Directory of Open Access Journals (Sweden)
Tenu Filemoni
2008-10-01
Full Text Available Abstract Background The use of repellent materials from plants against nuisance insects is common with great potential to compliment existing malaria control programmes and this requires evaluation in the field. Ocimum plant species, Ocimum suave (Willd and O. kilimandscharicum (Guerke materials and their essential oils extracted by steam distillation were evaluated in the field and experimental huts for repellence, exophily and feeding inhibition effects against three mosquito species, Anopheles arabiensis (Patton, An. gambiae ss (Giles and Culex quinquefasciatus (Say. The protective effect of essential oils from Ocimum plants were compared with N, N-diethly-3- methylbenzamide (DEET, a standard synthetic repellent. Also, the protective effect of fumigation by burning of repellent plants; Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara were tested in experimental huts and selected local houses. Results In the field, protection by Ocimum plants from mosquito bites was high and there was small variation among different mosquito species. Protection efficiency was 93.4%, 91.98% and 89.75% for An. arabiensis while for Cx. quinquefaciatus it was 91.30%, 88.65% and 90.50% for DEET, Ocimum suave and O. kilimandscharicum respectively. In the experimental hut, deterrence induced by burning of Ocimum and other plants ranged from 73.1.0% to 81.9% for An. arabiensis and 56.5% to 67.8% for Cx. quinquefaciatus, while feeding inhibition was 61.1% to 100% for An. arabiensis and 50% to 100% for Cx. quinquefaciatus. Evaluations under field conditions confirmed high protective efficacy, enhanced feeding inhibition and house entry inhibition (Deterrence. Conclusion This study shows the potential of Ocimum suave and Ocimum kilimandscharicum crude extracts and whole plants of Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara for use in protecting against human biting
Screening for adulticidal bioactivity of South African plants against Anopheles arabiensis
CSIR Research Space (South Africa)
Maharaj, R
2011-08-01
Full Text Available of Corymbia citriodora (Myrtaceae), and leaves and seeds of both Ocimum kilimandscharicum and Ocimum suave (Lamiaceae) had exhibited a signifi- cant repellent effect against Anopheles gambiae s.s and An. arabiensis during application of plant material...
Ethnobotanical study of some of mosquito repellent plants in north-eastern Tanzania
Directory of Open Access Journals (Sweden)
Tenu Filemoni
2008-08-01
Full Text Available Abstract Background The use of plant repellents against nuisance biting insects is common and its potential for malaria vector control requires evaluation in areas with different level of malaria endemicity. The essential oils of Ocimum suave and Ocimum kilimandscharicum were evaluated against malaria vectors in north-eastern Tanzania. Methodology An ethnobotanical study was conducted at Moshi in Kilimanjaro region north-eastern Tanzania, through interviews, to investigate the range of species of plants used as insect repellents. Also, bioassays were used to evaluate the protective potential of selected plants extracts against mosquitoes. Results The plant species mostly used as repellent at night are: fresh or smoke of the leaves of O. suave and O. kilimandscharicum (Lamiaceae, Azadirachta indica (Meliaceae, Eucalyptus globules (Myrtaceae and Lantana camara (Verbenaceae. The most popular repellents were O. kilimandscharicum (OK and O. suave (OS used by 67% out of 120 households interviewed. Bioassay of essential oils of the two Ocimum plants was compared with citronella and DEET to study the repellence and feeding inhibition of untreated and treated arms of volunteers. Using filter papers impregnated with Ocimum extracts, knockdown effects and mortality was investigated on malaria mosquito Anopheles arabiensis and Anopheles gambiae, including a nuisance mosquito, Culex quinquefasciatus. High biting protection (83% to 91% and feeding inhibition (71.2% to 92.5% was observed against three species of mosquitoes. Likewise the extracts of Ocimum plants induced KD90 of longer time in mosquitoes than citronella, a standard botanical repellent. Mortality induced by standard dosage of 30 mg/m2 on filter papers, scored after 24 hours was 47.3% for OK and 57% for OS, compared with 67.7% for citronella. Conclusion The use of whole plants and their products as insect repellents is common among village communities of north-eastern Tanzania and the results
Evaluation of Ocimum suave essential oil against anthropophilic ...
African Journals Online (AJOL)
The use of plant extracts as repellents against malaria vectors have been advocated in different studies. The objective of ... essential oil of Oc mum suave against Anopheles gamb ae s.s. The feeding inhibition of old and freshly prepared. O. suave extracts in ... against insects of medical and veterinary im- portance (Pålsson ...
