Japan)

    2016-04-15

    Thirty-eight spherules from the Antarctic ice sheet were analyzed using neutron activation analysis under two different conditions to investigate their origin. In almost all of these spherules, the contents of iron, cobalt, and manganese were determined to be 31% to 88%, 17 mg/kg to 810 mg/kg, and 0.017% to 7%, respectively. A detectable iridium content of 0.84 mg/kg was found in only one spherule, which was judged to be extraterrestrial in origin. A comparison of elemental compositions of the Antarctic spherules analyzed in this study with those of deep-sea sediment spherules and those of terrestrial materials revealed that most of the Antarctic spherules except for the sample in which iridium was detected could not be identified as extraterrestrial in origin.

  5. Storing CO{sub 2} under the North Sea Basin - A key solution for combating climate change

    Energy Technology Data Exchange (ETDEWEB)

    Skogen, T; Morris, B; Agerup, M; Svenningsen, S Oe; Kropelien, K F; Solheim, M; Northmore, B; Dixon, T; O' Carroll, K; Greaves, A; Golder, J; Selmer-Olsen, S; Sjoeveit, A; Kaarstad, O; Riley, N; Wright, I; Mansfield, C

    2007-06-15

    This report represents the first deliverable of the North Sea Basin Task Force, which Norway and the UK established in November 2005 to work together on issues surrounding the transport and storage of CO{sub 2} beneath the North Sea. The North Sea represents the best geological opportunity for storing our CO{sub 2} emissions away from the atmosphere for both the UK and Norway

  6. Personal care products and steroid hormones in the Antarctic coastal environment associated with two Antarctic research stations, McMurdo Station and Scott Base.

    Science.gov (United States)

    Emnet, Philipp; Gaw, Sally; Northcott, Grant; Storey, Bryan; Graham, Lisa

    2015-01-01

    Pharmaceutical and personal care products (PPCPs) are a major source of micropollutants to the aquatic environment. Despite intense research on the fate and effects of PPCPs in temperate climates, there is a paucity of data on their presence in polar environments. This study reports the presence of selected PPCPs in sewage effluents from two Antarctic research stations, the adjacent coastal seawater, sea ice, and biota. Sewage effluents contained bisphenol-A, ethinylestradiol, estrone, methyl triclosan, octylphenol, triclosan, and three UV-filters. The maximum sewage effluent concentrations of 4-methyl-benzylidene camphor, benzophenone-1, estrone, ethinylestradiol, and octylphenol exceeded concentrations previously reported. Coastal seawaters contained bisphenol-A, octylphenol, triclosan, three paraben preservatives, and four UV-filters. The sea ice contained a similar range and concentration of PPCPs as the seawater. Benzophenone-3 (preferential accumulation in clams), estradiol, ethinylestradiol, methyl paraben (preferential accumulation in fish, with concentrations correlating negatively with fillet size), octylphenol, and propyl paraben were detected in biota samples. PPCPs were detected in seawater and biota at distances up to 25 km from the research stations WWTP discharges. Sewage effluent discharges and disposal of raw human waste through sea ice cracks have been identified as sources of PPCPs to Antarctic coastal environments. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Spiders do have melanin after all.

    Science.gov (United States)

    Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

    2015-11-01

    Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

  8. Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

    Science.gov (United States)

    Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

    2009-03-04

    The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

  9. Antarctic glaciation caused ocean circulation changes at the Eocene-Oligocene transition.

    Science.gov (United States)

    Goldner, A; Herold, N; Huber, M

    2014-07-31

    Two main hypotheses compete to explain global cooling and the abrupt growth of the Antarctic ice sheet across the Eocene-Oligocene transition about 34 million years ago: thermal isolation of Antarctica due to southern ocean gateway opening, and declining atmospheric CO2 (refs 5, 6). Increases in ocean thermal stratification and circulation in proxies across the Eocene-Oligocene transition have been interpreted as a unique signature of gateway opening, but at present both mechanisms remain possible. Here, using a coupled ocean-atmosphere model, we show that the rise of Antarctic glaciation, rather than altered palaeogeography, is best able to explain the observed oceanographic changes. We find that growth of the Antarctic ice sheet caused enhanced northward transport of Antarctic intermediate water and invigorated the formation of Antarctic bottom water, fundamentally reorganizing ocean circulation. Conversely, gateway openings had much less impact on ocean thermal stratification and circulation. Our results support available evidence that CO2 drawdown--not gateway opening--caused Antarctic ice sheet growth, and further show that these feedbacks in turn altered ocean circulation. The precise timing and rate of glaciation, and thus its impacts on ocean circulation, reflect the balance between potentially positive feedbacks (increases in sea ice extent and enhanced primary productivity) and negative feedbacks (stronger southward heat transport and localized high-latitude warming). The Antarctic ice sheet had a complex, dynamic role in ocean circulation and heat fluxes during its initiation, and these processes are likely to operate in the future.

  10. Converter fed sub sea motor drives

    Energy Technology Data Exchange (ETDEWEB)

    Raad, R O

    1995-09-01

    Minor offshore gas and oil resources located 20-50 km from existing installations may often be commercially exploited only by use of complete sub sea solutions. This thesis deals with analyses of a sub sea adjustable speed electric motor which is fed by a frequency converter via a long cable (up to 50 km) between the converter and the motor. The author develops a general model for analysing such motor drive systems with the objective of verifying the feasibility of specific applications and of specifying the requirements on the system components. The simulation model is used to identify the critical frequency ranges in which the converter must not generate significant harmonics, to verify the start-up strategy chosen, and to verify the stability with potential disturbances applied to the system. Simulation models are developed for both transient and steady state analyses. They are accurate up to 5 kHz and can incorporate the frequency dependency of the motor and cable parameters. Ideal thyristors and diodes are used. The models are implemented in existing simulation tools. Most of the results relate to a base case with a 670 kW squirrel cage motor fed from a 30 km long cable, but cases with 3 MW rating or with 50 km cable have also been analyzed and found to be feasible. Each specific application must be separately studied. Results of simulation calculations are presented and conclusions given. 53 refs., 124 figs., 23 tabs.

  11. In vitro immunobiological activity of an Antarctic streptomyces polysaccharide

    International Nuclear Information System (INIS)

    Toshkova, R.; Yossifova, L.; Gardeva, E.; Zvetkova, E.; Ivanova, V.

    2010-01-01

    Antarctic Streptomyces sp. 1010, were obtained from sea water samples (Livingston Island, Antarctica), during the Third Bulgarian Antarctic Scientific Expedition (1994-1995). The ecophysiological methods for isolation and characterization of these active, cold-adapted, Gram-positive microorganisms (psychrophiles) in morphological, phenotypic, genetic and taxonomic aspects, have been earlier reported. In this study, a new extracellular polysaccharide (heteropolysaccharide) has been isolated and purified from cultured broth of the Antarctic Streptomyces sp. 1010. The monosaccharide content of the Antarctic streptomyces heteropolysaccharide has been examined by TLC and GC/MS. The mitogenic and immuno potential properties of the purified Antarctic Streptomyces polysaccharide (ASMP) have been studied in vitro - in the short-term cultures of human peripheral blood mononuclear cells (hPBMCs - lymphocytes and monocytes) and mouse spleen lymphocytes (mouse splenocytes - mSps). The results obtained show that ASMP has a double lectin-like effect on the proliferative activity of hPBMCs: similar to this of Con A on the lymphoid cells (preliminary T-lymphocytes) and to the effect of LPS on the mononuclear from monocyte-macrophage lineage. Expressed as proliferative index (PI), the mitogenic response of mSps to the in vitro influence of ASMP was also higher than PI in the negative, as well as in the positive controls (mSps, cultured in the presence of PHA, Con A and LPS). The new Antarctic Streptomyces' heteropolysaccharide examined could be useful in the future as an immunomodulative biologically active substance and its extracellular production may contribute to the development of thermobiochemistry, immunomodulative drug therapy and immunopharmaceutical industry. (authors)

  12. Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

    Science.gov (United States)

    Vetter, Richard S

    2011-06-01

    Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

  13. The Effect of Representing Bromine from VSLS on the Simulation and Evolution of Antarctic Ozone

    Science.gov (United States)

    Oman, Luke D.; Douglass, Anne R.; Salawitch, Ross J.; Canty, Timothy P.; Ziemke, Jerald R.; Manyin, Michael

    2016-01-01

    We use the Goddard Earth Observing System Chemistry Climate Model (GEOSCCM), a contributor to both the 2010 and 2014 WMO Ozone Assessment Reports, to show that inclusion of 5 parts per trillion (ppt) of stratospheric bromine(Br(sub y)) from very short lived substances (VSLS) is responsible for about a decade delay in ozone hole recovery. These results partially explain the significantly later recovery of Antarctic ozone noted in the 2014 report, as bromine from VSLS was not included in the 2010 Assessment. We show multiple lines of evidence that simulations that account for VSLS Br(sub y) are in better agreement with both total column BrO and the seasonal evolution of Antarctic ozone reported by the Ozone Monitoring Instrument (OMI) on NASAs Aura satellite. In addition, the near zero ozone levels observed in the deep Antarctic lower stratospheric polar vortex are only reproduced in a simulation that includes this Br(sub y) source from VSLS.

  14. Anomalous South Pacific lithosphere dynamics derived from new total sediment thickness estimates off the West Antarctic margin

    Science.gov (United States)

    Wobbe, Florian; Lindeque, Ansa; Gohl, Karsten

    2014-12-01

    Paleotopographic models of the West Antarctic margin, which are essential for robust simulations of paleoclimate scenarios, lack information on sediment thickness and geodynamic conditions, resulting in large uncertainties. A new total sediment thickness grid spanning the Ross Sea-Amundsen Sea-Bellingshausen Sea basins is presented and is based on all the available seismic reflection, borehole, and gravity modeling data offshore West Antarctica. This grid was combined with NGDC's global 5 arc minute grid of ocean sediment thickness (Whittaker et al., 2013) and extends the NGDC grid further to the south. Sediment thickness along the West Antarctic margin tends to be 3-4 km larger than previously assumed. The sediment volume in the Bellingshausen, Amundsen, and Ross Sea basins amounts to 3.61, 3.58, and 2.78 million km3, respectively. The residual basement topography of the South Pacific has been revised and the new data show an asymmetric trend over the Pacific-Antarctic Ridge. Values are anomalously high south of the spreading ridge and in the Ross Sea area, where the topography seems to be affected by persistent mantle processes. In contrast, the basement topography offshore Marie Byrd Land cannot be attributed to dynamic topography, but rather to crustal thickening due to intraplate volcanism. Present-day dynamic topography models disagree with the presented revised basement topography of the South Pacific, rendering paleotopographic reconstructions with such a limited dataset still fairly uncertain.

  15. The house spider genome reveals an ancient whole-genome duplication during arachnid evolution.

    Science.gov (United States)

    Schwager, Evelyn E; Sharma, Prashant P; Clarke, Thomas; Leite, Daniel J; Wierschin, Torsten; Pechmann, Matthias; Akiyama-Oda, Yasuko; Esposito, Lauren; Bechsgaard, Jesper; Bilde, Trine; Buffry, Alexandra D; Chao, Hsu; Dinh, Huyen; Doddapaneni, HarshaVardhan; Dugan, Shannon; Eibner, Cornelius; Extavour, Cassandra G; Funch, Peter; Garb, Jessica; Gonzalez, Luis B; Gonzalez, Vanessa L; Griffiths-Jones, Sam; Han, Yi; Hayashi, Cheryl; Hilbrant, Maarten; Hughes, Daniel S T; Janssen, Ralf; Lee, Sandra L; Maeso, Ignacio; Murali, Shwetha C; Muzny, Donna M; Nunes da Fonseca, Rodrigo; Paese, Christian L B; Qu, Jiaxin; Ronshaugen, Matthew; Schomburg, Christoph; Schönauer, Anna; Stollewerk, Angelika; Torres-Oliva, Montserrat; Turetzek, Natascha; Vanthournout, Bram; Werren, John H; Wolff, Carsten; Worley, Kim C; Bucher, Gregor; Gibbs, Richard A; Coddington, Jonathan; Oda, Hiroki; Stanke, Mario; Ayoub, Nadia A; Prpic, Nikola-Michael; Flot, Jean-François; Posnien, Nico; Richards, Stephen; McGregor, Alistair P

    2017-07-31

    The duplication of genes can occur through various mechanisms and is thought to make a major contribution to the evolutionary diversification of organisms. There is increasing evidence for a large-scale duplication of genes in some chelicerate lineages including two rounds of whole genome duplication (WGD) in horseshoe crabs. To investigate this further, we sequenced and analyzed the genome of the common house spider Parasteatoda tepidariorum. We found pervasive duplication of both coding and non-coding genes in this spider, including two clusters of Hox genes. Analysis of synteny conservation across the P. tepidariorum genome suggests that there has been an ancient WGD in spiders. Comparison with the genomes of other chelicerates, including that of the newly sequenced bark scorpion Centruroides sculpturatus, suggests that this event occurred in the common ancestor of spiders and scorpions, and is probably independent of the WGDs in horseshoe crabs. Furthermore, characterization of the sequence and expression of the Hox paralogs in P. tepidariorum suggests that many have been subject to neo-functionalization and/or sub-functionalization since their duplication. Our results reveal that spiders and scorpions are likely the descendants of a polyploid ancestor that lived more than 450 MYA. Given the extensive morphological diversity and ecological adaptations found among these animals, rivaling those of vertebrates, our study of the ancient WGD event in Arachnopulmonata provides a new comparative platform to explore common and divergent evolutionary outcomes of polyploidization events across eukaryotes.

  16. The seasonal evolution of shelf water masses around Bouvetøya, a sub-Antarctic island in the mid-Atlantic sector of the Southern Ocean, determined from an instrumented southern elephant seal

    Directory of Open Access Journals (Sweden)

    Andrew D. Lowther

    2016-10-01

    Full Text Available Our study makes use of a fortuitous oceanographic data set collected around the remote sub-Antarctic island of Bouvetøya by a conductivity–temperature–depth recorder (CTD integrated with a satellite-relayed data logger deployed on an adult female southern elephant seal (Mirounga leonina to describe the seasonal evolution of the western shelf waters. The instrumented seal remained in waters over the shelf for 259 days, collecting an average of 2.6 (±0.06 CTD profiles per day, providing hydrographic data encompassing the late austral summer and the entire winter. These data document the thermal stratification of the upper water layer due to summer surface heating of the previous year's Antarctic Surface Water, giving way to a cold subsurface layer at about 100 m as the austral winter progressed, with a concomitant increase in salinity of the upper layer. Upper Circumpolar Deep Water was detected at a depth of approximately 200 m along the western shelf of Bouvetøya throughout the year. These oceanographic data represent the only seasonal time series for this region and the second such animal–instrument oceanographic time series in the sub-Antarctic domain of the Southern Ocean.

  17. Large-Ensemble modeling of past and future variations of the Antarctic Ice Sheet with a coupled ice-Earth-sea level model

    Science.gov (United States)

    Pollard, David; DeConto, Robert; Gomez, Natalya

    2016-04-01

    To date, most modeling of the Antarctic Ice Sheet's response to future warming has been calibrated using recent and modern observations. As an alternate approach, we apply a hybrid 3-D ice sheet-shelf model to the last deglacial retreat of Antarctica, making use of geologic data of the last ~20,000 years to test the model against the large-scale variations during this period. The ice model is coupled to a global Earth-sea level model to improve modeling of the bedrock response and to capture ocean-ice gravitational interactions. Following several recent ice-sheet studies, we use Large Ensemble (LE) statistical methods, performing sets of 625 runs from 30,000 years to present with systematically varying model parameters. Objective scores for each run are calculated using modern data and past reconstructed grounding lines, relative sea level records, cosmogenic elevation-age data and uplift rates. The LE results are analyzed to calibrate 4 particularly uncertain model parameters that concern marginal ice processes and interaction with the ocean. LE's are extended into the future with climates following RCP scenarios. An additional scoring criterion tests the model's ability to reproduce estimated sea-level high stands in the warm mid-Pliocene, for which drastic retreat mechanisms of hydrofracturing and ice-cliff failure are needed in the model. The LE analysis provides future sea-level-rise envelopes with well-defined parametric uncertainty bounds. Sensitivities of future LE results to Pliocene sea-level estimates, coupling to the Earth-sea level model, and vertical profiles of Earth properties, will be presented.

  18. Effects of ocean acidification on the physiological performance and carbon production of the Antarctic sea ice diatom Nitzschia sp. ICE-H.

    Science.gov (United States)

    Qu, Chang-Feng; Liu, Fang-Ming; Zheng, Zhou; Wang, Yi-Bin; Li, Xue-Gang; Yuan, Hua-Mao; Li, Ning; An, Mei-Ling; Wang, Xi-Xi; He, Ying-Ying; Li, Lu-Lu; Miao, Jin-Lai

    2017-07-15

    Ocean acidification (OA) resulting from increasing atmospheric CO 2 strongly influences marine ecosystems, particularly in the polar ocean due to greater CO 2 solubility. Here, we grew the Antarctic sea ice diatom Nitzschia sp. ICE-H in a semicontinuous culture under low (~400ppm) and high (1000ppm) CO 2 levels. Elevated CO 2 resulted in a stimulated physiological response including increased growth rates, chlorophyll a contents, and nitrogen and phosphorus uptake rates. Furthermore, high CO 2 enhanced cellular particulate organic carbon production rates, indicating a greater shift from inorganic to organic carbon. However, the cultures grown in high CO 2 conditions exhibited a decrease in both extracellular and intracellular carbonic anhydrase activity, suggesting that the carbon concentrating mechanisms of Nitzschia sp. ICE-H may be suppressed by elevated CO 2 . Our results revealed that OA would be beneficial to the survival of this sea ice diatom strain, with broad implications for global carbon cycles in the future ocean. Copyright © 2017. Published by Elsevier Ltd.

  19. On the evaluation of global sea-salt aerosol models at coastal/orographic sites

    Science.gov (United States)

    Spada, M.; Jorba, O.; Pérez García-Pando, C.; Janjic, Z.; Baldasano, J. M.

    2015-01-01

    Sea-salt aerosol global models are typically evaluated against concentration observations at coastal stations that are unaffected by local surf conditions and thus considered representative of open ocean conditions. Despite recent improvements in sea-salt source functions, studies still show significant model errors in specific regions. Using a multiscale model, we investigated the effect of high model resolution (0.1° × 0.1° vs. 1° × 1.4°) upon sea-salt patterns in four stations from the University of Miami Network: Baring Head, Chatam Island, and Invercargill in New Zealand, and Marion Island in the sub-antarctic Indian Ocean. Normalized biases improved from +63.7% to +3.3% and correlation increased from 0.52 to 0.84. The representation of sea/land interfaces, mesoscale circulations, and precipitation with the higher resolution model played a major role in the simulation of annual concentration trends. Our results recommend caution when comparing or constraining global models using surface concentration observations from coastal stations.

  20. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1980-01-01

    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  1. Persistent Organic Pollutants in Biotic and Abiotic Components of Antarctic Pristine Environment

    Science.gov (United States)

    Bhardwaj, Laxmikant; Chauhan, Abhishek; Ranjan, Anuj; Jindal, Tanu

    2018-05-01

    Over the past decades, research in Antarctica has built a new understanding of Antarctica, its past, present and future. Human activities and long-range pollutants are increasing on the Antarctic continent. Research on persistent organic pollutants (POPs) has been carried out internationally by several countries having their permanent research stations to explain the impact of an ever increasing range of POPs in Antarctic ecosystem. POPs have been detected in Antarctica despite its geographical isolation and almost complete absence of human settlements. The presence of POPs in different abiotic (atmosphere, water bodies, sediments, soil, sea ice) and biotic components (mosses, lichens, krill, penguins, skua, etc.) in Antarctica has been studied and documented around for decades and has either been banned or strictly regulated but is still found in the environment. This review focuses on recent research pertaining to sources and occurrence of POPs in Antarctic lake water, soil, sediment, lichen, mosses and other Antarctic marine community. This review also proposes to summarize the current state of research on POPs in Antarctica environment and draw the earliest conclusions on possible significance of POPs in Antarctica based on presently available information from related Antarctic environment.

  2. Are temperate canopy spiders tree-species specific?

    Science.gov (United States)

    Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

    2014-01-01

    Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

  3. Spatial and temporal variability across life's hierarchies in the terrestrial Antarctic.

    Science.gov (United States)

    Chown, Steven L; Convey, Peter

    2007-12-29

    Antarctica and its surrounding islands lie at one extreme of global variation in diversity. Typically, these regions are characterized as being species poor and having simple food webs. Here, we show that terrestrial systems in the region are nonetheless characterized by substantial spatial and temporal variations at virtually all of the levels of the genealogical and ecological hierarchies which have been thoroughly investigated. Spatial variation at the individual and population levels has been documented in a variety of genetic studies, and in mosses it appears that UV-B radiation might be responsible for within-clump mutagenesis. At the species level, modern molecular methods have revealed considerable endemism of the Antarctic biota, questioning ideas that small organisms are likely to be ubiquitous and the taxa to which they belong species poor. At the biogeographic level, much of the relatively small ice-free area of Antarctica remains unsurveyed making analyses difficult. Nonetheless, it is clear that a major biogeographic discontinuity separates the Antarctic Peninsula and continental Antarctica, here named the 'Gressitt Line'. Across the Southern Ocean islands, patterns are clearer, and energy availability is an important correlate of indigenous and exotic species richness, while human visitor numbers explain much of the variation in the latter too. Temporal variation at the individual level has much to do with phenotypic plasticity, and considerable life-history and physiological plasticity seems to be a characteristic of Antarctic terrestrial species. Environmental unpredictability is an important driver of this trait and has significantly influenced life histories across the region and probably throughout much of the temperate Southern Hemisphere. Rapid climate change-related alterations in the range and abundance of several Antarctic and sub-Antarctic populations have taken place over the past several decades. In many sub-Antarctic locations, these

  4. Cloning, Expression, Purification, and Characterization of Glutaredoxin from Antarctic Sea-Ice Bacterium Pseudoalteromonas sp. AN178

    Directory of Open Access Journals (Sweden)

    Quanfu Wang

    2014-01-01

    Full Text Available Glutaredoxins (Grxs are small ubiquitous redox enzymes that catalyze glutathione-dependent reactions to reduce protein disulfide. In this study, a full-length Grx gene (PsGrx with 270 nucleotides was isolated from Antarctic sea-ice bacterium Pseudoalteromonas sp. AN178. It encoded deduced 89 amino acid residues with the molecular weight 9.8 kDa. Sequence analysis of the amino acid sequence revealed the catalytic motif CPYC. Recombinant PsGrx (rPsGrx stably expressed in E. coli BL21 was purified to apparent homogeneity by Ni-affinity chromatography. rPsGrx exhibited optimal activity at 30°C and pH 8.0 and showed 25.5% of the activity at 0°C. It retained 65.0% of activity after incubation at 40°C for 20 min and still exhibited 37.0% activity in 1.0 M NaCl. These results indicated that rPsGrx was a typical cold active protein with low thermostability.

  5. Fish predation by semi-aquatic spiders: a global pattern.

    Directory of Open Access Journals (Sweden)

    Martin Nyffeler

    Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  6. Fish predation by semi-aquatic spiders: a global pattern.

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

  7. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-07

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  8. Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

    NARCIS (Netherlands)

    Heuts, B.; Brunt, T.

    2009-01-01

    We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

  9. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.

    2007-01-01

    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  10. Learning to avoid spiders: fear predicts performance, not competence.

    Science.gov (United States)

    Luo, Xijia; Becker, Eni S; Rinck, Mike

    2018-01-05

    We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

  11. Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

    Science.gov (United States)

    Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

    2009-06-01

    Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

  12. Potential of the solid-Earth response for limiting long-term West Antarctic Ice Sheet retreat

    Science.gov (United States)

    Konrad, Hannes; Sasgen, Ingo; Pollard, David; Klemann, Volker

    2016-04-01

    The West Antarctic Ice Sheet (WAIS) is assumed to be inherently unstable because it is grounded below sea level in a large part, where the bedrock deepens from today's grounding line towards the interior of the ice sheet. Idealized simulations have shown that bedrock uplift due to isostatic adjustment of the solid Earth and the associated sea-level fall may stop the retreat of such a marine-based ice sheet (Gomez et al., 2012). Here, we employ a coupled model for ice-sheet dynamics and solid-Earth dynamics, including a gravitationally consistent description of sea level, to investigate the influence of the viscoelastic Earth structure on the WAIS' future stability (Konrad et al. 2015). For this, we start from a steady-state condition for the Antarctic Ice Sheet close to present-day observations and apply atmospheric and oceanic forcing of different strength to initiate the retreat of the WAIS and investigate the effect of the viscoelastic deformation on the ice evolution for a range of solid-Earth rheologies. We find that the climate forcing is the primary control on the occurrence of the WAIS collapse. However, for moderate climate forcing and a weak solid-Earth rheology associated with the West Antarctic rift system (asthenosphere viscosities of 3x10^19 Pa s or less), we find that the combined effect of bedrock uplift and gravitational sea-level fall limits the retreat to the Amundsen Sea embayment on millennial time scales. In contrast, a stiffer Earth rheology yields a collapse under these conditions. Under a stronger climate forcing, weak Earth structures do not prevent the WAIS collapse; however, they produce a delay of up to 5000 years in comparison to a stiffer solid-Earth rheology. In an additional experiment, we test the impact of sea-level rise from an assumed fast deglaciation of the Greenland Ice Sheet. In cases when the climatic forcing is too weak to force WAIS collapse by itself, the additional rise in sea-level leads to disintegration of the WAIS

  13. Synthetic spider silk sustainability verification by techno-economic and life cycle analysis

    Science.gov (United States)

    Edlund, Alan

    Major ampullate spider silk represents a promising biomaterial with diverse commercial potential ranging from textiles to medical devices due to the excellent physical and thermal properties from the protein structure. Recent advancements in synthetic biology have facilitated the development of recombinant spider silk proteins from Escherichia coli (E. coli), alfalfa, and goats. This study specifically investigates the economic feasibility and environmental impact of synthetic spider silk manufacturing. Pilot scale data was used to validate an engineering process model that includes all of the required sub-processing steps for synthetic fiber manufacture: production, harvesting, purification, drying, and spinning. Modeling was constructed modularly to support assessment of alternative protein production methods (alfalfa and goats) as well as alternative down-stream processing technologies. The techno-economic analysis indicates a minimum sale price from pioneer and optimized E. coli plants at 761 kg-1 and 23 kg-1 with greenhouse gas emissions of 572 kg CO2-eq. kg-1 and 55 kg CO2-eq. kg-1, respectively. Spider silk sale price estimates from goat pioneer and optimized results are 730 kg-1 and 54 kg-1, respectively, with pioneer and optimized alfalfa plants are 207 kg-1 and 9.22 kg-1 respectively. Elevated costs and emissions from the pioneer plant can be directly tied to the high material consumption and low protein yield. Decreased production costs associated with the optimized plants include improved protein yield, process optimization, and an Nth plant assumption. Discussion focuses on the commercial potential of spider silk, the production performance requirements for commercialization, and impact of alternative technologies on the sustainability of the system.

  14. Velocities of antarctic outlet glaciers determined from sequential Landsat images

    Science.gov (United States)

    MacDonald, Thomas R.; Ferrigno, Jane G.; Williams, Richard S.; Lucchitta, Baerbel K.

    1989-01-01

    Approximately 91.0 percent of the volume of present-day glacier ice on Earth is in Antarctica; Greenland contains about another 8.3 percent of the volume. Thus, together, these two great ice sheets account for an estimated 99.3 percent of the total. Long-term changes in the volume of glacier ice on our planet are the result of global climate change. Because of the relationship of global ice volume to sea level (± 330 cubic kilometers of glacier ice equals ± 1 millimeter sea level), changes in the mass balance of the antarctic ice sheet are of particular importance.Whether the mass balance of the east and west antarctic ice sheets is positive or negative is not known. Estimates of mass input by total annual precipitation for the continent have been made from scattered meteorological observations (Swithinbank 1985). The magnitude of annual ablation of the ice sheet from calving of outlet glaciers and ice shelves is also not well known. Although the velocities of outlet glaciers can be determined from field measurements during the austral summer,the technique is costly, does not cover a complete annual cycle,and has been applied to just a few glaciers. To increase the number of outlet glaciers in Antarctica for which velocities have been determined and to provide additional data for under-standing the dynamics of the antarctic ice sheets and their response to global climate change, sequential Landsat image of several outlet glaciers were measured.

  15. Links between Patagonian Ice Sheet fluctuations and Antarctic dust variability during the last glacial period (MIS 4-2)

    Science.gov (United States)

    Kaiser, Jérôme; Lamy, Frank

    2010-06-01

    Antarctic and Greenland ice-core records reveal large fluctuations of dust input on both orbital and millennial time-scales with potential global climate implications. At least during glacial periods, the Antarctic dust fluctuations appear to be largely controlled by environmental changes in southern South America. We compare dust flux records from two Antarctic ice-cores to variations in the composition of the terrigenous supply at ODP Site 1233 located off southern Chile and known to record fluctuations in the extent of the northern part of the Patagonian ice-sheet (NPIS) during the last glacial period (Marine Isotope Stage, MIS, 4 to 2). Within age uncertainties, millennial-scale glacial advances (retreats) of the NPIS correlate to Antarctic dust maxima (minima). In turn, NPIS fluctuations were closely related to offshore sea surface temperature (SST) changes. This pattern suggests a causal link involving changes in temperature, in rock flour availability, in latitudinal extensions of the westerly winds and in foehn winds in the southern Pampas and Patagonia. We further suggest that the long-term trend of dust accumulation is partly linked to the sea-level related changes in the size if the Patagonian source area due to the particular morphology of the Argentine shelf. We suggest that sea-level drops at the beginning of MIS 4 and MIS 2 were important for long-term dust increases, while changes in the Patagonian dust source regions primarily control the early dust decrease during the MIS 4/3 transition and Termination 1.

  16. Dating glacimarine sediments from the continental shelf in the Amundsen Sea using a multi-tool box: Implications for West Antarctic ice-sheet extent and retreat during the last glacial cycle

    Science.gov (United States)

    Hillenbrand, C. D.; Smith, J.; Klages, J. P.; Kuhn, G.; Maher, B.; Moreton, S.; Wacker, L.; Frederichs, T.; Wiers, S.; Jernas, P.; Anderson, J. B.; Ehrmann, W. U.; Graham, A. G. C.; Gohl, K.; Larter, R. D.

    2016-02-01

    Satellite data and in-situ measurements show that today considerable mass loss is occurring from the Amundsen Sea sector of the West Antarctic Ice Sheet (WAIS). The observational record only spans the past four decades, and until recently the long-term context of the current deglaciation was poorly constrained. This information is, however, crucial for understanding WAIS dynamics, evaluating the role of forcing mechanisms for ice-sheet melting, and testing and calibrating ice-sheet models that attempt to predict future WAIS behavior and its impact on global sea level. Over the past decade several multinational marine expeditions and terrestrial fieldwork campaigns have targeted the Amundsen Sea shelf and its hinterland to reconstruct the WAIS configuration during the Last Glacial Maximum (LGM) and its subsequent deglacial history. The resulting studies succeeded in shedding light on the maximum WAIS extent at the LGM and the style, pattern and speed of its retreat and thinning thereafter. Despite this progress, however, significant uncertainties and discrepancies between marine and terrestrial reconstructions remain, which may arise from difficulties in dating sediment cores from the Antarctic shelf, especially their deglacial sections. Resolving these issues is crucial for understanding the WAIS' contribution to post-LGM sea-level rise, its sensitivity to different forcing mechanisms and its future evolution. Here we present chronological constraints on WAIS advance in the Amundsen Sea and its retreat from 20 ka BP into the Holocene that were obtained by various techniques, such as 14C dating of large ( 10 mg) and small (sample aliquots of calcareous microfossils, 14C dating of acid-insoluble organic matter combusted at low (300 °C) and high (800 °C) temperatures and dating of sediment cores by using geomagnetic paleointensity. We will compare the different age constraints and discuss their reliability, applicability and implications for WAIS history.

  17. Modeling Antarctic Ice Sheet retreat in warm climates: a historical perspective.

    Science.gov (United States)

    Pollard, D.; Deconto, R. M.; Gasson, E.

    2016-12-01

    Early modeling of Antarctic Ice Sheet size vs. climate focused on asymmetry between retreat and growth, with much greater warming needed to cause retreat from full ice cover, due to Height Mass Balance Feedback and albedo feedback. This led to a long-standing model-data conflict, with models needing 1000 to2000 ppmv atmospheric CO2 to produce retreat from full size, vs. proxy data of large ice fluctuations despite much lower CO2 since the Miocene.Subsequent modeling with marine ice physics found that the West Antarctic Ice Sheet could undergo repeated warm-period collapses with realistic past forcing. However, that yields only 3 to 7 m equivalent sea-level rise above modern, compared to 10 to 20 m or more suggested by some geologic data. Large subglacial basins in East Antarctica could be vulnerable to the same processes,but did not retreat in most models due to narrower and shallower sills.After recent modifications, some ice sheet models were able to produce warm-period collapse of major East Antarctic basins, with sea-level rise of up to 15 m. The modifications are (i) hydrofracturing by surface melt, and structural failure of ice cliffs, or (ii) numerical treatment at the grounding line. In these models, large retreat occurs both for past warmintervals, and also for future business-as-usual scenarios.Some interpretations of data in the late Oligocene and Miocene suggest yet larger fluctuations, between 50 to 100% of modern Antarctic size. That would require surface-melt driven retreat of some terrestrial East Antarctic ice, despite the hysteresis issue raised above. A recent study using a coupled climate-ice sheet model found that with a finer climate gridand more frequent coupling exchange, substantial retreat of terrestrial Antarctica can occur with 500 to 840 ppmv CO2, much lower than in earlier models. This will allow meaningful interactions between modeling and deeper-time geologic interpretations since the late Oligocene.

  18. Uncovering the structure-function relationship in spider silk

    Science.gov (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

    2018-03-01

    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  19. Combined ice core and climate-model evidence for the collapse of the West Antarctic Ice Sheet during Marine Isotope Stage 5e.

    Science.gov (United States)

    Steig, Eric J.; Huybers, Kathleen; Singh, Hansi A.; Steiger, Nathan J.; Frierson, Dargan M. W.; Popp, Trevor; White, James W. C.

    2015-04-01

    It has been speculated that collapse of the West Antarctic Ice Sheet explains the very high eustatic sea level rise during the last interglacial period, marine isotope stage (MIS) 5e, but the evidence remains equivocal. Changes in atmospheric circulation resulting from a collapse of the West Antarctic Ice Sheet (WAIS) would have significant regional impacts that should be detectable in ice core records. We conducted simulations using general circulation models (GCMs) at varying levels of complexity: a gray-radiation aquaplanet moist GCM (GRaM), the slab ocean version of GFDL-AM2 (also as an aquaplanet), and the fully-coupled version of NCAR's CESM with realistic topography. In all the experiments, decreased elevation from the removal of the WAIS leads to greater cyclonic circulation over the West Antarctic region. This creates increased advection of relatively warm marine air from the Amundsen-Bellingshausen Seas towards the South Pole, and increased cold-air advection from the East Antarctic plateau towards the Ross Sea and coastal Marie Byrd Land. The result is anomalous warming in some areas of the East Antarctic interior, and significant cooling in Marie Byrd Land. Comparison of ice core records shows good agreement with the model predictions. In particular, isotope-paleotemperature records from ice cores in East Antarctica warmed more between the previous glacial period (MIS 6) and MIS 5e than coastal Marie Byrd Land. These results add substantial support to other evidence for WAIS collapse during the last interglacial period.

  20. Animal coloration: sexy spider scales.

    Science.gov (United States)

    Taylor, Lisa A; McGraw, Kevin J

    2007-08-07

    Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

  1. Time-dependent motor properties of multipedal molecular spiders.

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  2. The value of C sub(e) for the Arabian Sea during summer monsoon

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, A.S.; Sadhuram, Y.; Krishna, V.V.G.

    We estimate, from the moisture budget the bulk aerodynamic coefficient for latent heat flux (C sub(e)) during the monsoon season over the central Arabian Sea. The average value of C sub(e) under active monsoon conditions was found to be 2.25 x 10...

  3. West Antarctic ice sheet and CO/sub 2/ greenhouse effect: a threat of disaster

    Energy Technology Data Exchange (ETDEWEB)

    Mercer, J H

    1978-01-26

    If the global consumption of fossil fuels continues to grow at its present rate, atmospheric CO/sub 2/ content will double in about 50 years. Climatic models suggest that the resultant greenhouse-warming effect will be greatly magnified in high latitudes. The computed temperature rise at lat 80/sup 0/S could start rapid deglaciation of West Antarctica, leading to a 5 m rise in sea level.

  4. Millennial-scale instability of the Antarctic Ice Sheet during the last glaciation.

    NARCIS (Netherlands)

    Kanfoush, S.L.; Hodell, D.A.; Charles, C.D.; Guilderson, T.P.; Mortyn, P.G.

    2000-01-01

    Records of ice-rafted detritus (IRD) concentration in deep-sea cores from the southeast Atlantic Ocean reveal millennial-scale pulses of IRD delivery between 20,000 and 74,000 years ago. Prominent IRD layers correlate across the Polar Frontal Zone, suggesting episodes of Antarctic Ice Sheet

  5. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  6. On the use of high-throughput sequencing for the study of cyanobacterial diversity in Antarctic aquatic mats.

    Science.gov (United States)

    Pessi, Igor Stelmach; Maalouf, Pedro De Carvalho; Laughinghouse, Haywood Dail; Baurain, Denis; Wilmotte, Annick

    2016-06-01

    The study of Antarctic cyanobacterial diversity has been mostly limited to morphological identification and traditional molecular techniques. High-throughput sequencing (HTS) allows a much better understanding of microbial distribution in the environment, but its application is hampered by several methodological and analytical challenges. In this work, we explored the use of HTS as a tool for the study of cyanobacterial diversity in Antarctic aquatic mats. Our results highlight the importance of using artificial communities to validate the parameters of the bioinformatics procedure used to analyze natural communities, since pipeline-dependent biases had a strong effect on the observed community structures. Analysis of microbial mats from five Antarctic lakes and an aquatic biofilm from the Sub-Antarctic showed that HTS is a valuable tool for the assessment of cyanobacterial diversity. The majority of the operational taxonomic units retrieved were related to filamentous taxa such as Leptolyngbya and Phormidium, which are common genera in Antarctic lacustrine microbial mats. However, other phylotypes related to different taxa such as Geitlerinema, Pseudanabaena, Synechococcus, Chamaesiphon, Calothrix, and Coleodesmium were also found. Results revealed a much higher diversity than what had been reported using traditional methods and also highlighted remarkable differences between the cyanobacterial communities of the studied lakes. The aquatic biofilm from the Sub-Antarctic had a distinct cyanobacterial community from the Antarctic lakes, which in turn displayed a salinity-dependent community structure at the phylotype level. © 2016 Phycological Society of America.

  7. A consistent data set of Antarctic ice sheet topography, cavity geometry, and global bathymetry

    Directory of Open Access Journals (Sweden)

    R. Timmermann

    2010-12-01

    Full Text Available Sub-ice shelf circulation and freezing/melting rates in ocean general circulation models depend critically on an accurate and consistent representation of cavity geometry. Existing global or pan-Antarctic topography data sets have turned out to contain various inconsistencies and inaccuracies. The goal of this work is to compile independent regional surveys and maps into a global data set. We use the S-2004 global 1-min bathymetry as the backbone and add an improved version of the BEDMAP topography (ALBMAP bedrock topography for an area that roughly coincides with the Antarctic continental shelf. The position of the merging line is individually chosen in different sectors in order to capture the best of both data sets. High-resolution gridded data for ice shelf topography and cavity geometry of the Amery, Fimbul, Filchner-Ronne, Larsen C and George VI Ice Shelves, and for Pine Island Glacier are carefully merged into the ambient ice and ocean topographies. Multibeam survey data for bathymetry in the former Larsen B cavity and the southeastern Bellingshausen Sea have been obtained from the data centers of Alfred Wegener Institute (AWI, British Antarctic Survey (BAS and Lamont-Doherty Earth Observatory (LDEO, gridded, and blended into the existing bathymetry map. The resulting global 1-min Refined Topography data set (RTopo-1 contains self-consistent maps for upper and lower ice surface heights, bedrock topography, and surface type (open ocean, grounded ice, floating ice, bare land surface. The data set is available in NetCDF format from the PANGAEA database at doi:10.1594/pangaea.741917.

  8. Can gravity waves significantly impact PSC occurrence in the Antarctic?

    Directory of Open Access Journals (Sweden)

    R. M. Woollands

    2009-11-01

    Full Text Available A combination of POAM III aerosol extinction and CHAMP RO temperature measurements are used to examine the role of atmospheric gravity waves in the formation of Antarctic Polar Stratospheric Clouds (PSCs. POAM III aerosol extinction observations and quality flag information are used to identify Polar Stratospheric Clouds using an unsupervised clustering algorithm.

    A PSC proxy, derived by thresholding Met Office temperature analyses with the PSC Type Ia formation temperature (T<sub>NAT>, shows general agreement with the results of the POAM III analysis. However, in June the POAM III observations of PSC are more abundant than expected from temperature threshold crossings in five out of the eight years examined. In addition, September and October PSC identified using temperature thresholding is often significantly higher than that derived from POAM III; this observation probably being due to dehydration and denitrification. Comparison of the Met Office temperature analyses with corresponding CHAMP observations also suggests a small warm bias in the Met Office data in June. However, this bias cannot fully explain the differences observed.

    Analysis of CHAMP data indicates that temperature perturbations associated with gravity waves may partially explain the enhanced PSC incidence observed in June (relative to the Met Office analyses. For this month, approximately 40% of the temperature threshold crossings observed using CHAMP RO data are associated with small-scale perturbations. Examination of the distribution of temperatures relative to T<sub>NAT> shows a large proportion of June data to be close to this threshold, potentially enhancing the importance of gravity wave induced temperature perturbations. Inspection of the longitudinal structure of PSC occurrence in June 2005 also shows that regions of enhancement are geographically associated with the Antarctic Peninsula; a known mountain wave "hotspot". The

  9. Asynchronous behavior of the Antarctic Ice Sheet and local glaciers during and since Termination 1, Salmon Valley, Antarctica

    Science.gov (United States)

    Jackson, Margaret S.; Hall, Brenda L.; Denton, George H.

    2018-01-01

    The stability of the Antarctic Ice Sheet under future warming remains an open question with broad implications for sea-level prediction and adaptation. In particular, knowledge of whether the ice sheet has the capacity for rapid drawdown or collapse, or whether it can remain stable during periods of warming, is essential for predicting its future behavior. Here we use 55 radiocarbon dates, coupled with geomorphologic mapping, to reconstruct the timing of changes in ice extent and elevation during the last ice-age termination in Salmon Valley, adjacent to McMurdo Sound in the western Ross Sea Embayment. Results indicate that a grounded ice sheet in the Ross Sea Embayment achieved its maximum elevation and extent along the headlands of Salmon Valley at ∼18,000 yr BP, during a period of increasing temperatures and accumulation over the Antarctic continent. This ice remained at or near its maximum on the headlands near the valley mouth until after ∼14,000 yr BP. Removal of grounded Ross Sea ice from Salmon Valley was complete shortly after ∼7900 yr BP, indicating that the grounding line had retreated through southern McMurdo Sound by that time. We suggest the primary driver of Ross Sea ice removal from McMurdo Sound was marine-based, either through basal melting or calving due to sea-level rise. When combined with regional data, the Salmon Valley record suggests that this sector of the Antarctic Ice Sheet did not contribute in a significant way to deglacial meltwater pulses, such as meltwater pulse 1a. In contrast to the Ross Sea ice, our work also shows that local, independent alpine glaciers in Salmon Valley have advanced through the Holocene. Land-terminating glaciers such as these elsewhere in the region show a similar pattern, and may reflect the continued influence of increased accumulation following the termination of the last ice age.

  10. Satellite gravity gradient views help reveal the Antarctic lithosphere

    Science.gov (United States)

    Ferraccioli, F.; Ebbing, J.; Pappa, F.; Kern, M.; Forsberg, R.

    2017-12-01

    Here we present and analyse satellite gravity gradient signatures derived from GOCE and superimpose these on tectonic and bedrock topography elements, as well as seismically-derived estimates of crustal thickness for the Antarctic continent. The GIU satellite gravity component images the contrast between the thinner crust and lithosphere underlying the West Antarctic Rift System and the Weddell Sea Rift System and the thicker lithosphere of East Antarctica. The new images also suggest that more distributed wide-mode lithospheric and crustal extension affects both the Ross Sea Embayment and the less well known Ross Ice Shelf segment of the rift system. However, this pattern is less clear towards the Bellingshousen Embayment, indicating that the rift system narrows towards the southern edge of the Antarctic Peninsula. In East Antarctica, the satellite gravity data provides new views into the Archean to Mesoproterozoic Terre Adelie Craton, and clearly shows the contrast wrt to the crust and lithosphere underlying both the Wilkes Subglacial Basin to the east and the Sabrina Subglacial Basin to the west. This finding augments recent interpretations of aeromagnetic and airborne gravity data over the region, suggesting that the Mawson Continent is a composite lithospheric-scale entity, which was affected by several Paleoproterozoic and Mesoproterozoic orogenic events. Thick crust is imaged beneath the Transantarctic Mountains, the Terre Adelie Craton, the Gamburtsev Subglacial Mountains and also Eastern Dronning Maud Land, in particular beneath the recently proposed region of the Tonian Oceanic Arc Superterrane. The GIA and GIU components help delineate the edges of several of these lithospheric provinces. One of the most prominent lithospheric-scale features discovered in East Antarctica from satellite gravity gradient imaging is the Trans East Antarctic Shear Zone that separates the Gamburtsev Province from the Eastern Dronning Maud Land Province and appears to form the

  11. Diet and trophic niche of Antarctic silverfish Pleuragramma antarcticum in the Ross Sea, Antarctica.

    Science.gov (United States)

    Pinkerton, M H; Forman, J; Bury, S J; Brown, J; Horn, P; O'Driscoll, R L

    2013-01-01

    The diet of Antarctic silverfish Pleuragramma antarcticum was evaluated by examining stomach contents of specimens collected in the Ross Sea (71°-77° S; 165°-180° E) in January to March 2008. Pleuragramma antarcticum (50-236 mm standard length, L(S)) and prey items were analysed for stable-isotopic composition of carbon and nitrogen. According to index of relative importance (I(RI) ), which incorporates frequency of occurrence, mass and number of prey items, the most important prey items were copepods (81%I(RI) over all specimens), predominantly Metridia gerlachei and Paraeuchaeta sp., with krill and fishes having low I(RI) (2·2 and 5·6%I(RI) overall). According to mass of prey (M) in stomachs, however, fishes (P. antarcticum and myctophids) and krill dominated overall diet (48 and 22%M, respectively), with copepods being a relatively minor constituent of overall diet by mass (9·9%M). Piscivory by P. antarcticum occurred mainly in the extreme south-west of the region and near the continental slope. Krill identified to species level in P. antarcticum stomachs were predominantly Euphausia superba (14·1%M) with some Euphausia crystallophorias (4·8%M). Both DistLM modelling (PRIMER-permanova+) on stomach contents (by I(RI)) and stepwise generalized linear modelling on stable isotopes showed that L(S) and location were significant predictors of P. antarcticum diet. Postlarval P. antarcticum (50-89 mm L(S)) consumed exclusively copepods. Juvenile P. antarcticum (90-151 mm L(S)) consumed predominantly krill and copepods by mass (46 and 30%M, respectively). Small adult P. antarcticum (152-178 mm L(S)) consumed krill, fishes and copepods (37, 36 and 15%M, respectively). Large adult P. antarcticum (179-236 mm L(S)) consumed predominantly fishes and krill (55 and 17%M, respectively), especially in the north (near the Ross Sea slope) and in the SW Ross Sea. Amphipods were occasionally important prey items for P. antarcticum (western Ross Sea, 39%M). General

  12. Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

    Science.gov (United States)

    Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

    2014-06-01

    The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Dating Antarctic ice sheet collapse: Proposing a molecular genetic approach

    Science.gov (United States)

    Strugnell, Jan M.; Pedro, Joel B.; Wilson, Nerida G.