Chemistry and bioactivities of essential oils of some Ocimum species: an overview
Directory of Open Access Journals (Sweden)
Abhay Kumar Pandey
2014-09-01
Full Text Available Essential oils of different species of the genus Ocimum are natural flavouring materials of commercial importance. The data given in current literature are pertaining to the chemical composition of essential oils of different Ocimum species viz., Ocimum basilicum Linn. (alt. Ocimum basilicum var. minimum, Ocimum basilicum var. purpurience, Ocimum campechianum Mill., Ocimum canum Sims. (Ocimum americanum, Ocimum citriodorum, Ocimum gratissimum Linn., Ocimum kilimandscharicum Linn., Ocimum micranthum Willd., Ocimum sanctum Linn., (alt. Ocimum tenuiflorum Linn., Ocimum selloi Benth., Ocimum trichodon, Ocimum utricifolium from different geographical regions. A considerable difference in chemical composition of a particular species is found, which may be due to their occurrence in different eco-climatic zones and changes in edaphic factors. Attention is also focused on the biological properties of Ocimum oils which are related to their various interesting applications as antimicrobial, antioxidant, repellent, insecticidal, larvicidal, nematicidal and therapeutic (anti-inflammatory, antinociceptive, antipyretic, antiulcer, analgesic, anthelmintic, anticarcinogenic, skin permeation enhancer, immunomodulatory, cardio-protective, antilipidemic agents.
Building a SuAVE browse interface to R2R's Linked Data
Clark, D.; Stocks, K. I.; Arko, R. A.; Zaslavsky, I.; Whitenack, T.
2017-12-01
The Rolling Deck to Repository program (R2R) is creating and evaluating a new browse portal based on the SuAVE platform and the R2R linked data graph. R2R manages the underway sensor data collected by the fleet of US academic research vessels, and provides a discovery and access point to those data at its website, www.rvdata.us. R2R has a database-driven search interface, but seeks a more capable and extensible browse interface that could be built off of the substantial R2R linked data resources. R2R's Linked Data graph organizes its data holdings around key concepts (e.g. cruise, vessel, device type, operator, award, organization, publication), anchored by persistent identifiers where feasible. The "Survey Analysis via Visual Exploration" or SuAVE platform (suave.sdsc.edu) is a system for online publication, sharing, and analysis of images and metadata. It has been implemented as an interface to diverse data collections, but has not been driven off of linked data in the past. SuAVE supports several features of interest to R2R, including faceted searching, collaborative annotations, efficient subsetting, Google maps-like navigation over an image gallery, and several types of data analysis. Our initial SuAVE-based implementation was through a CSV export from the R2R PostGIS-enabled PostgreSQL database. This served to demonstrate the utility of SuAVE but was static and required reloading as R2R data holdings grew. We are now working to implement a SPARQL-based ("RDF Query Language") service that directly leverages the R2R Linked Data graph and offers the ability to subset and/or customize output.We will show examples of SuAVE faceted searches on R2R linked data concepts, and discuss our experience to date with this work in progress.
Directory of Open Access Journals (Sweden)
Eliane Teresinha Peres
2016-03-01
Full Text Available The main objective of this work was to present and analyze editorial aspects of the primer Caminho Suave, as well as the participation of the publishing house of the same name, in federal programs for school textbooks. The primer was published for the first time in 1948 and is edited until today, representing a landmark for Brazilian literacy, exerting influence over generations of teachers and students alike. Data analyzed were collected from official sources (Diário Oficial da União [Brazilian Official National Press] and Diário Oficial do Estado de São Paulo [São Paulo State Official Press], from periodical press (Veja Digital, Grupo Folha, and Hemeroteca Digital Brasileira [Brazilian Digital Periodical Press Collection], and from printings of the primer itself. In the research process, data indicated the primer Caminho Suave as one of the biggest editorial successes concerning books used to teach reading and writing inBrazil, as some studies in this field had already indicated.
Directory of Open Access Journals (Sweden)
Pedro Lara Velázquez
2015-08-01
Full Text Available En este trabajo se propone un modelo de Coloración en Gráficas Suaves donde se colorea con base en ponderaciones sobre las aristas de la gráfica. Se muestra que este modelo es muy flexible e incluye otros problemas similares, tales como los problemas de Coloración Mínima, Coloración Equitativa, Coloración de Gráficas Débiles y Coloración Robusta. Se proponen también un modelo binario lineal de solución y algunas instancias de prueba.