    2018-01-01

    Sea levels at the end of this century are projected to be 0.26-0.98 m higher than today. The upper end of this range, and even higher estimates, cannot be ruled out because of major uncertainties in the dynamic response of polar ice sheets to a warming climate. Here, we propose an ecological genetics approach that can provide insight into the past stability and configuration of the West Antarctic Ice Sheet (WAIS). We propose independent testing of the hypothesis that a trans-Antarctic seaway occurred at the last interglacial. Examination of the genomic signatures of bottom-dwelling marine species using the latest methods can provide an independent window into the integrity of the WAIS more than 100,000 years ago. Periods of connectivity facilitated by trans-Antarctic seaways could be revealed by dating coalescent events recorded in DNA. These methods allow alternative scenarios to be tested against a fit to genomic data. Ideal candidate taxa for this work would need to possess a circumpolar distribution, a benthic habitat, and some level of genetic structure indicated by phylogeographical investigation. The purpose of this perspective piece is to set out an ecological genetics method to help resolve when the West Antarctic Ice Shelf last collapsed.

  14. Facile Template-Free Fabrication of the hollow sea cucumber-like TbF{sub 3} and luminescent properties

    Energy Technology Data Exchange (ETDEWEB)

    Gao, Yu, E-mail: gaoy777@126.com [College of Materials Science and Engineering, Shenyang University of Chemical Technology, Shenyang, 100142 (China); Shi, Shan; Fang, Qinghong; Yang, Feng [College of Materials Science and Engineering, Shenyang University of Chemical Technology, Shenyang, 100142 (China); Xu, Zhenhe [College of Applied Chemistry, Shenyang University of Chemical Technology, Shenyang, 100142 (China)

    2014-12-15

    Graphical abstract: Hollow sea cucumber-like TbF{sub 3} has been prepared via a facile hydrothermal route. The possible growth mechanism and the luminescent properties of the as-prepared sample have been discussed. - Highlights: • TbF3 particles were prepared by a facile hydrothermal route. • TbF3 product show strong green emission. • This method may be more widely applicable in the design of other rare-earth compounds. - Abstract: Hollow sea cucumber-like TbF{sub 3} was successfully fabricated by a self-assembled hydrothermal method. The crystal structure, morphology and photoluminescence properties of the as-prepared TbF{sub 3} crystals were investigated. The results revealed that the as-prepared TbF{sub 3} sample has orthorhombic structure and composed of monodispersed 3D hollow sea cucumber-like particles. The possible formation mechanism for sea cucumber-like TbF{sub 3} is presented in detail. Additionally, the as-prepared sample possesses property of down-conversion photoluminescence. The excitation spectrum of TbF{sub 3} sample was obtained by monitoring the emission of Tb{sup 3+} at 545 nm was composed of the characteristics f–f transition lines within the Tb{sup 3+} 4f{sup 8} configuration. Under the UV light irradiation, the emission spectrum exhibited four obvious lines centered at 491, 545, 588, and 620 nm, which was corresponding to the {sup 5}D{sub 4} → {sup 7}F{sub J} (J = 6, 5, 4, 3) transitions of the Tb{sup 3+} ions in the TbF{sub 3} nanoparticles.

  15. On the mechanisms of late 20th century sea-surface temperature trends over the Antarctic Circumpolar Current

    Science.gov (United States)

    Kravtsov, Sergey; Kamenkovich, Igor; Hogg, Andrew M.; Peters, John M.

    2011-11-01

    The Antarctic Circumpolar Current (ACC), with its associated three-dimensional circulation, plays an important role in global climate. This study concentrates on surface signatures of recent climate change in the ACC region and on mechanisms that control this change. Examination of climate model simulations shows that they match the observed late 20th century sea-surface temperature (SST) trends averaged over this region quite well, despite underestimating the observed surface-wind increases. Such wind increases, however, are expected to lead to significant cooling of the region, contradicting the observed SST trends. Motivated by recent theories of the ACC response to variable wind and radiative forcing, the authors used two idealized models to assess contributions of various dynamical processes to the SST evolution in the region. In particular, a high-resolution channel model of the ACC responds to increasing winds by net surface ACC warming due to enhanced mesoscale turbulence and associated heat transports in the mixed layer. These fluxes, modeled, in a highly idealized fashion, via increased lateral surface mixing in a coarse-resolution hybrid climate model, substantially offset zonally non-uniform surface cooling due to air-sea flux and Ekman-transport anomalies. These results suggest that the combination of these opposing effects must be accounted for when estimating climate response to any external forcing in the ACC region.

  16. Satellite remote sensing of the island mass effect on the Sub-Antarctic Kerguelen Plateau, Southern Ocean

    Science.gov (United States)

    Jena, Babula

    2016-09-01

    The presence of the Kerguelen Plateau and surrounding bathymetric features has a strong influence on the persistently eastward flowing Antarctic Circumpolar Current (ACC), resulting in enhancement of surface chlorophyll-a (Chl- a) in the downstream section of the plateau along the polar front (PF). The phenomenon is reported in this paper as the island mass effect (IME). Analysis of climatological Chl- a datasets from Aqua- Moderate Resolution Imaging Spectroradiometer (Aqua- MODIS) and Sea-viewing Wide Field-of-view Sensor (SeaWiFS) shows distinct bloomy plumes (Chl- a>0.5 mg/m3) during austral spring-summer spreading as far as ~1800 km offshore up to 98°E along the downstream of the north Kerguelen Plateau (NKP). Similar IME phenomena is apparent over the south Kerguelen Plateau (SKP) with the phytoplankton bloom extending up to 96.7°E, along the southern boundary of ACC. The IME phenomena are pronounced only during austral spring-summer period with the availability of light and sedimentary source of iron from shallow plateau to sea surface that fertilizes the mixed layer. The NKP bloom peaks with a maximum areal extent of 1.315 million km2 during December, and the SKP bloom peaks during January with a time lag of one month. The blooms exist for at least 4 months of a year and are significant both as the base of regional food web and for regulating the biogeochemical cycle in the Southern Ocean. Even though the surface water above the Kerguelen Plateau is rich in Chl- a, an exception of an oligotrophic condition dominated between NKP and SKP due to apparent intrusion of iron limited low phytoplankton regime waters from the Enderby basin through the northeastward Fawn Trough Current.

  17. Water Circulation and Marine Environment in the Antarctic Traced by Speciation of 129I and 127I

    DEFF Research Database (Denmark)

    Xing, Shan; Hou, Xiaolin; Aldahan, Ala

    2017-01-01

    Emissions of anthropogenic 129I from human nuclear activities are now detected in the surface water of the Antarctic seas. Surface seawater samples from the Drake Passage, Bellingshausen, Amundsen, and Ross Seas were analyzed for total 129I and 127I, as well as for iodide and iodate of these two....... The iodine distribution patterns provide useful information on surface water transport and mixing that are vital for better understanding of the Southern Oceans effects on the global climate change. The results indicate multiple spatial interactions between the Antarctic Circumpolar Current (ACC......) and Antarctic Peninsula Coastal Current (APCC). These interactions happen in restricted circulation pathways that may partly relate to glacial melting and icebergs transport. Biological activity during the warm season should be one of the key factors controlling the reduction of iodate in the coastal water...

  18. Future Antarctic Bed Topography and Its Implications for Ice Sheet Dynamics

    Science.gov (United States)

    Adhikari, Surendra; Ivins, Erik R.; Larour, Eric Y.; Seroussi, Helene L.; Morlighem, Mathieu; Nowicki, S.

    2014-01-01

    The Antarctic bedrock is evolving as the solid Earth responds to the past and ongoing evolution of the ice sheet. A recently improved ice loading history suggests that the Antarctic Ice Sheet (AIS) has generally been losing its mass since the Last Glacial Maximum. In a sustained warming climate, the AIS is predicted to retreat at a greater pace, primarily via melting beneath the ice shelves.We employ the glacial isostatic adjustment (GIA) capability of the Ice Sheet System Model (ISSM) to combine these past and future ice loadings and provide the new solid Earth computations for the AIS.We find that past loading is relatively less important than future loading for the evolution of the future bed topography. Our computations predict that the West Antarctic Ice Sheet (WAIS) may uplift by a few meters and a few tens of meters at years AD 2100 and 2500, respectively, and that the East Antarctic Ice Sheet is likely to remain unchanged or subside minimally except around the Amery Ice Shelf. The Amundsen Sea Sector in particular is predicted to rise at the greatest rate; one hundred years of ice evolution in this region, for example, predicts that the coastline of Pine Island Bay will approach roughly 45mmyr-1 in viscoelastic vertical motion. Of particular importance, we systematically demonstrate that the effect of a pervasive and large GIA uplift in the WAIS is generally associated with the flattening of reverse bed slope, reduction of local sea depth, and thus the extension of grounding line (GL) towards the continental shelf. Using the 3-D higher-order ice flow capability of ISSM, such a migration of GL is shown to inhibit the ice flow. This negative feedback between the ice sheet and the solid Earth may promote stability in marine portions of the ice sheet in the future.

  19. Future Antarctic bed topography and its implications for ice sheet dynamics

    Science.gov (United States)

    Adhikari, S.; Ivins, E. R.; Larour, E.; Seroussi, H.; Morlighem, M.; Nowicki, S.

    2014-06-01

    The Antarctic bedrock is evolving as the solid Earth responds to the past and ongoing evolution of the ice sheet. A recently improved ice loading history suggests that the Antarctic Ice Sheet (AIS) has generally been losing its mass since the Last Glacial Maximum. In a sustained warming climate, the AIS is predicted to retreat at a greater pace, primarily via melting beneath the ice shelves. We employ the glacial isostatic adjustment (GIA) capability of the Ice Sheet System Model (ISSM) to combine these past and future ice loadings and provide the new solid Earth computations for the AIS. We find that past loading is relatively less important than future loading for the evolution of the future bed topography. Our computations predict that the West Antarctic Ice Sheet (WAIS) may uplift by a few meters and a few tens of meters at years AD 2100 and 2500, respectively, and that the East Antarctic Ice Sheet is likely to remain unchanged or subside minimally except around the Amery Ice Shelf. The Amundsen Sea Sector in particular is predicted to rise at the greatest rate; one hundred years of ice evolution in this region, for example, predicts that the coastline of Pine Island Bay will approach roughly 45 mm yr-1 in viscoelastic vertical motion. Of particular importance, we systematically demonstrate that the effect of a pervasive and large GIA uplift in the WAIS is generally associated with the flattening of reverse bed slope, reduction of local sea depth, and thus the extension of grounding line (GL) towards the continental shelf. Using the 3-D higher-order ice flow capability of ISSM, such a migration of GL is shown to inhibit the ice flow. This negative feedback between the ice sheet and the solid Earth may promote stability in marine portions of the ice sheet in the future.

  20. ARM West Antarctic Radiation Experiment (AWARE) Field Campaign Report

    Energy Technology Data Exchange (ETDEWEB)

    Lubin, Daniel [Univ. of California, San Diego, CA (United States). Scripps Inst. of Oceanography; Bromwich, David H [Ohio State University; Vogelmann, Andrew M [Brookhaven National Lab. (BNL), Upton, NY (United States); Verlinde, Johannes [Pennsylvania State Univ., University Park, PA (United States); Russell, Lynn M [Univ. of California, San Diego, CA (United States). Scripps Inst. of Oceanography

    2017-09-15

    The U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) West Antarctic Radiation Experiment (AWARE) is the most technologically advanced atmospheric and climate science campaign yet fielded in Antarctica. AWARE was motivated be recent concern about the impact of cryospheric mass loss on global sea level rise. Specifically, the West Antarctic Ice Sheet (WAIS) is now the second largest contributor to rising sea level, after the Greenland Ice Sheet. As steadily warming ocean water erodes the grounding lines of WAIS components where they meet the Amundsen and Bellingshausen Seas, the retreating grounding lines moving inland and downslope on the underlying terrain imply mechanical instability of the entire WAIS. There is evidence that this point of instability may have already been reached, perhaps signifying more rapid loss of WAIS ice mass. At the same time, the mechanical support provided by adjacent ice shelves, and also the fundamental stability of exposed ice cliffs at the ice sheet grounding lines, will be adversely impacted by a warming atmosphere that causes more frequent episodes of surface melting. The surface meltwater damages the ice shelves and ice cliffs through hydrofracturing. With the increasing concern regarding these rapid cryospheric changes, AWARE was motivated by the need to (a) diagnose the surface energy balance in West Antarctica as related to both summer season climatology and potential surface melting, and (b) improve global climate model (GCM) performance over Antarctica, such that future cryospheric projections can be more reliable.

  1. Climate change and the marine ecosystem of the western Antarctic Peninsula

    Science.gov (United States)

    Clarke, Andrew; Murphy, Eugene J; Meredith, Michael P; King, John C; Peck, Lloyd S; Barnes, David K.A; Smith, Raymond C

    2006-01-01

    The Antarctic Peninsula is experiencing one of the fastest rates of regional climate change on Earth, resulting in the collapse of ice shelves, the retreat of glaciers and the exposure of new terrestrial habitat. In the nearby oceanic system, winter sea ice in the Bellingshausen and Amundsen seas has decreased in extent by 10% per decade, and shortened in seasonal duration. Surface waters have warmed by more than 1 K since the 1950s, and the Circumpolar Deep Water (CDW) of the Antarctic Circumpolar Current has also warmed. Of the changes observed in the marine ecosystem of the western Antarctic Peninsula (WAP) region to date, alterations in winter sea ice dynamics are the most likely to have had a direct impact on the marine fauna, principally through shifts in the extent and timing of habitat for ice-associated biota. Warming of seawater at depths below ca 100 m has yet to reach the levels that are biologically significant. Continued warming, or a change in the frequency of the flooding of CDW onto the WAP continental shelf may, however, induce sublethal effects that influence ecological interactions and hence food-web operation. The best evidence for recent changes in the ecosystem may come from organisms which record aspects of their population dynamics in their skeleton (such as molluscs or brachiopods) or where ecological interactions are preserved (such as in encrusting biota of hard substrata). In addition, a southwards shift of marine isotherms may induce a parallel migration of some taxa similar to that observed on land. The complexity of the Southern Ocean food web and the nonlinear nature of many interactions mean that predictions based on short-term studies of a small number of species are likely to be misleading. PMID:17405211

  2. Climate change and the marine ecosystem of the western Antarctic Peninsula.

    Science.gov (United States)

    Clarke, Andrew; Murphy, Eugene J; Meredith, Michael P; King, John C; Peck, Lloyd S; Barnes, David K A; Smith, Raymond C

    2007-01-29

    The Antarctic Peninsula is experiencing one of the fastest rates of regional climate change on Earth, resulting in the collapse of ice shelves, the retreat of glaciers and the exposure of new terrestrial habitat. In the nearby oceanic system, winter sea ice in the Bellingshausen and Amundsen seas has decreased in extent by 10% per decade, and shortened in seasonal duration. Surface waters have warmed by more than 1 K since the 1950s, and the Circumpolar Deep Water (CDW) of the Antarctic Circumpolar Current has also warmed. Of the changes observed in the marine ecosystem of the western Antarctic Peninsula (WAP) region to date, alterations in winter sea ice dynamics are the most likely to have had a direct impact on the marine fauna, principally through shifts in the extent and timing of habitat for ice-associated biota. Warming of seawater at depths below ca 100 m has yet to reach the levels that are biologically significant. Continued warming, or a change in the frequency of the flooding of CDW onto the WAP continental shelf may, however, induce sublethal effects that influence ecological interactions and hence food-web operation. The best evidence for recent changes in the ecosystem may come from organisms which record aspects of their population dynamics in their skeleton (such as molluscs or brachiopods) or where ecological interactions are preserved (such as in encrusting biota of hard substrata). In addition, a southwards shift of marine isotherms may induce a parallel migration of some taxa similar to that observed on land. The complexity of the Southern Ocean food web and the nonlinear nature of many interactions mean that predictions based on short-term studies of a small number of species are likely to be misleading.

  3. Maternal care and subsocial behaviour in spiders.

    Science.gov (United States)

    Yip, Eric C; Rayor, Linda S

    2014-05-01

    While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

  4. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  5. Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

    DEFF Research Database (Denmark)

    Bilde, T.; Maklakov, A.A.; Schilling, Nadia

    2007-01-01

    avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

  6. Understanding Spider-Man: Your Everyday Superhero

    OpenAIRE

    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

    2014-01-01

    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  7. Impacts of Interactive Stratospheric Chemistry on Antarctic and Southern Ocean Climate Change in the Goddard Earth Observing System Version 5 (GEOS-5)

    Science.gov (United States)

    Li, Feng; Vikhliaev, Yury V.; Newman, Paul A.; Pawson, Steven; Perlwitz, Judith; Waugh, Darryn W.; Douglass, Anne R.

    2016-01-01

    Stratospheric ozone depletion plays a major role in driving climate change in the Southern Hemisphere. To date, many climate models prescribe the stratospheric ozone layer's evolution using monthly and zonally averaged ozone fields. However, the prescribed ozone underestimates Antarctic ozone depletion and lacks zonal asymmetries. In this study we investigate the impact of using interactive stratospheric chemistry instead of prescribed ozone on climate change simulations of the Antarctic and Southern Ocean. Two sets of 1960-2010 ensemble transient simulations are conducted with the coupled ocean version of the Goddard Earth Observing System Model, version 5: one with interactive stratospheric chemistry and the other with prescribed ozone derived from the same interactive simulations. The model's climatology is evaluated using observations and reanalysis. Comparison of the 1979-2010 climate trends between these two simulations reveals that interactive chemistry has important effects on climate change not only in the Antarctic stratosphere, troposphere, and surface, but also in the Southern Ocean and Antarctic sea ice. Interactive chemistry causes stronger Antarctic lower stratosphere cooling and circumpolar westerly acceleration during November-December-January. It enhances stratosphere-troposphere coupling and leads to significantly larger tropospheric and surface westerly changes. The significantly stronger surface wind stress trends cause larger increases of the Southern Ocean Meridional Overturning Circulation, leading to year-round stronger ocean warming near the surface and enhanced Antarctic sea ice decrease.

  8. Antartic sea ice, 1973 - 1976: Satellite passive-microwave observations

    Science.gov (United States)

    Zwally, H. J.; Comiso, J. C.; Parkinson, C. L.; Campbell, W. J.; Carsey, F. D.; Gloersen, P.

    1983-01-01

    Data from the Electrically Scanning Microwave Radiometer (ESMR) on the Nimbus 5 satellite are used to determine the extent and distribution of Antarctic sea ice. The characteristics of the southern ocean, the mathematical formulas used to obtain quantitative sea ice concentrations, the general characteristics of the seasonal sea ice growth/decay cycle and regional differences, and the observed seasonal growth/decay cycle for individual years and interannual variations of the ice cover are discussed. The sea ice data from the ESMR are presented in the form of color-coded maps of the Antarctic and the southern oceans. The maps show brightness temperatures and concentrations of pack ice averaged for each month, 4-year monthly averages, and month-to-month changes. Graphs summarizing the results, such as areas of sea ice as a function of time in the various sectors of the southern ocean are included. The images demonstrate that satellite microwave data provide unique information on large-scale sea ice conditions for determining climatic conditions in polar regions and possible global climatic changes.

  9. Calcium carbonate as ikaite crystals in Antarctic sea ice

    Science.gov (United States)

    Dieckmann, Gerhard S.; Nehrke, Gernot; Papadimitriou, Stathys; Göttlicher, Jörg; Steininger, Ralph; Kennedy, Hilary; Wolf-Gladrow, Dieter; Thomas, David N.

    2008-04-01

    We report on the discovery of the mineral ikaite (CaCO3.6H2O) in sea-ice from the Southern Ocean. The precipitation of CaCO3 during the freezing of seawater has previously been predicted from thermodynamic modelling, indirect measurements, and has been documented in artificial sea ice during laboratory experiments but has not been reported for natural sea-ice. It is assumed that CaCO3 formation in sea ice may be important for a sea ice-driven carbon pump in ice-covered oceanic waters. Without direct evidence of CaCO3 precipitation in sea ice, its role in this and other processes has remained speculative. The discovery of CaCO3.6H2O crystals in natural sea ice provides the necessary evidence for the evaluation of previous assumptions and lays the foundation for further studies to help elucidate the role of ikaite in the carbon cycle of the seasonally sea ice-covered regions

  10. Kiloniella antarctica sp. nov., isolated from a polynya of Amundsen Sea in Western Antarctic Sea.

    Science.gov (United States)

    Si, Ok-Ja; Yang, Hye-Young; Hwang, Chung Yeon; Kim, So-Jeong; Choi, Sun-Bin; Kim, Jong-Geol; Jung, Man-Young; Kim, Song-Gun; Roh, Seong Woon; Rhee, Sung-Keun

    2017-07-01

    A taxonomic study was conducted on strain soj2014T, which was isolated from the surface water of a polynya in the Antarctic Sea. Comparative 16S rRNA gene sequence analysis showed that strain soj2014T belongs to the family Kiloniellaceae and is closely related to Kiloniella spongiae MEBiC09566T, 'Kiloniella litopenaei' P1-1T and Kiloniella laminariae LD81T (98.0 %, 97.8 % and 96.2 % 16S rRNA gene sequence similarity, respectively). The DNA-DNA hybridization values between strain soj2014T and closely related strains were below 28.6 %. The G+C content of the genomic DNA of strain soj2014T was 45.5 mol%. The predominant cellular fatty acids were summed feature 8 (composed of C18 : 1ω6c/C18 : 1ω7c, 57.0 %) and summed feature 3 (composed of C16 : 1ω6c/C16 : 1ω7c, 23.5 %). Strain soj2014T was Gram-stain-negative, slightly curved, spiral-shaped, and motile with a single polar flagellum. The strain grew at 0-30 °C (optimum, 25 °C), in 1.5-5.1 % (w/v) NaCl (optimum, 2.1-2.4 %) and at pH 5.5-9.5 (optimum, 7.5-8.0). It also had differential carbohydrate utilization traits and enzyme activities compared with closely related strains. Based on these phylogenetic, phenotypic and chemotaxonomic analyses, strain soj2014T represents a distinct species, separable from the reference strains, and is, therefore, proposed as a novel species, Kiloniella antarctica sp. nov. The type strain is soj2014T (=KCTC 42186T=JCM 30386T).

  11. Wiring a periscope--ocelli, retinula axons, visual neuropils and the ancestrality of sea spiders.

    Science.gov (United States)

    Lehmann, Tobias; Hess, Martin; Melzer, Roland R

    2012-01-01

    The Pycnogonida or sea spiders are cryptic, eight-legged arthropods with four median ocelli in a 'periscope' or eye tubercle. In older attempts at reconstructing phylogeny they were Arthropoda incertae sedis, but recent molecular trees placed them as the sister group either to all other euchelicerates or even to all euarthropods. Thus, pycnogonids are among the oldest extant arthropods and hold a key position for the understanding of arthropod evolution. This has stimulated studies of new sets of characters conductive to cladistic analyses, e.g. of the chelifores and of the hox gene expression pattern. In contrast knowledge of the architecture of the visual system is cursory. A few studies have analysed the ocelli and the uncommon "pseudoinverted" retinula cells. Moreover, analyses of visual neuropils are still at the stage of Hanström's early comprehensive works. We have therefore used various techniques to analyse the visual fibre pathways and the structure of their interrelated neuropils in several species. We found that pycnogonid ocelli are innervated to first and second visual neuropils in close vicinity to an unpaired midline neuropil, i.e. possibly the arcuate body, in a way very similar to ancestral euarthropods like Euperipatoides rowelli (Onychophora) and Limulus polyphemus (Xiphosura). This supports the ancestrality of pycnogonids and sheds light on what eyes in the pycnogonid ground plan might have 'looked' like. Recently it was suggested that arthropod eyes originated from simple ocelli similar to larval eyes. Hence, pycnogonid eyes would be one of the early offshoots among the wealth of more sophisticated arthropod eyes.

  12. Wiring a periscope--ocelli, retinula axons, visual neuropils and the ancestrality of sea spiders.

    Directory of Open Access Journals (Sweden)

    Tobias Lehmann

    Full Text Available The Pycnogonida or sea spiders are cryptic, eight-legged arthropods with four median ocelli in a 'periscope' or eye tubercle. In older attempts at reconstructing phylogeny they were Arthropoda incertae sedis, but recent molecular trees placed them as the sister group either to all other euchelicerates or even to all euarthropods. Thus, pycnogonids are among the oldest extant arthropods and hold a key position for the understanding of arthropod evolution. This has stimulated studies of new sets of characters conductive to cladistic analyses, e.g. of the chelifores and of the hox gene expression pattern. In contrast knowledge of the architecture of the visual system is cursory. A few studies have analysed the ocelli and the uncommon "pseudoinverted" retinula cells. Moreover, analyses of visual neuropils are still at the stage of Hanström's early comprehensive works. We have therefore used various techniques to analyse the visual fibre pathways and the structure of their interrelated neuropils in several species. We found that pycnogonid ocelli are innervated to first and second visual neuropils in close vicinity to an unpaired midline neuropil, i.e. possibly the arcuate body, in a way very similar to ancestral euarthropods like Euperipatoides rowelli (Onychophora and Limulus polyphemus (Xiphosura. This supports the ancestrality of pycnogonids and sheds light on what eyes in the pycnogonid ground plan might have 'looked' like. Recently it was suggested that arthropod eyes originated from simple ocelli similar to larval eyes. Hence, pycnogonid eyes would be one of the early offshoots among the wealth of more sophisticated arthropod eyes.

  13. Non-pest prey do not disrupt aphid predation by a web-building spider.

    Science.gov (United States)

    Welch, K D; Whitney, T D; Harwood, J D

    2016-02-01

    A generalist predator's ability to contribute to biological control is influenced by the decisions it makes during foraging. Predators often use flexible foraging tactics, which allows them to pursue specific types of prey at the cost of reducing the likelihood of capturing other types of prey. When a pest insect has low nutritional quality or palatability for a predator, the predator is likely to reject that prey in favour of pursuing alternative, non-pest prey. This is often thought to limit the effectiveness of generalist predators in consuming aphids, which are of low nutritional quality for many generalist predators. Here, we report behavioural assays that test the hypothesis that the generalist predator, Grammonota inornata (Araneae: Linyphiidae), preferentially forages for a non-pest prey with high nutritional quality (springtails), and rejects a pest prey with low nutritional quality (aphids). In no-choice assays, molecular gut-content analysis revealed that spiders continued to feed on the low-quality aphids at high rates, even when high-quality springtails were readily available. When provided a choice between aphids and springtails in two-way choice tests, spiders did not show the expected preference for springtails. Decision-making by spiders during foraging therefore appears to be sub-optimal, possibly because of attraction to the less frequently encountered of two preys as part of a dietary diversification strategy. These results indicate that behavioural preferences alone do not necessarily compromise the pest-suppression capacity of natural enemies: even nutritionally sub-optimal pest prey can potentially be subject to predation and suppression by natural enemies.

  14. Antarctic research today

    International Nuclear Information System (INIS)

    Hempel, G.

    1982-01-01

    With the appetite for living and dead natural resources, the political and economical interest concerning the Antarctic increases throughout the world. There are three interrelated main subjects accounting for the international interest: The shelf tectonic puzzle of the original continent of Gondwana, where the Antarctic is situated in the centre, between Australia, South Africa and South America, and the hopes concerning the existence of mineral resources under the ice of the Antarctic are based thereon. The Antarctic forms the biggest unified living space of the world. (orig.)

  15. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  16. Restricted regions of enhanced growth of Antarctic krill in the circumpolar Southern Ocean.

    Science.gov (United States)

    Murphy, Eugene J; Thorpe, Sally E; Tarling, Geraint A; Watkins, Jonathan L; Fielding, Sophie; Underwood, Philip

    2017-07-31

    Food webs in high-latitude oceans are dominated by relatively few species. Future ocean and sea-ice changes affecting the distribution of such species will impact the structure and functioning of whole ecosystems. Antarctic krill (Euphausia superba) is a key species in Southern Ocean food webs, but there is little understanding of the factors influencing its success throughout much of the ocean. The capacity of a habitat to maintain growth will be crucial and here we use an empirical relationship of growth rate to assess seasonal spatial variability. Over much of the ocean, potential for growth is limited, with three restricted oceanic regions where seasonal conditions permit high growth rates, and only a few areas around the Scotia Sea and Antarctic Peninsula suitable for growth of the largest krill (>60 mm). Our study demonstrates that projections of impacts of future change need to account for spatial and seasonal variability of key ecological processes within ocean ecosystems.

  17. Parameter Estimations of Dynamic Energy Budget (DEB Model over the Life History of a Key Antarctic Species: The Antarctic Sea Star Odontaster validus Koehler, 1906.

    Directory of Open Access Journals (Sweden)

    Antonio Agüera

    Full Text Available Marine organisms in Antarctica are adapted to an extreme ecosystem including extremely stable temperatures and strong seasonality due to changes in day length. It is now largely accepted that Southern Ocean organisms are particularly vulnerable to global warming with some regions already being challenged by a rapid increase of temperature. Climate change affects both the physical and biotic components of marine ecosystems and will have an impact on the distribution and population dynamics of Antarctic marine organisms. To predict and assess the effect of climate change on marine ecosystems a more comprehensive knowledge of the life history and physiology of key species is urgently needed. In this study we estimate the Dynamic Energy Budget (DEB model parameters for key benthic Antarctic species the sea star Odontaster validus using available information from literature and experiments. The DEB theory is unique in capturing the metabolic processes of an organism through its entire life cycle as a function of temperature and food availability. The DEB model allows for the inclusion of the different life history stages, and thus, becomes a tool that can be used to model lifetime feeding, growth, reproduction, and their responses to changes in biotic and abiotic conditions. The DEB model presented here includes the estimation of reproduction handling rules for the development of simultaneous oocyte cohorts within the gonad. Additionally it links the DEB model reserves to the pyloric caeca an organ whose function has long been ascribed to energy storage. Model parameters described a slowed down metabolism of long living animals that mature slowly. O. validus has a large reserve that-matching low maintenance costs- allow withstanding long periods of starvation. Gonad development is continuous and individual cohorts developed within the gonads grow in biomass following a power function of the age of the cohort. The DEB model developed here for O

  18. Egg masses of the Patagonian squid Doryteuthis (Amerigo gahi attached to giant kelp (Macrocystis pyrifera in the sub-Antarctic ecoregion

    Directory of Open Access Journals (Sweden)

    Sebastián Rosenfeld

    2014-11-01

    Full Text Available Egg masses of the Patagonian squid Doryteuthis (Amerigo gahi attached to giant kelp (Macrocystis pyrifera in the Magellanic channels of the sub-Antarctic ecoregion in southern South America is documented for the first time. Of seven egg masses observed between 2008 and 2011, one was taken to the laboratory to be analysed and photographed. Comprising long transparent capsules containing eggs, the masses were strongly attached to the stipes of M. pyrifera. This macroalgae is a potentially important economic resource due to its multiple industrial uses; this study shows that it also serves an important ecological role as a spawning substrate for D. gahi.

  19. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

    Science.gov (United States)

    Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

    2015-09-24

    A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

  20. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  1. First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

    Science.gov (United States)

    Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

    2017-06-30

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

  2. Two new species of calcareous sponges (Porifera: Calcarea) from the deep Antarctic Eckström Shelf and a revised list of species found in Antarctic waters

    DEFF Research Database (Denmark)

    Rapp, Hans Tore; Göcke, Christian; Tendal, Ole Secher

    2013-01-01

    The paper reports on two new species of calcareous sponges (Porifera, Calcarea) from the Antarctic Weddell Sea, Clathrina brandtae sp. nov. and Leucetta delicata sp. nov., collected at 600 m depth during the ANT XXIV/2-SYSTCO expedition in January 2008. The new species are described based...... on a combination of morphological and molecular data. With these new additions the number of species of calcareous sponges reported from south of 50 degrees S (similar to south of the Polar Front) reaches 50 species. We report an exceptionally high degree of endemism within the group, and as many as 44 out...... of the 50 species of calcareous sponges are solely confined to Antarctic waters. An updated list of species of calcareous sponges from the area is provided....

  3. Albedo of the ice covered Weddell and Bellingshausen Seas

    OpenAIRE

    A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin

    2012-01-01

    This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo, which were conducted in the sea ice areas of the Weddell and Bellingshausen Seas show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albedo o...

  4. Albedo of the ice-covered Weddell and Bellingshausen Sea

    OpenAIRE

    A. I. Weiss; J. C. King; T. A. Lachlan-Cope; R. S. Ladkin

    2011-01-01

    This study investigates the surface albedo of the sea ice areas adjacent to the Antarctic Peninsula during the austral summer. Aircraft measurements of the surface albedo which were conducted in the sea ice areas of the Weddell and Bellingshausen Sea show significant differences between these two regions. The averaged surface albedo varied between 0.13 and 0.81. The ice cover of the Bellingshausen Sea consisted mainly of first year ice and the sea surface showed an averaged sea ice albed...

  5. Biomechanics of Spider Silks

    Science.gov (United States)

    2006-03-02

    water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

  6. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

  7. Arctic Landfast Sea Ice 1953-1998

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The files in this data set contain landfast sea ice data (monthly means) gathered from both Russian Arctic and Antarctic Research Institute (AARI) and Canadian Ice...

  8. SPIDERS: selection of spectroscopic targets using AGN candidates detected in all-sky X-ray surveys

    Science.gov (United States)

    Dwelly, T.; Salvato, M.; Merloni, A.; Brusa, M.; Buchner, J.; Anderson, S. F.; Boller, Th.; Brandt, W. N.; Budavári, T.; Clerc, N.; Coffey, D.; Del Moro, A.; Georgakakis, A.; Green, P. J.; Jin, C.; Menzel, M.-L.; Myers, A. D.; Nandra, K.; Nichol, R. C.; Ridl, J.; Schwope, A. D.; Simm, T.

    2017-07-01

    SPIDERS (SPectroscopic IDentification of eROSITA Sources) is a Sloan Digital Sky Survey IV (SDSS-IV) survey running in parallel to the Extended Baryon Oscillation Spectroscopic Survey (eBOSS) cosmology project. SPIDERS will obtain optical spectroscopy for large numbers of X-ray-selected active galactic nuclei (AGN) and galaxy cluster members detected in wide-area eROSITA, XMM-Newton and ROSAT surveys. We describe the methods used to choose spectroscopic targets for two sub-programmes of SPIDERS X-ray selected AGN candidates detected in the ROSAT All Sky and the XMM-Newton Slew surveys. We have exploited a Bayesian cross-matching algorithm, guided by priors based on mid-IR colour-magnitude information from the Wide-field Infrared Survey Explorer survey, to select the most probable optical counterpart to each X-ray detection. We empirically demonstrate the high fidelity of our counterpart selection method using a reference sample of bright well-localized X-ray sources collated from XMM-Newton, Chandra and Swift-XRT serendipitous catalogues, and also by examining blank-sky locations. We describe the down-selection steps which resulted in the final set of SPIDERS-AGN targets put forward for spectroscopy within the eBOSS/TDSS/SPIDERS survey, and present catalogues of these targets. We also present catalogues of ˜12 000 ROSAT and ˜1500 XMM-Newton Slew survey sources that have existing optical spectroscopy from SDSS-DR12, including the results of our visual inspections. On completion of the SPIDERS programme, we expect to have collected homogeneous spectroscopic redshift information over a footprint of ˜7500 deg2 for >85 per cent of the ROSAT and XMM-Newton Slew survey sources having optical counterparts in the magnitude range 17 < r < 22.5, producing a large and highly complete sample of bright X-ray-selected AGN suitable for statistical studies of AGN evolution and clustering.

  9. Radiative effects of clouds and cryosphere in the Antarctic

    Directory of Open Access Journals (Sweden)

    Takashi Yamanouchi

    1997-03-01

    Full Text Available Examination of the effects of clouds, ice sheet and sea ice on the radiation budget in the Antarctic using Earth Radiation Budget Experiment (ERBE data were reported. The continental ice sheet affects not only the albedo, but also the surface temperature because of elevation, and hence the OLR. Sea ice, which is a critical climate feedback factor, appears to have less impact on radiation than do clouds. However, these surfaces lie underneath clouds, and it was found that the independent effect of sea ice is as large as that of clouds, and clouds are masking the radiative effect of sea ice by more than half. The radiation budget at the top of the atmosphere from satellite observation and that at the surface from the surface radiation measurements at Syowa and South Pole Stations were compared. Cloud radiative forcing at both stations for the surface, atmosphere and top of the atmosphere was derived.

  10. Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

    NARCIS (Netherlands)

    Huijdlng, J; de Jong, PJ; Huijding, J.

    This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

  11. MIS 5e relative sea-level changes in the Mediterranean Sea: Contribution of isostatic disequilibrium

    Science.gov (United States)

    Stocchi, Paolo; Vacchi, Matteo; Lorscheid, Thomas; de Boer, Bas; Simms, Alexander R.; van de Wal, Roderik S. W.; Vermeersen, Bert L. A.; Pappalardo, Marta; Rovere, Alessio

    2018-04-01

    Sea-level indicators dated to the Last Interglacial, or Marine Isotope Stage (MIS) 5e, have a twofold value. First, they can be used to constrain the melting of Greenland and Antarctic Ice Sheets in response to global warming scenarios. Second, they can be used to calculate the vertical crustal rates at active margins. For both applications, the contribution of glacio- and hydro-isostatic adjustment (GIA) to vertical displacement of sea-level indicators must be calculated. In this paper, we re-assess MIS 5e sea-level indicators at 11 Mediterranean sites that have been generally considered tectonically stable or affected by mild tectonics. These are found within a range of elevations of 2-10 m above modern mean sea level. Four sites are characterized by two separate sea-level stands, which suggest a two-step sea-level highstand during MIS 5e. Comparing field data with numerical modeling we show that (i) GIA is an important contributor to the spatial and temporal variability of the sea-level highstand during MIS 5e, (ii) the isostatic imbalance from the melting of the MIS 6 ice sheet can produce a >2.0 m sea-level highstand, and (iii) a two-step melting phase for the Greenland and Antarctic Ice Sheets reduces the differences between observations and predictions. Our results show that assumptions of tectonic stability on the basis of the MIS 5e records carry intrinsically large uncertainties, stemming either from uncertainties in field data and GIA models. The latter are propagated to either Holocene or Pleistocene sea-level reconstructions if tectonic rates are considered linear through time.

  12. Treatment and prevention of infection following bites of the Antarctic fur seal (Arctocephalus gazella

    Directory of Open Access Journals (Sweden)

    Kouliev T

    2015-04-01

    Full Text Available Timur Kouliev,1 Victoria Cui2 1Beijing United Family Hospital, Beijing, People's Republic of China; 2Department of Biological Sciences, Columbia University, New York, NY, USA Abstract: In recent decades, an increasing number of people have traveled to sub-Antarctic and Antarctic regions each year for research, tourism, and resource exploitation. Hunting of Antarctic fur seals (Arctocephalus gazella almost pushed the species to extinction in the early 1900s, but populations have since shown rapid and substantial recovery. The species' range has re-expanded to include several islands south of the Antarctic Convergence, most notably South Georgia, and now overlaps with many popular Antarctic travel destinations. Both male and female fur seals can become extremely aggressive when provoked, and their bites, if not properly treated, pose a significant risk of infection by microorganisms not usually encountered in cases of animal bites. In this report, we present the case of a patient treated for a fur seal bite during an Antarctic expedition cruise, review the literature concerning seal bites, and suggest the use of antibiotic prophylaxis to prevent complications. Keywords: zoonotic, polar tourism, prophylaxis, seal finger, expedition medicine

  13. A Roadmap for Antarctic and Southern Ocean Science for the Next Two Decades and Beyond

    Science.gov (United States)

    Kennicutt, M. C., II

    2015-12-01

    Abstract: Antarctic and Southern Ocean science is vital to understanding natural variability, the processes that govern global change and the role of humans in the Earth and climate system. The potential for new knowledge to be gained from future Antarctic science is substantial. Therefore, the international Antarctic community came together to 'scan the horizon' to identify the highest priority scientific questions that researchers should aspire to answer in the next two decades and beyond. Wide consultation was a fundamental principle for the development of a collective, international view of the most important future directions in Antarctic science. From the many possibilities, the horizon scan identified 80 key scientific questions through structured debate, discussion, revision and voting. Questions were clustered into seven topics: i) Antarctic atmosphere and global connections, ii) Southern Ocean and sea ice in a warming world, iii) ice sheet and sea level, iv) the dynamic Earth, v) life on the precipice, vi) near-Earth space and beyond, and vii) human presence in Antarctica. Answering the questions identified by the horizon scan will require innovative experimental designs, novel applications of technology, invention of next-generation field and laboratory approaches, and expanded observing systems and networks. Unbiased, non-contaminating procedures will be required to retrieve the requisite air, biota, sediment, rock, ice and water samples. Sustained year-round access to Antarctica and the Southern Ocean will be essential to increase winter-time measurements. Improved models are needed that represent Antarctica and the Southern Ocean in the Earth System, and provide predictions at spatial and temporal resolutions useful for decision making. A co-ordinated portfolio of cross-disciplinary science, based on new models of international collaboration, will be essential as no scientist, programme or nation can realize these aspirations alone.

  14. Glycosides from the sea cucumber Cucumaria frondosa. IV. Structure of frondosides A{sub 2}-4, A{sub 2}-7, and A{sub 2}-8, three new minor monosulfated triterpene glycosides

    Energy Technology Data Exchange (ETDEWEB)

    Silchenko, A.S.; Avilov, S.A.; Antonov, A.S.; Kalinovsky, A.I.; Dmitrenok, P.S.; Kalinin, V.I. [Pacific Inst. of Bioorganic Chemistry, Far East Div. of the Russian Academy of Sciences, Vladivostok (Russian Federation)], E-mail: kalininv@piboc.dvo.ru; Woodward, C.; Collin, P.D. [Coastside Bio Resources Inc., Stonington, Maine (United States)

    2005-12-15

    Frondosides A{sub 2}-4, A{sub 2}-7, and A{sub 2}-8 are new monosulfated triterpene glycosides isolated from the sea cucumber Cucumaria frondosa. Their structures have been elucidated on the basis of spectral data (2D NMR and MS). Frondosides A{sub 2}-7 and A{sub 2}-8 are isomers and differ from each other only by the position of a double bond in their non-holostane-type aglycones. (author)

  15. The Antarctic - the wild card in the global climate

    International Nuclear Information System (INIS)

    Oesterhus, Svein; Gammelsroed, Tor; Foldvik, Arne; Noest, Ole Anders

    1999-01-01

    The overview gives an account of studies of snowfall, ice melting and formation and water flow patterns in the Antarctic during the present global warming period. It also gives a survey of the ice area in the region. The sea water warming is dramatic and a large floating glacier seems to be decomposing which is disrupting the oceanographic and ecological relations in the region and globally and is significantly influencing the global climate

  16. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  17. [Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

    Science.gov (United States)

    Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

    1992-07-25

    We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

  18. Second-order nonlinear optical microscopy of spider silk

    Science.gov (United States)

    Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

    2017-06-01

    Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

  19. Anti-inflammatory activity in selected Antarctic benthic organisms

    Directory of Open Access Journals (Sweden)

    Juan eMoles

    2014-07-01

    Full Text Available Antarctic benthos was prospected in search for anti-inflammatory activity in polar benthic invertebrates, in two different geographical areas: deep-bottoms of the Eastern Weddell Sea and shallow-waters of the South Shetland Islands. A total of 36 benthic algae and invertebrate species were selected to perform solubility tests in order to test them for anti-inflammatory activity. From these, ethanol extracts of ten species from five different phyla resulted suitable to be studied in cell macrophage cultures (RAW 264.7. Cytotoxicity (MTT method and production of inflammatory mediators (prostaglandin E2, leukotriene B4, interleukin-1 were determined at three extract concentrations (50, 125, 250 g/mL. Bioassays resulted in four different species showing anti-inflammatory activity corresponding to three sponges: Mycale (Oxymycale acerata, Isodictya erinacea, and I. toxophila; and one hemichordate: Cephalodiscus sp. These results show that Antarctic sessile invertebrates may have great value as a source of lead compounds with potential pharmaceutical applications.

  20. Holocene sea level, a semi-empirical contemplation

    Science.gov (United States)

    Bittermann, K.; Kemp, A.; Vermeer, M.; Rahmstorf, S.

    2017-12-01

    Holocene eustatic sea level from approximately -10,000-1800 CE was characterized by an increase of about 60m, with the rate progressively slowing down until sea level almost stabilizes between 500-1800 CE. Global and northern-hemisphere temperatures rose from the last glacial termination until the `Holocene Optimum'. From ­­there, up to the start of the recent anthropogenic rise, they almost steadily decline. How are the sea-level and temperature evolutions linked? We investigate this with semi-empirical sea-level models. We found that, due to the nature of Milankovitch forcing, northern-hemisphere temperature (we used the Greenland temperature by Vinther et al., 2009) is a better model driver than global mean temperature because the evolving mass of northern-hemisphere land ice was the dominant cause of Holocene global sea-level trends. The adjustment timescale for this contribution is 1200 years (900-1500 years; 90% confidence interval). To fit the observed sea-level history, the model requires a small additional constant rate (Bittermann 2016). This rate turns out to be of the same order of magnitude as reconstructions of Antarctic sea-level contributions (Briggs et al. 2014, Golledge et al. 2014). In reality this contribution is unlikely to be constant but rather has a dominant timescale that is large compared to the time considered. We thus propose that Holocene sea level can be described by a linear combination of a temperature driven rate, which becomes negative in the late Holocene (as Northern Hemisphere ice masses are diminished), and a positive, approximately constant term (possibly from Antarctica), which starts to dominate from the middle of the Holocene until the start of industrialization. Bibliography: Bittermann, K. 2016. Semi-empirical sea-level modelling. PhD Thesis University of Potsdam. Briggs, R.D., et al. 2014. A data-constrained large ensemble analysis of Antarctic evolution since the Eemian. Quaternary science reviews, 103, 91

  1. Modeling sub-sea permafrost in the East Siberian Arctic Shelf: the Dmitry Laptev Strait

    International Nuclear Information System (INIS)

    Nicolsky, D; Shakhova, N

    2010-01-01

    The present state of sub-sea permafrost modeling does not agree with certain observational data on the permafrost state within the East Siberian Arctic Shelf. This suggests a need to consider other mechanisms of permafrost destabilization after the recent ocean transgression. We propose development of open taliks wherever thaw lakes and river paleo-valleys were submerged shelf-wide as a possible mechanism for the degradation of sub-sea permafrost. To test the hypothesis we performed numerical modeling of permafrost dynamics in the Dmitry Laptev Strait area. We achieved sufficient agreement with the observed distribution of thawed and frozen layers to suggest that the proposed mechanism of permafrost destabilization is plausible.

  2. Manufacturing of the full size prototype of the ion source for the ITER neutral beam injector – The SPIDER beam source

    Energy Technology Data Exchange (ETDEWEB)

    Pavei, Mauro, E-mail: mauro.pavei@igi.cnr.it [Consorzio RFX, C.so Stati Uniti 4, I-35127, Padova (Italy); Boilson, Deirdre [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Bonicelli, Tullio [Fusion for Energy, C/Joseph Pla 2, 08019 Barcelona (Spain); Boury, Jacques [Thales Electron Devices, Velizy Villacoublay (France); Bush, Michael [Galvano-T GmbH, T, Raiffeisenstraße 8, 51570 Windeck (Germany); Ceracchi, Andrea; Faso, Diego [CECOM S.r.l., Via Tiburtina – Guidonia Montecelio, Roma (Italy); Graceffa, Joseph [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Heinemann, Bernd [Max-Planck-Institut für Plasmaphysik, D-85740 Garching (Germany); Hemsworth, Ronald [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Lievin, Christophe [Thales Electron Devices, Velizy Villacoublay (France); Marcuzzi, Diego [Consorzio RFX, C.so Stati Uniti 4, I-35127, Padova (Italy); Masiello, Antonio [Fusion for Energy, C/Joseph Pla 2, 08019 Barcelona (Spain); Sczepaniak, Bernd [Galvano-T GmbH, T, Raiffeisenstraße 8, 51570 Windeck (Germany); Singh, Mahendrajit [ITER Organization, Route de Vinon-sur-Verdon, CS 90 046, 13067 St. Paul Lez Durance Cedex (France); Toigo, Vanni; Zaccaria, Pierluigi [Consorzio RFX, C.so Stati Uniti 4, I-35127, Padova (Italy)

    2015-10-15

    Highlights: • Negative ion sources are key components of neutral beam injectors for nuclear fusion. • The SPIDER experiment aims to optimize the negative ion source of MITICA and HNB. • The SPIDER Beam Source manufacturing is currently on-going. • Manufacturing and assembling technological issues encountered are presented. - Abstract: In ITER, each heating neutral beam injector (HNB) will deliver about 16.5 MW heating power by accelerating a 40 A deuterium negative ion beam up to the energy of 1 MeV. The ions are generated inside a caesiated negative ion source, where the injected H{sub 2}/D{sub 2} is ionized by a radio frequency electromagnetic field. The SPIDER test bed, currently being manufactured, is going to be the ion source test facility for the full size ion source of the HNBs and of the diagnostic neutral beam injector of ITER. The SPIDER beam source comprises an ion source with 8 radio-frequency drivers and a three-grid system, providing an overall acceleration up to energies of about 100 keV [1]. SPIDER represents a substantial step forward between the half ITER size ion source, which is currently being tested at the ELISE test bed in IPP-Garching, and the negative ion sources to be used on ITER, in terms of layout, dimensions and operating parameters. The SPIDER beam source will be housed inside a vacuum vessel which will be equipped with a beam dump and a graphite diagnostic calorimeter. The manufacturing design of the main parts of the SPIDER beam source has been completed and many of the tests on the prototypes have been successfully passed. The most complex parts, from the manufacturing point of view, of the ion source and the accelerator, developed by galvanic deposition of copper are being manufactured. The manufacturing phase will be completed within 2015, when the assembly of the device will start at the PRIMA site, in Padova (I). The paper describes the status of the procurement, the adaptations operated on the design of the beam

  3. Sea Ice Edge Location and Extent in the Russian Arctic, 1933-2006

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Sea Ice Edge Location and Extent in the Russian Arctic, 1933-2006 data are derived from sea ice charts from the Arctic and Antarctic Research Institute (AARI),...

  4. Installation of deep water sub-sea equipment

    Energy Technology Data Exchange (ETDEWEB)

    Pollack, Jack; Demian, Nabil [SBM-IMODCO Inc., Houston, TX (UNited States)

    2004-07-01

    Offshore oil developments are being planned in water depths exceeding 2000 m. Lowering and positioning large, heavy sub sea hardware, using conventional methods, presents new technical challenges in these ultra deep waters. In 3000 m a safe lift using conventional steel cables will require more capacity to support the cable self weight than the static payload. Adding dynamic loads caused by the motions of the surface vessel can quickly cause the safe capacity of the wire to be exceeded. Synthetic ropes now exist to greatly reduce the lowering line weight. The lower stiffness of these synthetic ropes aggravate the dynamic line tensions due to vessel motions and relatively little is known about the interaction of these ropes on the winches and sheaves required for pay-out and haul-in of these lines under dynamic load. Usage of conventional winches would damage the synthetic rope and risk the hardware being deployed. Reliable and economic installation systems that can operate from existing installation vessels are considered vital for ultra deep-water oil development. The paper describes a Deep Water Sub-Sea Hardware Deployment system consisting of a buoy with variable, pressure-balanced buoyancy, which is used to offset most of the payload weight as it is lowered. The buoyant capacity is controlled by air pumped into the tank from the surface vessel through a reinforced hose. The buoy and payload motion are isolated from the deployment line surface dynamics using a simple passive heave compensator mounted between the buoy and the bottom of the deployment rope. The system components, functionality and dynamic behavior are presented in the paper. (author)

  5. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  6. Sclerotherapy of Varicose Veins and Spider Veins

    Science.gov (United States)

    ... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

  7. Assassin bug uses aggressive mimicry to lure spider prey.

    Science.gov (United States)

    Wignall, Anne E; Taylor, Phillip W

    2011-05-07

    Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

  8. Do Climate Models Simulate the Right Sea Ice Trends for the Wrong Reasons?

    Science.gov (United States)

    Rosenblum, E. J.; Eisenman, I.

    2016-02-01

    Observations indicate that the Arctic sea ice cover is rapidly retreating while the Antarctic sea ice cover is steadily expanding. State-of-the-art climate models, by contrast, predict a moderate decrease in both the Arctic and Antarctic sea ice cover. A number of recent studies have attributed this discrepancy in each hemisphere to natural variability. Here we examine sea ice changes during 1979-2013 in simulations from the most recent Coupled Model Intercomparison Project as well as the Community Earth System Model Large Ensemble. We find that after accounting for biases in the level of global warming in each simulation, the possibility that natural variability alone could explain the difference between models and observations becomes exceedingly small. This suggests instead that there is a systematic bias in the climate models or possibly the observations.

  9. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.

    2017-11-28

    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  10. Peatland Ecosystem Processes in the Maritime Antarctic During Warm Climates.

    Science.gov (United States)

    Loisel, Julie; Yu, Zicheng; Beilman, David W; Kaiser, Karl; Parnikoza, Ivan

    2017-09-27

    We discovered a 50-cm-thick peat deposit near Cape Rasmussen (65.2°S), in the maritime Antarctic. To our knowledge, while aerobic 'moss banks' have often been examined, waterlogged 'peatlands' have never been described in this region before. The waterlogged system is approximately 100 m 2 , with a shallow water table. Surface vegetation is dominated by Warnstorfia fontinaliopsis, a wet-adapted moss commonly found in the Antarctic Peninsula. Peat inception was dated at 2750 cal. BP and was followed by relatively rapid peat accumulation (~0.1 cm/year) until 2150 cal. BP. Our multi-proxy analysis then shows a 2000-year-long stratigraphic hiatus as well as the recent resurgence of peat accumulation, sometime after 1950 AD. The existence of a thriving peatland at 2700-2150 cal. BP implies regionally warm summer conditions extending beyond the mid-Holocene; this finding is corroborated by many regional records showing moss bank initiation and decreased sea ice extent during this time period. Recent peatland recovery at the study site (maritime Antarctic region may promote a more peatland-rich landscape in the future.

  11. Wiring a Periscope – Ocelli, Retinula Axons, Visual Neuropils and the Ancestrality of Sea Spiders

    Science.gov (United States)

    Lehmann, Tobias; Heß, Martin; Melzer, Roland R.

    2012-01-01

    The Pycnogonida or sea spiders are cryptic, eight-legged arthropods with four median ocelli in a ‘periscope’ or eye tubercle. In older attempts at reconstructing phylogeny they were Arthropoda incertae sedis, but recent molecular trees placed them as the sister group either to all other euchelicerates or even to all euarthropods. Thus, pycnogonids are among the oldest extant arthropods and hold a key position for the understanding of arthropod evolution. This has stimulated studies of new sets of characters conductive to cladistic analyses, e.g. of the chelifores and of the hox gene expression pattern. In contrast knowledge of the architecture of the visual system is cursory. A few studies have analysed the ocelli and the uncommon “pseudoinverted” retinula cells. Moreover, analyses of visual neuropils are still at the stage of Hanström's early comprehensive works. We have therefore used various techniques to analyse the visual fibre pathways and the structure of their interrelated neuropils in several species. We found that pycnogonid ocelli are innervated to first and second visual neuropils in close vicinity to an unpaired midline neuropil, i.e. possibly the arcuate body, in a way very similar to ancestral euarthropods like Euperipatoides rowelli (Onychophora) and Limulus polyphemus (Xiphosura). This supports the ancestrality of pycnogonids and sheds light on what eyes in the pycnogonid ground plan might have ‘looked’ like. Recently it was suggested that arthropod eyes originated from simple ocelli similar to larval eyes. Hence, pycnogonid eyes would be one of the early offshoots among the wealth of more sophisticated arthropod eyes. PMID:22279594

  12. Particle flux on the continental shelf in the Amundsen Sea Polynya and Western Antarctic Peninsula

    Directory of Open Access Journals (Sweden)

    Hugh W. Ducklow

    2015-04-01

    Full Text Available Abstract We report results from a yearlong, moored sediment trap in the Amundsen Sea Polynya (ASP, the first such time series in this remote and productive ecosystem. Results are compared to a long-term (1992–2013 time series from the western Antarctic Peninsula (WAP. The ASP trap was deployed from December 2010 to December 2011 at 350 m depth. We observed two brief, but high flux events, peaking at 8 and 5 mmol C m−2 d−1 in January and December 2011, respectively, with a total annual capture of 315 mmol C m−2. Both peak fluxes and annual capture exceeded the comparable WAP observations. Like the overlying phytoplankton bloom observed during the cruise in the ASP (December 2010 to January 2011, particle flux was dominated by Phaeocystis antarctica, which produced phytodetrital aggregates. Particles at the start of the bloom were highly depleted in 13C, indicating their origin in the cold, CO2-rich winter waters exposed by retreating sea ice. As the bloom progressed, microscope visualization and stable isotopic composition provided evidence for an increasing contribution by zooplankton fecal material. Incubation experiments and zooplankton observations suggested that fecal pellet production likely contributed 10–40% of the total flux during the first flux event, and could be very high during episodic krill swarms. Independent estimates of export from the surface (100 m were about 5–10 times that captured in the trap at 350 m. Estimated bacterial respiration was sufficient to account for much of the decline in the flux between 50 and 350 m, whereas zooplankton respiration was much lower. The ASP system appears to export only a small fraction of its production deeper than 350 m within the polynya region. The export efficiency was comparable to other polar regions where phytoplankton blooms were not dominated by diatoms.

  13. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  14. Cuticular antifungals in spiders: density- and condition dependence.

    Science.gov (United States)

    González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

    2014-01-01

    Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  15. Different Oceanographic Regimes in the Vicinity of the Antarctic Peninsula Reflected in Benthic Nematode Communities.

    Directory of Open Access Journals (Sweden)

    Freija Hauquier

    Full Text Available Marine free-living nematode communities were studied at similar depths (~500 m at two sides of the Antarctic Peninsula, characterised by different environmental and oceanographic conditions. At the Weddell Sea side, benthic communities are influenced by cold deep-water formation and seasonal sea-ice conditions, whereas the Drake Passage side experiences milder oceanic conditions and strong dynamics of the Antarctic Circumpolar Current. This resulted in different surface primary productivity, which contrasted with observed benthic pigment patterns and varied according to the area studied: chlorophyll a concentrations (as a proxy for primary production were high in the Weddell Sea sediments, but low in the surface waters above; this pattern was reversed in the Drake Passage. Differences between areas were largely mirrored by the nematode communities: nematode densities peaked in Weddell stations and showed deeper vertical occurrence in the sediment, associated with deeper penetration of chlorophyll a and indicative of a strong bentho-pelagic coupling. Generic composition showed some similarities across both areas, though differences in the relative contribution of certain genera were noted, together with distinct community shifts with depth in the sediment at all locations.

  16. Field experiments on individual adaptation of the spider crab Inachus phalangium to its sea anemone host Anemonia viridis in the northern Adriatic Sea

    Directory of Open Access Journals (Sweden)

    S. LANDMANN

    2015-02-01

    Full Text Available We studied the adaptation of the spider crab Inachus phalangium (Fabricius, 1755 to one of its sea anemone host species, Anemonia viridis (Forsskål, 1775 in the coastal region of Rovinj, Croatia. Similar to other brachyuran species, Inachus spp. generally lives within the anemone to obtain protection from possible predators. Using removal and reintroduction experiments, this study investigates the protection mechanism and shows a loss of adaptation after a period of 10 days when the crabs are taken out of their host and kept solitary. Thirty-nine anemones from two different trial sites were marked individually and the inhabiting crabs were isolated to be released back into their individual hosts later. The reactions of the anemones were closely observed and characterized to determine the respective state of crab adaptation. As 35 out of 39 individuals provoked a defense /attack reaction of the anemone, it is concluded that the crabs possessed some sort of non-permanent protection mechanism that was lost during the test run (chi-square test, p < 0.00014. All tested crabs re-inhabited their host anemones within a maximum of 20 minutes after they had been reintroduced and stung by the anemones. Therefore, habituation to the host’s defense / attack mechanism is acquired individually and not genetically inherent to the species. The results are compared to adaptation and protection data on other decapod crustaceans and some anemonefishes.

  17. Brain systems underlying encounter expectancy bias in spider phobia.

    Science.gov (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

    2015-06-01

    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  18. Antarctic macrobenthic communities: A compilation of circumpolar information

    Directory of Open Access Journals (Sweden)

    Julian Gutt

    2013-02-01

    Full Text Available Comprehensive information on Antarctic macrobenthic community structure has been publicly available since the 1960s. It stems from trawl, dredge, grab, and corer samples as well as from direct and camera observations (Table 1–2. The quality of this information varies considerably; it consists of pure descriptions, figures for presence (absence and abundance of some key taxa or proxies for such parameters, e.g. sea-floor cover. Some data sets even cover a defined and complete proportion of the macrobenthos with further analyses on diversity and zoogeography. As a consequence the acquisition of data from approximately 90 different campaigns assembled here was not standardised. Nevertheless, it was possible to classify this broad variety of known macrobenthic assemblages to the best of expert knowledge (Gutt 2007; Fig. 1. This overview does not replace statistically sound community and diversity analyses. However, it shows from where which kind of information is available and it acts as an example of the feasibility and power of such data collections. The data set provides unique georeferenced biological basic information for the planning of future coordinated research activities, e.g. under the umbrella of the biology program “Antarctic Thresholds - Ecosystem Resilience and Adaptation” (AnT-ERA of the Scientific Committee on Antarctic Research (SCAR and especially for actual conservation issues, e.g. the planning of Marine Protected Areas (MPAs by the Commission for the Conservation of Antarctic Marine Living Resources (CCAMLR.

  19. Arctic Landfast Sea Ice 1953-1998, Version 1

    Data.gov (United States)

    National Aeronautics and Space Administration — The files in this data set contain landfast sea ice data (monthly means) gathered from both Russian Arctic and Antarctic Research Institute (AARI) and Canadian Ice...

  20. Accelerated warming of the Southern Ocean and its impacts on the hydrological cycle and sea ice.

    Science.gov (United States)

    Liu, Jiping; Curry, Judith A

    2010-08-24

    The observed sea surface temperature in the Southern Ocean shows a substantial warming trend for the second half of the 20th century. Associated with the warming, there has been an enhanced atmospheric hydrological cycle in the Southern Ocean that results in an increase of the Antarctic sea ice for the past three decades through the reduced upward ocean heat transport and increased snowfall. The simulated sea surface temperature variability from two global coupled climate models for the second half of the 20th century is dominated by natural internal variability associated with the Antarctic Oscillation, suggesting that the models' internal variability is too strong, leading to a response to anthropogenic forcing that is too weak. With increased loading of greenhouse gases in the atmosphere through the 21st century, the models show an accelerated warming in the Southern Ocean, and indicate that anthropogenic forcing exceeds natural internal variability. The increased heating from below (ocean) and above (atmosphere) and increased liquid precipitation associated with the enhanced hydrological cycle results in a projected decline of the Antarctic sea ice.

  1. Evidence from the Baltic Sea for an enhanced CO{sub 2} air-sea transfer velocity

    Energy Technology Data Exchange (ETDEWEB)

    Kuss, Joachim; Nagel, Klaus; Schneider, Bernd [Baltic Sea Research Institute, Warnemuende (Germany). Dept. of Marine Chemistry

    2004-04-01

    Surface water total CO{sub 2} concentrations (CT) and the CO{sub 2} partial pressure of the surface water and in the atmosphere were measured in the eastern Gotland Sea at approximately monthly intervals during five cruises in the winter of 1999/2000. Taking into account vertical/lateral exchange processes and the decomposition of organic matter, the monthly changes in CT were used to determine CO{sub 2} evasion fluxes. In addition, the CO{sub 2} fluxes were calculated on the basis of the CO{sub 2} partial pressure differences using local wind speed (u) records and different currently applied parametrizations of the gas exchange transfer velocity (k). The latter resulted in substantially lower monthly fluxes that indicated a considerable underestimation of k from the k(u) functions used. To achieve an optimal agreement between the flux calculations and the balance-derived CO{sub 2} fluxes, the coefficients of both a simple quadratic and cubic function k(u) were iterated using a least-squares fitting procedure. The resulting equations, which refer to short-term wind data and to the CO{sub 2} exchange at 20 deg C, were k= (0.45 {+-} 0.10)u{sup 2} and k(0.037 {+-} 0.008)u{sup 3} (k, cm/h; u, m/s) . These yielded higher k values than most of the previously proposed parametrizations. Unfortunately, our data did not allow us to decide whether the quadratic or cubic function is more appropriate to describe the gas exchange dynamics.

  2. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  3. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

  4. El Niño and the Antarctic During Recent Climatic Events

    Science.gov (United States)

    Kidwell, A. N.; Jo, Y. H.; Yan, X. H.

    2014-12-01

    The difference between eastern Pacific (EP) and central Pacific (CP) type El Niños has been noted in the tropical Pacific Ocean. During recent global warming hiatus, the Pacific Decadal Oscillations (PDO) switches to the negative phase while the CP El Niños occur more often than EP El Niños. The changes of El Niño type in conjunction with westward drift and increasing warm pool size shows an interesting multidecadal change in the warm pool (Kidwell et al, 2014). However, the effect of these variations in other regions is not fully explored. A comprehensive study of the El Niño /La Niña (EN/LN) events and their Antarctic teleconnections was conducted using multiple remote sensing and composite data sets. During the time period from April 2002-April 2011, the sea ice coverage, remotely sensed sea surface temperature (SST), outgoing longwave radiation (OLR) and continental water mass variations data were all collected and analyzed. The results show the different ways in which the variations in tropical SST and OLR associated with CP and EP El Niños cause regional changes in sea ice coverage around the continent of Antarctica as well as changes in continental water mass during six distinct El Niño events and three distinct La Niña events. The El Niño Southern Oscillation (ENSO) diversity and the Southern Ocean deep warming around the Antarctic during recent "Hiatus" will also be discussed.

  5. Thermohaline structure and water masses in the north of Antarctic Peninsula from data collected in situ by southern elephant seals (Mirounga leonina

    Directory of Open Access Journals (Sweden)

    Ilana E. K. C. Wainer

    2013-04-01

    Full Text Available The Western Antarctic Peninsula is rapidly warming and exhibits high indices of biodiversity concentrated mostly along its continental shelf. This region has great importance due to the the mixing caused by the interaction of waters from Weddell Sea (MW, Bransfield Strait (EB and the Antarctic Circumpolar Current (CCA transmits thermohaline characteristics and nutrients of different sites and finally connects with all the world’s oceans. However, studies focusing on the temporal variability of the region’s oceanographic conditions that finally determine the water mass formation are sparse due to the logistical difficulties of conducting oceanographic surveys and traditional monitoring during the winter. For this study, variations of the thermohaline structure and water masses in the vicinity and below the sea ice in the North of the Antarctic Peninsula (AP and Scotia Sea (SS were recorded between February and November 2008 by two female southern elephant seals (SES, Mirounga leonina tagged with Conductivity–Temperature–Depth/Satellite-Relay Data Logger (CTD–SRDL. One thousand three hundred and thirty vertical profiles of temperature and salinity were collected by seals which were tagged by the MEOP-BR Project team at the Elephant Island, South Shetlands. These profiles, together with spread state diagrams allowed the identification of water masses and their variances in the ocean’s vertical structure. Among the set of identified water masses we cite: Antarctic Surface Water (AASW, Winter Water (WW, Warm Deep Water (WDW, Modified Warm Deep Water (MWDW, Circumpolar Deep Water (CDW, Upper Circumpolar Deep Water (UCDW, Lower Circumpolar Deep Water (LCDW and Ice Shelf Water (ISW. Our results show that the oceanic vertical structure undergoes changes that cannot be traditionally monitored, particularly during the Austral winter and that SES are important and modern oceanographic data collection platforms allowing for the improvement of our

  6. Testing oils in antarctic soils

    International Nuclear Information System (INIS)

    Leufkens, D.

    2001-01-01

    The resident seals, whales and penguins in Antarctica's Ross Sea region have only environmentally friendly ways of getting around. In contrast, wherever humans go in the Antarctic and whatever they do, be it research, tourism or fishing, they need fuel for their planes, icebreaker ships, land vehicles and generators. Because of this, petroleum hydrocarbons are the most likely source of pollution in the Antarctic. Accidental oil spills often occur near scientific stations, where storage and refuelling of aircraft and vehicles can result in spills. Spills also occur as a consequence of drilling activities. Dr Jackie Aislabie, a microbiologist from the New Zealand government's research company Landcare Research, is leading a program aimed at understanding how oil spills impact on Antarctic soils. The properties of pristine soils were compared with oil-contaminated soil at three locations: Scott Base, Marble Point and in the Wright Valley at Bull Pass. Soils in the Scott Base area are impacted by the establishment and continuous habitation of the base over 40 years, and a hydrocarbon-contaminated site was sampled near a former storage area for drums of mixed oils. Soil sampled from Marble Point was taken from near the old Marble Point camp, which was inhabited from 1957 to about 1963. Oil stains were visible on the soil surface, and are assumed to have been there for more than 30 years. The samples selected for analysis from the Wright Valley came from a spill site near Bull Pass that occurred during seismic bore-hole drilling activities in 1985. The contamination levels ranged from below detection to just over 29,000 μg/g of soil. Descriptions and analyse results are included into a Geographic Information System and associated soils database

  7. Biased interpretation and memory in children with varying levels of spider fear.

    Science.gov (United States)

    Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

  8. Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

    Science.gov (United States)

    Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

    2010-01-01

    There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

  9. Geochemical nature of sub-ridge mantle and opening dynamics of the South China Sea

    Science.gov (United States)

    Zhang, Guo-Liang; Luo, Qing; Zhao, Jian; Jackson, Matthew G.; Guo, Li-Shuang; Zhong, Li-Feng

    2018-05-01

    The Indian-type mantle (i.e., above the north hemisphere reference line on the plot of 208Pb/204Pb vs. 206Pb/204Pb) has been considered as a "Southern Hemisphere" geochemical signature, whose origin remains enigmatic. The South China Sea is an extensional basin formed after rifting of the Euro-Asia continent in the Northern Hemisphere, however, the geochemical nature of the igneous crust remains unexplored. For the first time, IODP Expedition 349 has recovered seafloor basalts covered by the thick sediments in the Southwest sub-basin (Sites U1433 and U1434) and the East sub-basin (Site U1431). The Southwest sub-basin consists of enriched (E)-MORB type basalts, and the East sub-basin consists of both normal (N)-MORB-type and E-MORB-type basalts based on trace element compositions. The basalts of the two sub-basins are Indian-type MORBs based on Sr-Nd-Pb-Hf isotope compositions, and the Southwest sub-basin basalts show isotopic compositions (i.e., 206Pb/204Pb of 17.59-17.89) distinctly different from the East sub-basin (i.e., 206Pb/204Pb of 18.38-18.57), suggesting a sub-basin scale mantle compositional heterogeneity and different histories of mantle compositional evolution. Two different enriched mantle end-members (EM1 and EM2) are responsible for the genesis of the Indian-type mantle in the South China Sea. We have modeled the influences of Hainan mantle plume and lower continental crust based on Sr-Nd-Pb-Hf isotope compositions. The results indicate that the influence of Hainan plume can explain the elevated 206Pb/204Pb of the East sub-basin basalts, and the recycling of lower continental crust can explain the low 206Pb/204Pb of the Southwest sub-basin basalts. Based on the strong geochemical imprints of Hainan plume in the ridge magmatism, we propose that the Hainan plume might have promoted the opening of the South China Sea, during which the Hainan plume contributed enriched component to the sub-ridge mantle and caused thermal erosion and return of lower

  10. Antarctic Bottom Water temperature changes in the western South Atlantic from 1989 to 2014

    Science.gov (United States)

    Johnson, Gregory C.; McTaggart, Kristene E.; Wanninkhof, Rik

    2014-12-01

    Warming of abyssal waters in recent decades contributes to global heat uptake and sea level rise. Repeat oceanographic section data in the western South Atlantic taken mostly in 1989 (1995 across the Scotia Sea), 2005, and 2014 are used to quantify warming in abyssal waters that spread northward through the region from their Antarctic origins in the Weddell Sea. While much of the Scotia Sea warmed between 1995 and 2005, only the southernmost portion, on the north side of the Weddell Gyre, continued to warm between 2005 and 2014. The abyssal Argentine Basin also warmed between 1989 and 2005, but again only the southernmost portion continued to warm between 2005 and 2014, suggesting a slowdown in the inflow of the coldest, densest Antarctic Bottom Waters into the western South Atlantic between 1989 and 2014. In contrast, the abyssal waters of the Brazil Basin warmed both between 1989 and 2005 and between 2005 and 2014, at a rate of about 2 m°C yr-1. This warming is also assessed in terms of the rates of change of heights above the bottom for deep isotherms in each deep basin studied. These results, together with findings from previous studies, suggest the deep warming signal observed in the Weddell Sea after the mid-1970s Weddell Polynya was followed by abyssal warming in the Argentine Basin from the late 1970s through about 2005, then warming in the deep Vema Channel from about 1992 through at least 2010, and warming in the Brazil Basin from 1989 to 2014.

  11. Multi-year record of atmospheric mercury at Dumont d'Urville, East Antarctic coast: continental outflow and oceanic influences

    Directory of Open Access Journals (Sweden)

    H. Angot

    2016-07-01

    Full Text Available Under the framework of the Global Mercury Observation System (GMOS project, a 3.5-year record of atmospheric gaseous elemental mercury (Hg(0 has been gathered at Dumont d'Urville (DDU, 66°40′ S, 140°01′ E, 43 m above sea level on the East Antarctic coast. Additionally, surface snow samples were collected in February 2009 during a traverse between Concordia Station located on the East Antarctic plateau and DDU. The record of atmospheric Hg(0 at DDU reveals particularities that are not seen at other coastal sites: a gradual decrease of concentrations over the course of winter, and a daily maximum concentration around midday in summer. Additionally, total mercury concentrations in surface snow samples were particularly elevated near DDU (up to 194.4 ng L−1 as compared to measurements at other coastal Antarctic sites. These differences can be explained by the more frequent arrival of inland air masses at DDU than at other coastal sites. This confirms the influence of processes observed on the Antarctic plateau on the cycle of atmospheric mercury at a continental scale, especially in areas subject to recurrent katabatic winds. DDU is also influenced by oceanic air masses and our data suggest that the ocean plays a dual role on Hg(0 concentrations. The open ocean may represent a source of atmospheric Hg(0 in summer whereas the sea-ice surface may provide reactive halogens in spring that can oxidize Hg(0. This paper also discusses implications for coastal Antarctic ecosystems and for the cycle of atmospheric mercury in high southern latitudes.

  12. The Formation each Winter of the Circumpolar Wave in the Sea Ice around Antarctica

    Science.gov (United States)

    Gloersen, Per; White, Warren B.

    1999-01-01

    Seeking to improve upon the visualization of the Antarctic Circumpolar Wave (ACW) , we compare a 16-year sequence of 6-month winter averages of Antarctic sea ice extents and concentrations with those of adjacent sea surface temperatures (SSTs). Here we follow SSTs around the globe along the maximum sea ice edge rather than in a zonal band equatorward of it. The results are similar to the earlier ones, but the ACWs do not propagate with equal amplitude or speed. Additionally in a sequence of 4 polar stereographic plots of these SSTs and sea ice concentrations, we find a remarkable correlation between SST minima and sea ice concentration maxima, even to the extent of matching contours across the ice-sea boundary, in the sector between 900E and the Palmer Peninsula. Based on these observations, we suggest that the memory of the ACW in the sea ice is carried from one Austral winter to the next by the neighboring SSTS, since the sea ice is nearly absent in the Austral summer.

  13. Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

    Science.gov (United States)

    Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

    2003-12-01

    Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

  14. Deep-sea Hexactinellida (Porifera) of the Weddell Sea

    Science.gov (United States)

    Janussen, Dorte; Tabachnick, Konstantin R.; Tendal, Ole S.

    2004-07-01

    New Hexactinellida from the deep Weddel Sea are described. This moderately diverse hexactinellid fauna includes 14 species belonging to 12 genera, of which five species and one subgenus are new to science: Periphragella antarctica n. sp., Holascus pseudostellatus n. sp., Caulophacus (Caulophacus) discohexactinus n. sp., C. ( Caulodiscus) brandti n. sp., C. ( Oxydiscus) weddelli n. sp., and C. ( Oxydiscus) n. subgen. So far, 20 hexactinellid species have been reported from the deep Weddell Sea, 15 are known from the northern part and 10 only from here, while 10 came from the southern area, and five of these only from there. However, this apparent high "endemism" of Antarctic hexactinellid sponges is most likely the result of severe undersampling of the deep-sea fauna. We find no reason to believe that a division between an oceanic and a more continental group of species exists. The current poor database indicates that a substantial part of the deep hexactinellid fauna of the Weddell Sea is shared with other deep-sea regions, but it does not indicate a special biogeographic relationship with any other ocean.

  15. Spider foraging strategy affects trophic cascades under natural and drought conditions.

    Science.gov (United States)

    Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

    2015-07-23

    Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

  16. The soil and plant determinants of community structures of the dominant actinobacteria in Marion Island terrestrial habitats, Sub-Antarctica

    CSIR Research Space (South Africa)

    Sanyika, TW

    2012-08-01

    Full Text Available Marion Island is a Sub-Antarctic island made up of distinct ecological habitats based on soil physiochemical, plant cover and physical characteristics. The microbial diversity and ecological determinants in this harsh Sub-Antarctic environment...

  17. Natural and anthropogenic hydrocarbons in the Antarctic pack ice

    International Nuclear Information System (INIS)

    Nemirovskaya, I.A.; Novigatsky, A.N.

    2004-01-01

    A field experiment was conducted near the Russian Antarctic stations in May, 2001 in the Pridz Bay and coastal part of the Davies Sea to examine the content of dissolved and suspended forms of aliphatic hydrocarbons in melted snow samples, pack ice and ice cores. The site included clean control areas and polluted test areas. A spill was performed by covering the bare ice surface with marine diesel fuel. The different physical characteristics of clean and polluted ice were measured. This included radiation balance, reflected solar radiation, integral albedo radiation, surface temperature, seawater temperature, salinity at depth, and ice salinity. The study showed that accumulation of natural and anthropogenic hydrocarbon took place in the ice-water barrier zone, mostly in suspended form. It was concluded that for oil spills in pack Antarctic ice, the mechanism of filtration due to convection-diffusion plays an important role in the transformation of diesel fuel. 14 refs., 2 tabs., 2 figs

  18. Antarctic contribution to sea level rise observed by GRACE with improved GIA correction

    NARCIS (Netherlands)

    Ivins, E.R.; James, T.S.; Wahr, J.; Schrama, E.J.O.; Landerer, F.W.; Simon, K.M.

    2013-01-01

    Antarctic volume changes during the past 21 thousand years are smaller than previously thought, and here we construct an ice sheet history that drives a forward model prediction of the glacial isostatic adjustment (GIA) gravity signal. The new model, in turn, should give predictions that are

  19. The ocean's role in polar climate change: asymmetric Arctic and Antarctic responses to greenhouse gas and ozone forcing.

    Science.gov (United States)

    Marshall, John; Armour, Kyle C; Scott, Jeffery R; Kostov, Yavor; Hausmann, Ute; Ferreira, David; Shepherd, Theodore G; Bitz, Cecilia M

    2014-07-13

    In recent decades, the Arctic has been warming and sea ice disappearing. By contrast, the Southern Ocean around Antarctica has been (mainly) cooling and sea-ice extent growing. We argue here that interhemispheric asymmetries in the mean ocean circulation, with sinking in the northern North Atlantic and upwelling around Antarctica, strongly influence the sea-surface temperature (SST) response to anthropogenic greenhouse gas (GHG) forcing, accelerating warming in the Arctic while delaying it in the Antarctic. Furthermore, while the amplitude of GHG forcing has been similar at the poles, significant ozone depletion only occurs over Antarctica. We suggest that the initial response of SST around Antarctica to ozone depletion is one of cooling and only later adds to the GHG-induced warming trend as upwelling of sub-surface warm water associated with stronger surface westerlies impacts surface properties. We organize our discussion around 'climate response functions' (CRFs), i.e. the response of the climate to 'step' changes in anthropogenic forcing in which GHG and/or ozone-hole forcing is abruptly turned on and the transient response of the climate revealed and studied. Convolutions of known or postulated GHG and ozone-hole forcing functions with their respective CRFs then yield the transient forced SST response (implied by linear response theory), providing a context for discussion of the differing warming/cooling trends in the Arctic and Antarctic. We speculate that the period through which we are now passing may be one in which the delayed warming of SST associated with GHG forcing around Antarctica is largely cancelled by the cooling effects associated with the ozone hole. By mid-century, however, ozone-hole effects may instead be adding to GHG warming around Antarctica but with diminished amplitude as the ozone hole heals. The Arctic, meanwhile, responding to GHG forcing but in a manner amplified by ocean heat transport, may continue to warm at an accelerating rate.

  20. A glimpse beneath Antarctic sea ice: observation of platelet-layer thickness and ice-volume fraction with multi-frequency EM

    Science.gov (United States)

    Hendricks, S.; Hoppmann, M.; Hunkeler, P. A.; Kalscheuer, T.; Gerdes, R.

    2015-12-01

    In Antarctica, ice crystals (platelets) form and grow in supercooled waters below ice shelves. These platelets rise and accumulate beneath nearby sea ice to form a several meter thick sub-ice platelet layer. This special ice type is a unique habitat, influences sea-ice mass and energy balance, and its volume can be interpreted as an indicator for ice - ocean interactions. Although progress has been made in determining and understanding its spatio-temporal variability based on point measurements, an investigation of this phenomenon on a larger scale remains a challenge due to logistical constraints and a lack of suitable methodology. In the present study, we applied a lateral constrained Marquardt-Levenberg inversion to a unique multi-frequency electromagnetic (EM) induction sounding dataset obtained on the ice-shelf influenced fast-ice regime of Atka Bay, eastern Weddell Sea. We adapted the inversion algorithm to incorporate a sensor specific signal bias, and confirmed the reliability of the algorithm by performing a sensitivity study using synthetic data. We inverted the field data for sea-ice and sub-ice platelet-layer thickness and electrical conductivity, and calculated ice-volume fractions from platelet-layer conductivities using Archie's Law. The thickness results agreed well with drill-hole validation datasets within the uncertainty range, and the ice-volume fraction also yielded plausible results. Our findings imply that multi-frequency EM induction sounding is a suitable approach to efficiently map sea-ice and platelet-layer properties. However, we emphasize that the successful application of this technique requires a break with traditional EM sensor calibration strategies due to the need of absolute calibration with respect to a physical forward model.

  1. Peculiar torsion dynamical response of spider dragline silk

    Science.gov (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

    2017-07-01

    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  2. Antarctic climate and ice-sheet configuration during the early Pliocene interglacial at 4.23 Ma

    Science.gov (United States)

    Golledge, Nicholas R.; Thomas, Zoë A.; Levy, Richard H.; Gasson, Edward G. W.; Naish, Timothy R.; McKay, Robert M.; Kowalewski, Douglas E.; Fogwill, Christopher J.

    2017-07-01

    The geometry of Antarctic ice sheets during warm periods of the geological past is difficult to determine from geological evidence, but is important to know because such reconstructions enable a more complete understanding of how the ice-sheet system responds to changes in climate. Here we investigate how Antarctica evolved under orbital and greenhouse gas conditions representative of an interglacial in the early Pliocene at 4.23 Ma, when Southern Hemisphere insolation reached a maximum. Using offline-coupled climate and ice-sheet models, together with a new synthesis of high-latitude palaeoenvironmental proxy data to define a likely climate envelope, we simulate a range of ice-sheet geometries and calculate their likely contribution to sea level. In addition, we use these simulations to investigate the processes by which the West and East Antarctic ice sheets respond to environmental forcings and the timescales over which these behaviours manifest. We conclude that the Antarctic ice sheet contributed 8.6 ± 2.8 m to global sea level at this time, under an atmospheric CO2 concentration identical to present (400 ppm). Warmer-than-present ocean temperatures led to the collapse of West Antarctica over centuries, whereas higher air temperatures initiated surface melting in parts of East Antarctica that over one to two millennia led to lowering of the ice-sheet surface, flotation of grounded margins in some areas, and retreat of the ice sheet into the Wilkes Subglacial Basin. The results show that regional variations in climate, ice-sheet geometry, and topography produce long-term sea-level contributions that are non-linear with respect to the applied forcings, and which under certain conditions exhibit threshold behaviour associated with behavioural tipping points.

  3. Investigation of Arctic and Antarctic spatial and depth patterns of sea water in CTD profiles using chemometric data analysis

    DEFF Research Database (Denmark)

    Kotwa, Ewelina Katarzyna; Lacorte, Silvia; Duarte, Carlos

    2014-01-01

    In this paper we examine 2- and 3-way chemometric methods for analysis of Arctic and Antarctic water samples. Standard CTD (conductivity–temperature–depth) sensor devices were used during two oceanographic expeditions (July 2007 in the Arctic; February 2009 in the Antarctic) covering a total of 174...

  4. Plastic material investment in load-bearing silk attachments in spiders.

    Science.gov (United States)

    Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

    2018-05-17

    The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

  5. Impact of Greenland and Antarctic ice sheet interactions on climate sensitivity

    Energy Technology Data Exchange (ETDEWEB)

    Goelzer, H.; Huybrechts, P. [Vrije Universiteit Brussel, Earth System Sciences and Departement Geografie, Brussels (Belgium); Loutre, M.F.; Goosse, H.; Fichefet, T. [Universite Catholique de Louvain, Georges Lemaitre Centre for Earth and Climate Research (TECLIM), Earth and Life Institute, Louvain-la-Neuve (Belgium); Mouchet, A. [Universite de Liege, Laboratoire de Physique Atmospherique et Planetaire, Liege (Belgium)

    2011-09-15

    We use the Earth system model of intermediate complexity LOVECLIM to show the effect of coupling interactive ice sheets on the climate sensitivity of the model on a millennial time scale. We compare the response to a 2 x CO{sub 2} warming scenario between fully coupled model versions including interactive Greenland and Antarctic ice sheet models and model versions with fixed ice sheets. For this purpose an ensemble of different parameter sets have been defined for LOVECLIM, covering a wide range of the model's sensitivity to greenhouse warming, while still simulating the present-day climate and the climate evolution over the last millennium within observational uncertainties. Additional freshwater fluxes from the melting ice sheets have a mitigating effect on the model's temperature response, leading to generally lower climate sensitivities of the fully coupled model versions. The mitigation is effectuated by changes in heat exchange within the ocean and at the sea-air interface, driven by freshening of the surface ocean and amplified by sea-ice-related feedbacks. The strength of the effect depends on the response of the ice sheets to the warming and on the model's climate sensitivity itself. The effect is relatively strong in model versions with higher climate sensitivity due to the relatively large polar amplification of LOVECLIM. With the ensemble approach in this study we cover a wide range of possible model responses. (orig.)

  6. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

    Science.gov (United States)

    Vetter, Richard S; Rust, Michael K

    2010-06-01

    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  7. High School Students' Attitudes Towards Spiders: A cross-cultural comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

    2010-08-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

  8. Photoluminescent properties of spider silk coated with Eu-doped nanoceria

    International Nuclear Information System (INIS)

    Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

    2017-01-01

    Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

  9. Science 101: Why Don't Spiders Stick to Their Own Webs?

    Science.gov (United States)

    Robertson, Bill

    2011-01-01

    This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

  10. Salticid predation as one potential driving force of ant mimicry in jumping spiders

    Science.gov (United States)

    Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

    2011-01-01

    Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

  11. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2018-01-01

    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  12. The Antarctic-Magellan connection: macrobenthos ecology on the shelf and upper slope, a progress report

    Directory of Open Access Journals (Sweden)

    Wolf E. Arntz

    2005-12-01

    Full Text Available Ecological work carried out on the Antarctic and Magellan shelves since the first IBMANT conference held at the UMAG, Punta Arenas in 1997 is summarized to identify areas where progress has been made and others, where important gaps have remained in understanding past and present interaction between the Antarctic and the southern tip of South America. This information is complementary to a review on shallow-water work along the Scotia Arc (Barnes, 2005 and recent work done in the deep sea (Brandt and Hilbig, 2004. While principally referring to shipboard work in deeper water, above all during the recent international EASIZ and LAMPOS campaigns, relevant work from shore stations is also included. Six years after the first IBMANT symposium, significant progress has been made along the latitudinal gradient from the Magellan region to the high Antarctic in the fields of biodiversity, biogeography and community structure, life strategies and adaptations, the role of disturbance and its significance for biodiversity, and trophic coupling of the benthic realm with the water column and sea ice. A better understanding has developed of the role of evolutionary and ecological factors in shaping past and present-day environmental conditions, species composition and distribution, and ecosystem functioning. Furthermore, the science community engaged in unravelling Antarctic-Magellan interactions has advanced in methodological aspects such as new analytical approaches for comparing biodiversity derived from visual methods, growth and age determination, trophic modelling using stable isotope ratios, and molecular approaches for taxonomic and phylogenetic purposes. At the same time, much effort has been invested to complement the species inventory of the two adjacent regions. However, much work remains to be done to fill the numerous gaps. Some perspectives are outlined in this review, and suggestions are made where particular emphasis should be placed in future

  13. Silk Spinning in Silkworms and Spiders.

    Science.gov (United States)

    Andersson, Marlene; Johansson, Jan; Rising, Anna

    2016-08-09

    Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

  14. Long-term (1993-2013) changes in macrozooplankton off the Western Antarctic Peninsula

    Science.gov (United States)

    Steinberg, Deborah K.; Ruck, Kate E.; Gleiber, Miram R.; Garzio, Lori M.; Cope, Joseph S.; Bernard, Kim S.; Stammerjohn, Sharon E.; Schofield, Oscar M. E.; Quetin, Langdon B.; Ross, Robin M.

    2015-07-01

    The Western Antarctic Peninsula (WAP) is one of the most rapidly warming regions on Earth, and where a high apex predator biomass is supported in large part by macrozooplankton. We examined trends in summer (January-February) abundance of major taxa of macrozooplankton along the WAP over two decades (1993-2013) and their relationship with environmental parameters (sea ice, atmospheric climate indices, sea surface temperature, and phytoplankton biomass and productivity). Macrozooplankton were collected from the top 120 m of the water column in a mid-Peninsula study region divided into latitudinal (North, South, and Far South) and cross-shelf (coastal, shelf, slope) sub-regions. Trends for krill species included a 5-year cycle in abundance peaks (positive anomalies) for Euphausia superba, but no directional long-term trend, and an increase in Thysanoessa macrura in the North; variability in both species was strongly influenced by primary production 2-years prior. E. crystallorophias abundance was best explained by the Southern Annular Mode (SAM) and Multivariate El Niño Southern Oscillation Index (MEI), and was more abundant in higher ice conditions. The salp Salpa thompsoni and thecosome pteropod Limacina helicina cycled between negative and positive anomalies in the North, but showed increasing positive anomalies in the South over time. Variation in salp and pteropod abundance was best explained by SAM and the MEI, respectively, and both species were more abundant in lower ice conditions. There was a long-term increase in some carnivorous gelatinous zooplankton (polychaete worm Tomopteris spp.) and amphipods. Abundance of Pseudosagitta spp. chaetognaths was closely related to SAM, with higher abundance tied to lower ice conditions. Long-term changes and sub-decadal cycles of WAP macrozooplankton community composition may affect energy transfer to higher trophic levels, and alter biogeochemical cycling in this seasonally productive and sensitive polar ecosystem.

  15. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  16. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2015-12-01

    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  17. ADMAP-2: The second generation Antarctic crustal magnetic anomaly map.

    Science.gov (United States)

    Ferraccioli, F.; Golynsky, A.; Golynsky, D.; Young, D. A.; Eagles, G.; Damaske, D.; Finn, C.; Aitken, A.; von Frese, R. R. B.; Ghidella, M. E.; Kim, H. R.; Hong, J.

    2017-12-01

    ADMAP-2 is the second generation crustal magnetic anomaly compilation for the Antarctic region south of 60°S. It was produced from more than 3.5 million line-km of near-surface terrestrial, airborne and marine magnetic observations collected since the International Geophysical Year 1957/58 through 2013. The data were edited, IGRF corrected, profile levelled and gridded at a 1.5-km interval on a polar stereographic projection using the minimum curvature technique. Given the ubiquitous polar cover of snow, ice and sea water, the magnetic anomaly compilation offers important constraints on the global tectonic processes and crustal properties of the Antarctic. It also links widely separated areas of outcrop to help unify disparate geologic studies, and provides insights on the lithospheric transition between Antarctica and adjacent oceans, as well as the geodynamic evolution of the Antarctic lithosphere in the assembly and break-up of the Gondwana, Rodinia, and Columbia supercontinents and key piercing points for reconstructing linkages between the protocontinents. The magnetic data together with ice-probing radar and gravity information greatly facilitate understanding the evolution of fundamental large-scale geological processes such as continental rifting, intraplate mountain building, subduction and terrane accretion processes, and intraplate basin formation.

  18. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    OpenAIRE

    Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

    2018-01-01

    Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

  19. Spider diffraction: a comparison of curved and straight legs

    International Nuclear Information System (INIS)

    Richter, J.L.

    1984-01-01

    It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

  20. High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

    2010-01-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

  1. Spreading of Antarctic Bottom Water in the Atlantic Ocean

    OpenAIRE

    Morozov, E.; Tarakanov, R. Y.; Zenk, Walter

    2012-01-01

    This paper describes the transport of bottom water from its source region in the Weddell Sea through the abyssal channels of the Atlantic Ocean. The research brings together the recent observations and historical data. A strong flow of Antarctic Bottom Water through the Vema Channel is analyzed. The mean speed of the flow is 30 cm/s. A temperature increase was found in the deep Vema Channel, which has been observed for 30 years already. The flow of bottom water in the northern part of the Bra...

  2. The Antarctic Master Directory -- the Electronic Card Catalog of Antarctic Data

    Science.gov (United States)

    Scharfen, G.; Bauer, R.

    2003-12-01

    The Antarctic Master Directory (AMD) is a Web-based, searchable record of thousands of Antarctic data descriptions. These data descriptions contain information about what data were collected, where they were collected, when they were collected, who the scientists are, who the point of contact is, how to get the data, and information about the format of the data and what documentation and bibliographic information exists. With this basic descriptive information about content and access for thousands of Antarctic scientific data sets, the AMD is a resource for scientists to advertise the data they have collected and to search for data they need. The AMD has been created by more than twenty nations which conduct research in the Antarctic under the auspices of the Antarctic Treaty. It is a part of the International Directory Network/Global Change Master Directory (IDN/GCMD). Using the AMD is easy. Users can search on subject matter key words, data types, geographic place-names, temporal or spatial ranges, or conduct free-text searches. To search the AMD go to: http://gcmd.nasa.gov/Data/portals/amd/. Contributing your own data descriptions for Antarctic data that you have collected is also easy. Scientists can start by submitting a short data description first (as a placeholder in the AMD, and to satisfy National Science Foundation (NSF) reporting requirements), and then add to, modify or update their record whenever it is appropriate. An easy to use on-line tool and a simple tutorial are available at: http://nsidc.org/usadcc. With NSF Office of Polar Programs (OPP) funding, the National Snow and Ice Data Center (NSIDC) operates the U.S. Antarctic Data Coordination Center (USADCC), partly to assist scientists in using and contributing to the AMD. The USADCC website is at http://nsidc.org/usadcc.

  3. Changes in ice dynamics and mass balance of the Antarctic ice sheet.

    Science.gov (United States)

    Rignot, Eric

    2006-07-15

    The concept that the Antarctic ice sheet changes with eternal slowness has been challenged by recent observations from satellites. Pronounced regional warming in the Antarctic Peninsula triggered ice shelf collapse, which led to a 10-fold increase in glacier flow and rapid ice sheet retreat. This chain of events illustrated the vulnerability of ice shelves to climate warming and their buffering role on the mass balance of Antarctica. In West Antarctica, the Pine Island Bay sector is draining far more ice into the ocean than is stored upstream from snow accumulation. This sector could raise sea level by 1m and trigger widespread retreat of ice in West Antarctica. Pine Island Glacier accelerated 38% since 1975, and most of the speed up took place over the last decade. Its neighbour Thwaites Glacier is widening up and may double its width when its weakened eastern ice shelf breaks up. Widespread acceleration in this sector may be caused by glacier ungrounding from ice shelf melting by an ocean that has recently warmed by 0.3 degrees C. In contrast, glaciers buffered from oceanic change by large ice shelves have only small contributions to sea level. In East Antarctica, many glaciers are close to a state of mass balance, but sectors grounded well below sea level, such as Cook Ice Shelf, Ninnis/Mertz, Frost and Totten glaciers, are thinning and losing mass. Hence, East Antarctica is not immune to changes.

  4. Optically probing torsional superelasticity in spider silks

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

    2013-11-11

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

  5. Optically probing torsional superelasticity in spider silks

    International Nuclear Information System (INIS)

    Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

    2013-01-01

    We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

  6. New and interesting species of the genus Muelleria (Bacillariophyta) from the Antarctic region and South Africa

    Science.gov (United States)

    Van De Vijver, B.; Mataloni, G.; Stanish, L.; Spaulding, S.A.

    2010-01-01

    During a survey of the terrestrial diatom flora of some sub-Antarctic islands in the southern Indian and Atlantic Oceans and of the Antarctic continent, more than 15 taxa belonging to the genus Muelleria were observed. Nine of these taxa are described as new species using light and scanning electron microscopy. Comments are made on their systematic position and how they are distinguished from other species in the genus. Additionally, two previously unrecognized taxa within the genus were discovered in samples from South Africa. One of these, Muelleria taylorii Van de Vijver & Cocquyt sp. nov., is new to science; the other, Muelleria vandermerwei (Cholnoky) Van de Vijver & Cocquyt nov. comb., had been included in the genus Diploneis. The large number of new Muelleria taxa on the (sub)-Antarctic locations is not surprising. Species in Muelleria occur rarely in collections; in many habitats, it is unusual to find more than 1-2 valves in any slide preparation. As a result, records are scarce. The practice of "force-fitting" (shoehorning) specimens into descriptions from common taxonomic keys (and species drift) results in European species, such as M. gibbula and M. linearis, being applied to Antarctic forms in ecological studies. Finally, the typical terrestrial habitats of soils, mosses and ephemeral water bodies of most of these taxa have been poorly studied in the past.

  7. And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

    Science.gov (United States)

    LoBue, Vanessa

    2010-01-01

    Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

  8. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  9. Silk elasticity as a potential constraint on spider body size.

    Science.gov (United States)

    Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

    2010-10-07

    Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

  10. The multimillennial sea-level commitment of global warming.

    Science.gov (United States)

    Levermann, Anders; Clark, Peter U; Marzeion, Ben; Milne, Glenn A; Pollard, David; Radic, Valentina; Robinson, Alexander

    2013-08-20

    Global mean sea level has been steadily rising over the last century, is projected to increase by the end of this century, and will continue to rise beyond the year 2100 unless the current global mean temperature trend is reversed. Inertia in the climate and global carbon system, however, causes the global mean temperature to decline slowly even after greenhouse gas emissions have ceased, raising the question of how much sea-level commitment is expected for different levels of global mean temperature increase above preindustrial levels. Although sea-level rise over the last century has been dominated by ocean warming and loss of glaciers, the sensitivity suggested from records of past sea levels indicates important contributions should also be expected from the Greenland and Antarctic Ice Sheets. Uncertainties in the paleo-reconstructions, however, necessitate additional strategies to better constrain the sea-level commitment. Here we combine paleo-evidence with simulations from physical models to estimate the future sea-level commitment on a multimillennial time scale and compute associated regional sea-level patterns. Oceanic thermal expansion and the Antarctic Ice Sheet contribute quasi-linearly, with 0.4 m °C(-1) and 1.2 m °C(-1) of warming, respectively. The saturation of the contribution from glaciers is overcompensated by the nonlinear response of the Greenland Ice Sheet. As a consequence we are committed to a sea-level rise of approximately 2.3 m °C(-1) within the next 2,000 y. Considering the lifetime of anthropogenic greenhouse gases, this imposes the need for fundamental adaptation strategies on multicentennial time scales.

  11. Sea-ice dynamics strongly promote Snowball Earth initiation and destabilize tropical sea-ice margins

    Directory of Open Access Journals (Sweden)

    A. Voigt

    2012-12-01

    Full Text Available The Snowball Earth bifurcation, or runaway ice-albedo feedback, is defined for particular boundary conditions by a critical CO<sub>2sub> and a critical sea-ice cover (SI, both of which are essential for evaluating hypotheses related to Neoproterozoic glaciations. Previous work has shown that the Snowball Earth bifurcation, denoted as (CO<sub>2sub>, SI*, differs greatly among climate models. Here, we study the effect of bare sea-ice albedo, sea-ice dynamics and ocean heat transport on (CO<sub>2sub>, SI* in the atmosphere–ocean general circulation model ECHAM5/MPI-OM with Marinoan (~ 635 Ma continents and solar insolation (94% of modern. In its standard setup, ECHAM5/MPI-OM initiates a~Snowball Earth much more easily than other climate models at (CO<sub>2sub>, SI* ≈ (500 ppm, 55%. Replacing the model's standard bare sea-ice albedo of 0.75 by a much lower value of 0.45, we find (CO<sub>2sub>, SI* ≈ (204 ppm, 70%. This is consistent with previous work and results from net evaporation and local melting near the sea-ice margin. When we additionally disable sea-ice dynamics, we find that the Snowball Earth bifurcation can be pushed even closer to the equator and occurs at a hundred times lower CO<sub>2sub>: (CO<sub>2sub>, SI* ≈ (2 ppm, 85%. Therefore, the simulation of sea-ice dynamics in ECHAM5/MPI-OM is a dominant determinant of its high critical CO<sub>2sub> for Snowball initiation relative to other models. Ocean heat transport has no effect on the critical sea-ice cover and only slightly decreases the critical CO<sub>2sub>. For disabled sea-ice dynamics, the state with 85% sea-ice cover is stabilized by the Jormungand mechanism and shares characteristics with the Jormungand climate states. However, there is no indication of the Jormungand bifurcation and hysteresis in ECHAM5/MPI-OM. The state with 85% sea-ice cover therefore is a soft Snowball state rather than a true

  12. Herbivory in spiders: the importance of pollen for orb-weavers.

    Science.gov (United States)

    Eggs, Benjamin; Sanders, Dirk

    2013-01-01

    Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.

  13. Antarctic station life: The first 15 years of mixed expeditions to the Antarctic

    Science.gov (United States)

    Sarris, Aspa

    2017-02-01

    This study examined the experiences of women who lived and worked on remote and isolated Antarctic stations for up to 15 months at a time. The study employed purposeful sampling and a longitudinal - processual approach to study women's experiences over the first 15 years of mixed gender Antarctic expeditions. The retrospective analysis was based on a semi-structured interview administered to 14 women upon their return to Australia. The results showed that women referred to the natural physical Antarctic environment as one of the best aspects of their experience and the reason they would recommend the Antarctic to their friends as a good place to work. In describing the worst aspect of their experience, women referred to aspects of Antarctic station life, including: (i) the male dominated nature of station culture; (ii) the impact of interpersonal conflict, including gender based conflict and friction between scientists and trades workers; and (iii) the lack of anonymity associated with living and working with the same group of individuals, mainly men, for up to 12 months or more. The results are discussed within the context of the evolution of Antarctic station culture and recommendations are made in terms of the demography of expeditions, expeditioner selection and recruitment and the ongoing monitoring of Antarctic station culture. The study presents a framework that can be applied to groups and teams living and working in analogous isolated, confined and extreme work environments, including outer space missions.

  14. Sub-Antarctic marine aerosol: dominant contributions from biogenic sources

    Directory of Open Access Journals (Sweden)

    J. Schmale

    2013-09-01

    Full Text Available Biogenic influences on the composition and characteristics of aerosol were investigated on Bird Island (54°00' S, 38°03' W in the South Atlantic during November and December 2010. This remote marine environment is characterised by large seabird and seal colonies. The chemical composition of the submicron particles, measured by an aerosol mass spectrometer (AMS, was 21% non-sea-salt sulfate, 2% nitrate, 8% ammonium, 22% organics and 47% sea salt including sea salt sulfate. A new method to isolate the sea spray signature from the high-resolution AMS data was applied. Generally, the aerosol was found to be less acidic than in other marine environments due to the high availability of ammonia, from local fauna emissions. By positive matrix factorisation five different organic aerosol (OA profiles could be isolated: an amino acid/amine factor (AA-OA, 18% of OA mass, a methanesulfonic acid OA factor (MSA-OA, 25%, a marine oxygenated OA factor (M-OOA, 41%, a sea spray OA fraction (SS-OA, 7% and locally produced hydrocarbon-like OA (HOA, 9%. The AA-OA was dominant during the first two weeks of November and found to be related with the hatching of penguins in a nearby colony. This factor, rich in nitrogen (N : C ratio = 0.13, has implications for the biogeochemical cycling of nitrogen in the area as particulate matter is often transported over longer distances than gaseous N-rich compounds. The MSA-OA was mainly transported from more southerly latitudes where phytoplankton bloomed. The bloom was identified as one of three sources for particulate sulfate on Bird Island, next to sea salt sulfate and sulfate transported from South America. M-OOA was the dominant organic factor and found to be similar to marine OA observed at Mace Head, Ireland. An additional OA factor highly correlated with sea spray aerosol was identified (SS-OA. However, based on the available data the type of mixture, internal or external, could not be determined. Potassium was not

  15. Evolution in the deep sea: biological traits, ecology and phylogenetics of pelagic copepods.

    Science.gov (United States)

    Laakmann, Silke; Auel, Holger; Kochzius, Marc

    2012-11-01

    Deep-sea biodiversity has received increasing interest in the last decade, mainly focusing on benthic communities. In contrast, studies of zooplankton in the meso- to bathypelagic zones are relatively scarce. In order to explore evolutionary processes in the pelagic deep sea, the present study focuses on copepods of two clausocalanoid families, Euchaetidae and Aetideidae, which are abundant and species-rich in the deep-sea pelagic realm. Molecular phylogenies based on concatenated-portioned data on 18S, 28S and internal transcribed spacer 2 (ITS2), as well as mitochondrial cytochrome c oxidase subunit I (COI), were examined on 13 species, mainly from Arctic and Antarctic regions, together with species-specific biological traits (i.e. vertical occurrence, feeding behaviour, dietary preferences, energy storage, and reproductive strategy). Relationships were resolved on genus, species and even sub-species levels, the latter two established by COI with maximum average genetic distances ranging from ≤5.3% at the intra-specific, and 20.6% at the inter-specific level. There is no resolution at a family level, emphasising the state of Euchaetidae and Aetideidae as sister families and suggesting a fast radiation of these lineages, a hypothesis which is further supported by biological parameters. Euchaetidae were similar in lipid-specific energy storage, reproductive strategy, as well as feeding behaviour and dietary preference. In contrast, Aetideidae were more diverse, comprising a variety of characteristics ranging from similar adaptations within Paraeuchaeta, to genera consisting of species with completely different reproductive and feeding ecologies. Reproductive strategies were generally similar within each aetideid genus, but differed between genera. Closely related species (congeners), which were similar in the aforementioned biological and ecological traits, generally occurred in different depth layers, suggesting that vertical partitioning of the water column

  16. Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

    Science.gov (United States)

    Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

    2017-08-01

    Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

  17. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris

    2009-01-01

    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  18. Coagulopathy after spider bites in a six-year-old boy

    Directory of Open Access Journals (Sweden)

    Ansari SH.

    2008-06-01

    Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

  19. Glacial removal of late Cenozoic subglacially emplaced volcanic edifices by the West Antarctic ice sheet

    Science.gov (United States)

    Behrendt, John C.; Blankenship, D.D.; Damaske, D.; Cooper, A. K.

    1995-01-01

    Local maxima of the horizontal gradient of pseudogravity from closely spaced aeromagnetic surveys over the Ross Sea, northwestern Ross Ice Shelf, and the West Antarctic ice sheet, reveal a linear magnetic rift fabric and numerous subcircular, high-amplitude anomalies. Geophysical data indicate two or three youthful volcanic edifices at widely separated areas beneath the sea and ice cover in the West Antarctic rift system. In contrast, we suggest glacial removal of edifices of volcanic sources of many more anomalies. Magnetic models, controlled by marine seismic reflection and radar ice-sounding data, allow us to infer that glacial removal of the associated late Cenozoic volcanic edifices (probably debris, comprising pillow breccias, and hyaloclastites) has occurred essentially concomitantly with their subglacial eruption. "Removal' of unconsolidated volcanic debris erupted beneath the ice is probably a more appropriate term than "erosion', given its fragmented, ice-contact origin. The exposed volcanoes may have been protected from erosion by the surrounding ice sheet because of more competent rock or high elevation above the ice sheet. -from Authors

  20. Camel spider (Solifugae) use of prairie dog colonies

    Science.gov (United States)

    Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

  1. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  2. Arachnid aloft: directed aerial descent in neotropical canopy spiders.

    Science.gov (United States)

    Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

    2015-09-06

    The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

  3. Spider silk reinforced by graphene or carbon nanotubes

    Science.gov (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2017-09-01

    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  4. First High-Resolution Record of Late Quaternary Environmental Changes in the Amundsen Sea, West Antarctica, Revealed by Multi-proxy Analysis of Drift Sediments

    Science.gov (United States)

    Horrocks, J.; Ó Cofaigh, C.; Lloyd, J. M.; Hillenbrand, C. D.; Kuhn, G.; Smith, J.; Ehrmann, W. U.; Esper, O.

    2015-12-01

    The Amundsen Sea sector of the West Antarctic Ice Sheet (WAIS) is experiencing rapid mass loss and there is a pressing need to place the contemporary ice-sheet changes into a longer term context. The continental rise in this region is characterised by large sediment mounds that are shaped by westward flowing bottom currents and that resemble contouritic drifts existing offshore from the Antarctic Peninsula. Similar to the Antarctic Peninsula drifts, marine sediment cores from the poorly studied sediment mounds in the Amundsen Sea have the potential to provide reliable records of dynamical ice-sheet behaviour in West Antarctica and palaeoceanographic changes in the Southern Ocean during the Late Quaternary that can be reconstructed from their terrestrial, biogenic and authigenic components. Here we use multi-proxy data from three sediment cores recovered from two of the Amundsen Sea mounds to present the first high-resolution study of environmental changes on this part of the West Antarctic continental margin over the glacial-interglacial cycles of the Late Quaternary. Age constraints for the records are derived from biostratigraphy, AMS 14C dates and lithostratigraphy. We focus on the investigation of processes for drift formation, thereby using grain size and sortable silt data to reconstruct changes in bottom current speed and to identify episodes of current winnowing. Data on geochemical and mineralogical sediment composition and physical properties are used to infer both changes in terrigenous sediment supply in response to the advance and retreat of the WAIS across the Amundsen Sea shelf and changes in biological productivity that are mainly controlled by the duration of annual sea-ice coverage. We compare our data sets from the Amundsen Sea mounds to those from the well-studied Antarctic Peninsula drifts, thereby highlighting similarities and discrepancies in depositional processes and climatically-driven environmental changes.

  5. Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

    Science.gov (United States)

    Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

    2015-08-01

    An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

  6. Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

    Science.gov (United States)

    Langeslag, Sandra J E; van Strien, Jan W

    2018-05-30

    Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

  7. Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

    Science.gov (United States)

    Shao, Lili; Li, Shuqiang

    2018-05-24

    The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

  8. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-04

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  10. Invited review current progress and limitations of spider silk for biomedical applications.

    Science.gov (United States)

    Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

    2012-06-01

    Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

  11. Online estimation of wax deposition thickness in single-phase sub-sea pipelines based on acoustic chemometrics: A feasibility study

    OpenAIRE

    Halstensen, Maths; Arvoh, Benjamin Kaku; Amundsen, Lene; Hoffmann, Rainer

    2012-01-01

    Wax deposition in sub-sea oil producing pipelines is a concern to the oil producing companies. The deposition of wax in pipelines can cause serious economic implications if not monitored and controlled. Several researchers have developed models and investigated the deposition of wax in crude oil pipelines. As of today, there is no off the shelf instrument available for reliable online estimation of the wax depo- sition thickness in sub-sea pipelines. Acoustic chemometrics was applied to inves...

  12. Satellite gravimetry observation of Antarctic snow accumulation related to ENSO

    OpenAIRE

    Ingo Sasgen; Henryk Dobslaw; Z. Martinec; Maik Thomas

    2010-01-01

    Interannual ice-mass variations along the Antarctic Peninsula (AP) and in the Amundsen Sea Sector (AS) are obtained for the years 2002 until 2009 using satellite data of the Gravity Recovery and Climate Experiment, that correlate well (r ≈ 0.7) with accumulation variations based on the net precipitation from the European Centre for Medium Range Weather Forecasts. Moreover, mass signals for AP and AS are anti-correlated in time (r ≈ − 0.4) and contain El Niño Southern Oscillation signatures re...

  13. Determination of PCDDs in spider webs: preliminary studies

    Science.gov (United States)

    Rybak, Justyna; Rutkowski, Radosław

    2018-01-01

    The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  14. Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

    Science.gov (United States)

    Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

    2013-02-01

    Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

  15. Atmospheric and oceanic impacts of Antarctic glaciation across the Eocene-Oligocene transition.

    Science.gov (United States)

    Kennedy, A T; Farnsworth, A; Lunt, D J; Lear, C H; Markwick, P J

    2015-11-13

    The glaciation of Antarctica at the Eocene-Oligocene transition (approx. 34 million years ago) was a major shift in the Earth's climate system, but the mechanisms that caused the glaciation, and its effects, remain highly debated. A number of recent studies have used coupled atmosphere-ocean climate models to assess the climatic effects of Antarctic glacial inception, with often contrasting results. Here, using the HadCM3L model, we show that the global atmosphere and ocean response to growth of the Antarctic ice sheet is sensitive to subtle variations in palaeogeography, using two reconstructions representing Eocene and Oligocene geological stages. The earlier stage (Eocene; Priabonian), which has a relatively constricted Tasman Seaway, shows a major increase in sea surface temperature over the Pacific sector of the Southern Ocean in response to the ice sheet. This response does not occur for the later stage (Oligocene; Rupelian), which has a more open Tasman Seaway. This difference in temperature response is attributed to reorganization of ocean currents between the stages. Following ice sheet expansion in the earlier stage, the large Ross Sea gyre circulation decreases in size. Stronger zonal flow through the Tasman Seaway allows salinities to increase in the Ross Sea, deep-water formation initiates and multiple feedbacks then occur amplifying the temperature response. This is potentially a model-dependent result, but it highlights the sensitive nature of model simulations to subtle variations in palaeogeography, and highlights the need for coupled ice sheet-climate simulations to properly represent and investigate feedback processes acting on these time scales. © 2015 The Author(s).

  16. Extended spider cognition.

    Science.gov (United States)

    Japyassú, Hilton F; Laland, Kevin N

    2017-05-01

    There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

  17. Antarctic climate and ice-sheet configuration during the early Pliocene interglacial at 4.23 Ma

    Directory of Open Access Journals (Sweden)

    N. R. Golledge

    2017-07-01

    Full Text Available The geometry of Antarctic ice sheets during warm periods of the geological past is difficult to determine from geological evidence, but is important to know because such reconstructions enable a more complete understanding of how the ice-sheet system responds to changes in climate. Here we investigate how Antarctica evolved under orbital and greenhouse gas conditions representative of an interglacial in the early Pliocene at 4.23 Ma, when Southern Hemisphere insolation reached a maximum. Using offline-coupled climate and ice-sheet models, together with a new synthesis of high-latitude palaeoenvironmental proxy data to define a likely climate envelope, we simulate a range of ice-sheet geometries and calculate their likely contribution to sea level. In addition, we use these simulations to investigate the processes by which the West and East Antarctic ice sheets respond to environmental forcings and the timescales over which these behaviours manifest. We conclude that the Antarctic ice sheet contributed 8.6 ± 2.8 m to global sea level at this time, under an atmospheric CO2 concentration identical to present (400 ppm. Warmer-than-present ocean temperatures led to the collapse of West Antarctica over centuries, whereas higher air temperatures initiated surface melting in parts of East Antarctica that over one to two millennia led to lowering of the ice-sheet surface, flotation of grounded margins in some areas, and retreat of the ice sheet into the Wilkes Subglacial Basin. The results show that regional variations in climate, ice-sheet geometry, and topography produce long-term sea-level contributions that are non-linear with respect to the applied forcings, and which under certain conditions exhibit threshold behaviour associated with behavioural tipping points.

  18. A comparison of spider communities in Bt and non-Bt rice fields.

    Science.gov (United States)

    Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

    2014-06-01

    To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

  19. Edge effect on weevils and spiders

    OpenAIRE

    Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  20. Mixotrophic Activity and Diversity of Antarctic Marine Protists in Austral Summer

    Directory of Open Access Journals (Sweden)

    Rebecca J. Gast

    2018-02-01

    Full Text Available Identifying putative mixotrophic protist species in the environment is important for understanding their behavior, with the recovery of these species in culture essential for determining the triggers of feeding, grazing rates, and overall impact on bacterial standing stocks. In this project, mixotroph abundances determined using tracer ingestion in water and sea ice samples collected in the Ross Sea, Antarctica during the summer of 2011 were compared with data from the spring (Ross Sea and fall (Arctic to examine the impacts of bacterivory/mixotrophy. Mixotrophic nanoplankton (MNAN were usually less abundant than heterotrophs, but consumed more of the bacterial standing stock per day due to relatively higher ingestion rates (1–7 bacteria mixotroph−1 h−1 vs. 0.1–4 bacteria heterotroph−1 h−1. Yet, even with these high rates observed in the Antarctic summer, mixotrophs appeared to have a smaller contribution to bacterivory than in the Antarctic spring. Additionally, putative mixotroph taxa were identified through incubation experiments accomplished with bromodeoxyuridine-labeled bacteria as food, immunoprecipitation (IP of labeled DNA, and amplification and high throughput sequencing of the eukaryotic ribosomal V9 region. Putative mixotroph OTUs were identified in the IP samples by taxonomic similarity to known phototroph taxa. OTUs that had increased abundance in IP samples compared to the non-IP samples from both surface and chlorophyll maximum (CM depths were considered to represent active mixotrophy and include ones taxonomically similar to Dictyocha, Gymnodinium, Pentapharsodinium, and Symbiodinium. These OTUs represent target taxa for isolation and laboratory experiments on triggers for mixotrophy, to be combined with qPCR to estimate their abundance, seasonal distribution and potential impact.

  1. Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

    Science.gov (United States)

    Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

    2016-01-01

    Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

  2. Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

    DEFF Research Database (Denmark)

    Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

    2012-01-01

    Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

  3. The time course of location-avoidance learning in fear of spiders.

    Science.gov (United States)

    Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

    2016-01-01

    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

  4. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  5. Metal complexation capacity of Antarctic lacustrine sediments.

    Science.gov (United States)

    Alberti, Giancarla; Mussi, Matteo; Quattrini, Federico; Pesavento, Maria; Biesuz, Raffaela

    2018-04-01

    The purpose of this study is to implement a work that is a part of a project funded by the Italian National Antarctic Research Program (PNRA, Piano Nazionale di Ricerche in Antartide) within the main thematic focus "Chemical Contamination-Global Change". This research was devoted to detect and characterize micro and nano components with strong complexing capability towards metal ions at trace level in sea water, lakes and lacustrine sediments, sampled during the XXII expedition of PNRA. In particular, in the present work, the sorption complexation capacity of an Antarctic lacustrine sediments toward Cu(II) and Pb(II) is described. The characterization of the sorption was undertaken, studying kinetics and isotherm profiles. The lake here considered is Tarn Flat in the area of Terra Nova Bay. The sorption equilibria of Cu(II) and Pb(II) on the lacustrine sediments were reached in about 10 h, and they were best modelled by the Langmuir equation. Preliminary, to establish if the data here obtained were consistent with those reported for the same area in other expeditions, a common multivariate techniques, namely the principal component analysis (PCA), was applied and finally the consistency of the data has been confirmed. Copyright © 2018 Elsevier Ltd. All rights reserved.

  6. Sea-level and solid-Earth deformation feedbacks in ice sheet modelling

    Science.gov (United States)

    Konrad, Hannes; Sasgen, Ingo; Klemann, Volker; Thoma, Malte; Grosfeld, Klaus; Martinec, Zdeněk

    2014-05-01

    The interactions of ice sheets with the sea level and the solid Earth are important factors for the stability of the ice shelves and the tributary inland ice (e.g. Thomas and Bentley, 1978; Gomez et al, 2012). First, changes in ice extent and ice thickness induce viscoelastic deformation of the Earth surface and Earth's gravity field. In turn, global and local changes in sea level and bathymetry affect the grounding line and, subsequently, alter the ice dynamic behaviour. Here, we investigate these feedbacks for a synthetic ice sheet configuration as well as for the Antarctic ice sheet using a three-dimensional thermomechanical ice sheet and shelf model, coupled to a viscoelastic solid-Earth and gravitationally self-consistent sea-level model. The respective ice sheet undergoes a forcing from rising sea level, warming ocean, and/or changing surface mass balance. The coupling is realized by exchanging ice thickness, Earth surface deformation and sea level periodically. We apply several sets of viscoelastic Earth parameters to our coupled model, e.g. simulating a low-viscous upper mantle present at the Antarctic Peninsula (Ivins et al., 2011). Special focus of our study lies on the evolution of Earth surface deformation and local sea level changes, as well as on the accompanying grounding line evolution. N. Gomez, D. Pollard, J. X. Mitrovica, P. Huybers, and P. U. Clark 2012. Evolution of a coupled marine ice sheet-sea level model, J. Geophys. Res., 117, F01013, doi:10.1029/2011JF002128. E. R. Ivins, M. M. Watkins, D.-N. Yuan, R. Dietrich, G. Casassa, and A. Rülke 2011. On-land ice loss and glacial isostatic adjustment at the Drake Passage: 2003-2009, J. Geophys. Res. 116, B02403, doi: 10.1029/2010JB007607 R. H. Thomas and C. R. Bentley 1978. A model for Holocene retreat of the West Antarctic Ice Sheet, Quaternary Research, 10 (2), pages 150-170, doi: 10.1016/0033-5894(78)90098-4.

  7. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian

    2011-01-01

    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  8. SPIDER: A Framework for Understanding Driver Distraction.

    Science.gov (United States)

    Strayer, David L; Fisher, Donald L

    2016-02-01

    The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

  9. Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

    Science.gov (United States)

    Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

    2008-06-01

    The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

  10. Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

    Science.gov (United States)

    Marín, Linda; Perfecto, Ivette

    2013-04-01

    Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

  11. The safety band of Antarctic ice shelves

    Science.gov (United States)

    Fürst, Johannes Jakob; Durand, Gaël; Gillet-Chaulet, Fabien; Tavard, Laure; Rankl, Melanie; Braun, Matthias; Gagliardini, Olivier

    2016-05-01

    The floating ice shelves along the seaboard of the Antarctic ice sheet restrain the outflow of upstream grounded ice. Removal of these ice shelves, as shown by past ice-shelf recession and break-up, accelerates the outflow, which adds to sea-level rise. A key question in predicting future outflow is to quantify the extent of calving that might precondition other dynamic consequences and lead to loss of ice-shelf restraint. Here we delineate frontal areas that we label as `passive shelf ice’ and that can be removed without major dynamic implications, with contrasting results across the continent. The ice shelves in the Amundsen and Bellingshausen seas have limited or almost no `passive’ portion, which implies that further retreat of current ice-shelf fronts will yield important dynamic consequences. This region is particularly vulnerable as ice shelves have been thinning at high rates for two decades and as upstream grounded ice rests on a backward sloping bed, a precondition to marine ice-sheet instability. In contrast to these ice shelves, Larsen C Ice Shelf, in the Weddell Sea, exhibits a large `passive’ frontal area, suggesting that the imminent calving of a vast tabular iceberg will be unlikely to instantly produce much dynamic change.

  12. The past, present and future distribution of a deep-sea shrimp in the Southern Ocean

    Directory of Open Access Journals (Sweden)

    Zeenatul Basher

    2016-02-01

    Full Text Available Shrimps have a widespread distribution across the shelf, slope and seamount regions of the Southern Ocean. Studies of Antarctic organisms have shown that individual species and higher taxa display different degrees of sensitivity and adaptability in response to environmental change. We use species distribution models to predict changes in the geographic range of the deep-sea Antarctic shrimp Nematocarcinus lanceopes under changing climatic conditions from the Last Glacial Maximum to the present and to the year 2100. The present distribution range indicates a pole-ward shift of the shrimp population since the last glaciation. This occurred by colonization of slopes from nearby refugia located around the northern part of Scotia Arc, southern tip of South America, South Georgia, Bouvet Island, southern tip of the Campbell plateau and Kerguelen plateau. By 2100, the shrimp are likely to expand their distribution in east Antarctica but have a continued pole-ward contraction in west Antarctica. The range extension and contraction process followed by the deep-sea shrimp provide a geographic context of how other deep-sea Antarctic species may have survived during the last glaciation and may endure with projected changing climatic conditions in the future.

  13. The Influence of deep-sea bed CO<sub>2sub> sequestration on small metazoan (meiofaunal) community structure and function

    Energy Technology Data Exchange (ETDEWEB)

    Carman, Kevin R. [Louisiana State Univ., Baton Rouge, LA (United States); Fleeger, John W. [Louisiana State Univ., Baton Rouge, LA (United States); Thistle, David [Florida State Univ., Tallahassee, FL (United States)

    2013-02-17

    reduction in pH to about 7.0 after 30 days were as great as an extreme pH reduction (5.4), suggesting that moderate CO<sub>2sub exposure, compared to the range of exposures possible following CO<sub>2sub release, causes high mortality rates in the two most abundant sediment-dwelling metazoans (nematodes and copepods). While we found evidence for negative impacts on deep-sea benthos, we also observed that small-scale experiments with CO<sub>2sub releases were difficult to replicate in the deep sea. Specifically, in one CO<sub>2sub-release experiment in the Monterey Canyon we did not detect an adverse impacts on benthic meiofauan. In laboratory experiments, we manipulated seawater acidity by addition of HCl and by increasing CO<sub>2sub concentration and observed that two coastal harpacticoid copepod species were both more sensitive to increased acidity when generated by CO<sub>2sub. Copepods living in environments more prone to hypercapnia, such as mudflats, may be less sensitive to future acidification. Ocean acidification is also expected to alter the toxicity of waterborne metals by influencing their speciation in seawater. CO<sub>2sub enrichment did not affect the free-ion concentration of Cd but did increase the free-ion concentration of Cu. Antagonistic toxicities were observed between CO<sub>2sub with Cd, Cu and Cu free-ion. This interaction could be due to a competition for H+ and metals for binding sites.

  14. Reconstitutable control rod spider assembly

    International Nuclear Information System (INIS)

    Shallenberger, J.M.; Ferian, S.J.

    1990-01-01

    A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

  15. Geological characterization of CO{sub 2} storage sites: lessons from Sleipner, Northern North Sea

    Energy Technology Data Exchange (ETDEWEB)

    R.A. Chadwick; P. Zweigel; U. Gregersen; G.A. Kirby; S. Holloway; P.N. Johannessen [British Geological Survey, Keyworth (United Kingdom). Kingsley Dunham Centre

    2003-07-01

    The paper aims to draw some generic conclusions on reservoir characterization based on the Sleipner operation in the North Sea where CO{sub 2} is being injected into the Utsira Sand, a saline aquifer. Regional mapping and petrophysical characterization of the reservoir, based on 2D seismic and well data, enable gross storage potential to be evaluated. Site specific injection studies, however, require precision depth mapping based on 3D seismic data and detailed knowledge of reservoir stratigraphy. Stratigraphical and structural permeability barriers, difficult to detect prior to CO{sub 2} injection, can radically affect CO{sub 2} migration within the aquifer. 5 refs., 5 figs.

  16. New insights into the use of stable water isotopes at the northern Antarctic Peninsula as a tool for regional climate studies

    Science.gov (United States)

    Fernandoy, Francisco; Tetzner, Dieter; Meyer, Hanno; Gacitúa, Guisella; Hoffmann, Kirstin; Falk, Ulrike; Lambert, Fabrice; MacDonell, Shelley

    2018-03-01

    Due to recent atmospheric and oceanic warming, the Antarctic Peninsula is one of the most challenging regions of Antarctica to understand in terms of both local- and regional-scale climate signals. Steep topography and a lack of long-term and in situ meteorological observations complicate the extrapolation of existing climate models to the sub-regional scale. Therefore, new techniques must be developed to better understand processes operating in the region. Isotope signals are traditionally related mainly to atmospheric conditions, but a detailed analysis of individual components can give new insight into oceanic and atmospheric processes. This paper aims to use new isotopic records collected from snow and firn cores in conjunction with existing meteorological and oceanic datasets to determine changes at the climatic scale in the northern extent of the Antarctic Peninsula. In particular, a discernible effect of sea ice cover on local temperatures and the expression of climatic modes, especially the Southern Annular Mode (SAM), is demonstrated. In years with a large sea ice extension in winter (negative SAM anomaly), an inversion layer in the lower troposphere develops at the coastal zone. Therefore, an isotope-temperature relationship (δ-T) valid for all periods cannot be obtained, and instead the δ-T depends on the seasonal variability of oceanic conditions. Comparatively, transitional seasons (autumn and spring) have a consistent isotope-temperature gradient of +0.69 ‰ °C-1. As shown by firn core analysis, the near-surface temperature in the northern-most portion of the Antarctic Peninsula shows a decreasing trend (-0.33 °C year-1) between 2008 and 2014. In addition, the deuterium excess (dexcess) is demonstrated to be a reliable indicator of seasonal oceanic conditions, and therefore suitable to improve a firn age model based on seasonal dexcess variability. The annual accumulation rate in this region is highly variable, ranging between 1060 and 2470 kg m

  17. Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

    Science.gov (United States)

    Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

    2018-05-07

    Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

  18. Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

    Science.gov (United States)

    Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

    2014-11-01

    Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

  19. Pakistan and Antarctic research - an overview

    International Nuclear Information System (INIS)

    Rizvi, S.H.

    1993-01-01

    The paper describes the significance of Antarctica and the necessity of conducting scientific research for the understanding of the global environment and through various environmental processes operative in Antarctica. The paper presents a review of the Pakistan's activities and research interests in Antarctica focussing on the salient features of the Pakistan's Antarctic Research Programme and objectives. It summarises the significance of Antarctica, Antarctic Research and the interests of the world in Antarctica and international co-operation for Antarctic Research. The paper also highlights the philosophy of Antarctic Science and provides some guidelines for the development of Antarctic Research programmes for Pakistan and for the newcomers in Antarctica particularly for the developing countries. (author)

  20. Remote monitoring of vibrational information in spider webs

    Science.gov (United States)

    Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

    2018-06-01

    Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

  1. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Directory of Open Access Journals (Sweden)

    Yann Hénaut

    Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  2. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Science.gov (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  3. Environmental and hormonal factors controlling reversible colour change in crab spiders.

    Science.gov (United States)

    Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

    2013-10-15

    Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

  4. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

    Science.gov (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

    2014-01-01

    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

  5. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

    2011-01-01

    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  6. Simulating a Dynamic Antarctic Ice Sheet in the Early to Middle Miocene

    Science.gov (United States)

    Gasson, E.; DeConto, R.; Pollard, D.; Levy, R. H.

    2015-12-01

    There are a variety of sources of geological data that suggest major variations in the volume and extent of the Antarctic ice sheet during the early to middle Miocene. Simulating such variability using coupled climate-ice sheet models is problematic due to a strong hysteresis effect caused by height-mass balance feedback and albedo feedback. This results in limited retreat of the ice sheet once it has reached the continental size, as likely occurred prior to the Miocene. Proxy records suggest a relatively narrow range of atmospheric CO2 during the early to middle Miocene, which exacerbates this problem. We use a new climate forcing which accounts for ice sheet-climate feedbacks through an asynchronous GCM-RCM coupling, which is able to better resolve the narrow Antarctic ablation zone in warm climate simulations. When combined with recently suggested mechanisms for retreat into subglacial basins due to ice shelf hydrofracture and ice cliff failure, we are able to simulate large-scale variability of the Antarctic ice sheet in the Miocene. This variability is equivalent to a seawater oxygen isotope signal of ~0.5 ‰, or a sea level equivalent change of ~35 m, for a range of atmospheric CO2 between 280 - 500 ppm.

  7. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen

    2015-09-01

    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  8. Optical surface profiling of orb-web spider capture silks

    Energy Technology Data Exchange (ETDEWEB)

    Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

    2010-09-15

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  9. Optical surface profiling of orb-web spider capture silks

    International Nuclear Information System (INIS)

    Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

    2010-01-01

    Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

  10. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  11. Antarctic Lithosphere Studies: Progress, Problems and Promise

    Science.gov (United States)

    Dalziel, I. W. D.; Wilson, T. J.

    2017-12-01

    In the sixty years since the International Geophysical Year, studies of the Antarctic lithosphere have progressed from basic geological observations and sparse geophysical measurements to continental-scale datasets of radiometric dates, ice thickness, bedrock topography and characteristics, seismic imaging and potential fields. These have been augmented by data from increasingly dense broadband seismic and geodetic networks. The Antarctic lithosphere is known to have been an integral part, indeed a "keystone" of the Pangea ( 250-185Ma) and Gondwanaland ( 540-180 Ma) supercontinents. It is widely believed to have been part of hypothetical earlier supercontinents Rodinia ( 1.0-0.75 Ga) and Columbia (Nuna) ( 2.0-1.5 Ga). Despite the paucity of exposure in East Antarctica, the new potential field datasets have emboldened workers to extrapolate Precambrian geological provinces and structures from neighboring continents into Antarctica. Hence models of the configuration of Columbia and its evolution into Rodinia and Gondwana have been proposed, and rift-flank uplift superimposed on a Proterozoic orogenic root has been hypothesized to explain the Gamburtsev Subglacial Mountains. Mesozoic-Cenozoic rifting has imparted a strong imprint on the West Antarctic lithosphere. Seismic tomographic evidence reveals lateral variation in lithospheric thickness, with the thinnest zones within the West Antarctic rift system and underlying the Amundsen Sea Embayment. Upper mantle low velocity zones are extensive, with a deeper mantle velocity anomaly underlying Marie Byrd Land marking a possible mantle plume. Misfits between crustal motions measured by GPS and GIA model predictions can, in part, be linked with the changes in lithosphere thickness and mantle rheology. Unusually high uplift rates measured by GPS in the Amundsen region can be interpreted as the response of regions with thin lithosphere and weak mantle to late Holocene ice mass loss. Horizontal displacements across the TAM

  12. Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

    Science.gov (United States)

    Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

    2017-06-01

    This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

  13. Antarctic crabs: invasion or endurance?

    Directory of Open Access Journals (Sweden)

    Huw J Griffiths

    Full Text Available Recent scientific interest following the "discovery" of lithodid crabs around Antarctica has centred on a hypothesis that these crabs might be poised to invade the Antarctic shelf if the recent warming trend continues, potentially decimating its native fauna. This "invasion hypothesis" suggests that decapod crabs were driven out of Antarctica 40-15 million years ago and are only now returning as "warm" enough habitats become available. The hypothesis is based on a geographically and spatially poor fossil record of a different group of crabs (Brachyura, and examination of relatively few Recent lithodid samples from the Antarctic slope. In this paper, we examine the existing lithodid fossil record and present the distribution and biogeographic patterns derived from over 16,000 records of Recent Southern Hemisphere crabs and lobsters. Globally, the lithodid fossil record consists of only two known specimens, neither of which comes from the Antarctic. Recent records show that 22 species of crabs and lobsters have been reported from the Southern Ocean, with 12 species found south of 60 °S. All are restricted to waters warmer than 0 °C, with their Antarctic distribution limited to the areas of seafloor dominated by Circumpolar Deep Water (CDW. Currently, CDW extends further and shallower onto the West Antarctic shelf than the known distribution ranges of most lithodid species examined. Geological evidence suggests that West Antarctic shelf could have been available for colonisation during the last 9,000 years. Distribution patterns, species richness, and levels of endemism all suggest that, rather than becoming extinct and recently re-invading from outside Antarctica, the lithodid crabs have likely persisted, and even radiated, on or near to Antarctic slope. We conclude there is no evidence for a modern-day "crab invasion". We recommend a repeated targeted lithodid sampling program along the West Antarctic shelf to fully test the validity of the

  14. How informative are case studies of spider bites in the medical literature?

    Science.gov (United States)

    Stuber, Marielle; Nentwig, Wolfgang

    2016-05-01

    We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

    Science.gov (United States)

    Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

    2013-10-01

    This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

  16. Who is afraid of a black Spider(-Man)?

    OpenAIRE

    Ora C. McWilliams

    2013-01-01

    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  17. The evolution of water property in the Mackenzie Bay polynya during Antarctic winter

    Science.gov (United States)

    Xu, Zhixin; Gao, Guoping; Xu, Jianping; Shi, Maochong

    2017-10-01

    Temperature and salinity profile data, collected by southern elephant seals equipped with autonomous CTD-Satellite Relay Data Loggers (CTD-SRDLs) during the Antarctic wintertime in 2011 and 2012, were used to study the evolution of water property and the resultant formation of the high density water in the Mackenzie Bay polynya (MBP) in front of the Amery Ice Shelf (AIS). In late March the upper 100-200 m layer is characterized by strong halocline and inversion thermocline. The mixed layer keeps deepening up to 250 m by mid-April with potential temperature remaining nearly the surface freezing point and sea surface salinity increasing from 34.00 to 34.21. From then on until mid-May, the whole water column stays isothermally at about -1.90℃ while the surface salinity increases by a further 0.23. Hereafter the temperature increases while salinity decreases along with the increasing depth both by 0.1 order of magnitude vertically. The upper ocean heat content ranging from 120.5 to 2.9 MJ m-2, heat flux with the values of 9.8-287.0 W m-2 loss and the sea ice growth rates of 4.3-11.7 cm d-1 were estimated by using simple 1-D heat and salt budget methods. The MBP exists throughout the whole Antarctic winter (March to October) due to the air-sea-ice interaction, with an average size of about 5.0×103 km2. It can be speculated that the decrease of the salinity of the upper ocean may occur after October each year. The recurring sea-ice production and the associated brine rejection process increase the salinity of the water column in the MBP progressively, resulting in, eventually, the formation of a large body of high density water.

  18. Community metabolism and air-sea CO[sub 2] fluxes in a coral reef ecosystem (Moorea, French Polynesia)

    Energy Technology Data Exchange (ETDEWEB)

    Gattuso, J P; Pichon, M; Delesalle, B; Frankignoulle, M [Observatory of European Oceanology (Monaco)

    1993-06-01

    Community metabolism (primary production, respiration and calcification) and air-sea CO[sub 2] fluxes of the 'Tiahura barrier reef' (Moorea, French Polynesia) were investigated in November and December 1991. Gross production and respiration were respectively 640.2 to 753 and 590.4 to 641.5 mmol (O[sub 2] or CO[sub 2]) m[sup 2] d[sup -1] (7.7 to 9.0 and 7.1 to 7.7 g C m)[sup 2] d[sup -1] and the reef displayed a slightly negative excess (net) production. The contribution of planktonic primary production to reef metabolism was negligible (0.15% of total gross production). Net calcification was positive both during the day and at night; its daily value was 243 mmol CaCO[sub 3] m[sup 2] d[sup -1] (24.3 g CaCO)[sub 3] m[sup -2] d[sup -1]. Reef metabolism decreased seawater total CO[sub 2] by 433.3 mmol m[sup 2] d[sup -1]. The air-sea CO[sub 2] fluxes were close to zero in the ocean but displayed a strong daily pattern at the reef front and the back reef. Fluxes were positive (CO[sub 2] evasion) at night, decreased as irradiance increased and were negative during the day (CO[sub 2] invasion). Integration of the fluxes measured during a 24 h experiment at the back reef showed that the reef was a source of CO[sub 2] to the atmosphere (1.5 mmol m[sup 2] d[sup -1]).

  19. Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

    Directory of Open Access Journals (Sweden)

    Sandra M. Rodriguez-Artigas

    2016-04-01

    Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

  20. Antarctic icebergs distributions 1992-2014

    Science.gov (United States)

    Tournadre, J.; Bouhier, N.; Girard-Ardhuin, F.; Rémy, F.

    2016-01-01

    Basal melting of floating ice shelves and iceberg calving constitute the two almost equal paths of freshwater flux between the Antarctic ice cap and the Southern Ocean. The largest icebergs (>100 km2) transport most of the ice volume but their basal melting is small compared to their breaking into smaller icebergs that constitute thus the major vector of freshwater. The archives of nine altimeters have been processed to create a database of small icebergs (law of slope -1.52 ± 0.32 close to the -3/2 laws observed and modeled for brittle fragmentation. The global volume of ice and its distribution between the ocean basins present a very strong interannual variability only partially explained by the number of large icebergs. Indeed, vast zones of the Southern Ocean free of large icebergs are largely populated by small iceberg drifting over thousands of kilometers. The correlation between the global small and large icebergs volumes shows that small icebergs are mainly generated by large ones breaking. Drifting and trapping by sea ice can transport small icebergs for long period and distances. Small icebergs act as an ice diffuse process along large icebergs trajectories while sea ice trapping acts as a buffer delaying melting.