Scott y Zelda Fitzgerald y el psicoanálisis: la construcción de "Suave es la noche"
Esteve Díaz, Nuria
2016-01-01
Esta tesis aporta una investigación original que pretende analizar la novela Suave es la noche (Tender is the Night, 1934) del escritor norteamericano Francis Scott Key Fitzgerald desde la perspectiva de las humanidades médicas y de manera particular, de las relaciones entre medicina y literatura. En Suave es la noche existen amplias referencias médicas y conceptos psicoanalíticos relacionados con la psiquiatría europea de finales del siglo XIX y comienzos del XX, por lo que cobra especial in...
GROWTH-RATES OF SHRUBS ON DIFFERENT SOILS IN TANZANIA
PRINS, HHT; VANDERJEUGD, HP
1992-01-01
Because little is known of growth rates of shrubs in East Africa, the growth rates of Acalypha fructicosa, Gardenia jovis-tonantis, Justicia cordata, Maerua triphylla, and Ocimum suave were measured in Lake Manyara National Park, northern Tanzania. Branch diameter increments and branch length
Growth rates of shrubs on different soils in Tanzania.
Prins, H.H.T.; Jeugd, van der H.P.
1992-01-01
Because little is known of growth rates of shrubs in East Africa, the growth rates of Acalypha fructicosa, Gardenia jovis-tonantis, Justicia cordata, Maerua triphylla, and Ocimum suave were measured in Lake Manyara National Park, northern Tanzania. Branch diameter increments and branch length
Comparative reproduction mechanisms of three species of Ocimum L. (Lamiaceae
Directory of Open Access Journals (Sweden)
Matthew Oziegbe
2016-03-01
Full Text Available Ocimum species have a combination of reproductive system which varies with the locality and cultivar. We have studied here the reproductive mechanisms of five variants of three Ocimum species in Nigeria, namely: Ocimum canum Sims., O. basilicum L., and O. americanum L. Flowers from each variant were subjected to open and bagged pollination treatments of hand self-pollination, spontaneous self-pollination and emasculation. All open treatments of the five Ocimum variants produced more fruit and seed than the corresponding bagged treatments. The two O. canum variants and O. basilicum ‘b1’ produced high fruit and seed set in the open and bagged treatments of spontaneous self-pollination. Ocimum basilicum ‘b2’ and O. americanum produced higher fruit and seed set in the self-pollination open treatment but significantly lower fruit and seed set in the bagged treatment. Fewer fruit and seeds were produced in the emasculated open treatments but none in the emasculated bagged treatments of the five Ocimum variants. The floral foragers comprising of bees, wasps and butterflies visited the Ocimum species to collect pollen or nectar in the open treatments. The two O. canum variants and O. basilicum ‘b1’ variant reproduced mainly through autogamy but O. basilicum ‘b2’ and O. americanum showed mixed reproduction of autogamy and outcrosssing. Insect visitation to the flowers enhanced pollination resulting in higher fruit and seed set in all the Ocimum species studied.
Evaluation of Ocimum suave essential oil against anthropophilic ...
African Journals Online (AJOL)
Abstract: Interruption of vector-human contact is of priority in breaking the transmission chain of malaria parasites. The use of plant extracts as repellents against malaria vectors have been advocated in different studies. The objective of this study was to evaluate the protective efficacy of freshly distilled and ten years old ...
Sistema de Navegación Reactiva Difusa para Giros Suaves de Plataformas Móviles Empleando el Kinect
Directory of Open Access Journals (Sweden)
Claudia Cruz Martínez
2016-11-01
Full Text Available La navegación en un robot móvil es la habilidad para desplazarse de un lugar a otro dentro de un entorno evitando los obstáculos que se presenten. La autonomía de un robot móvil se basa en su sistema de navegación. La aplicación de técnicas de Inteligencia Artificial como la lógica difusa y el uso de la visión por computadora son dos herramientas empleadas para cumplir esta tarea. En algunos sistemas de navegación la seguridad y la facilidad de operación son factores muy importantes. En estos casos, la tolerancia a la incertidumbre de información, la reacción ante objetos imprevistos, y la navegación mediante giros suaves son argumentos del diseño de estos sistemas. En este artículo se presenta el desarrollo de un sistema de navegación reactiva difusa que emplea los datos de profundidad del sensor Kinect, algoritmos de visión por computadora, y lógica difusa, para generar ángulos de giro suave para la navegación de un robot móvil. En pruebas realizadas con la plataforma móvil ERA-MOBI se observaron giros suaves con un porcentaje de evasión de obstáculos del 85.7%.
Floral biology and reproductive mechanisms of the Ocimum canum Sims (Lamiaceae
Directory of Open Access Journals (Sweden)
Cláudio Lúcio Fernandes Amaral
2008-06-01
Full Text Available The Ocimum genus (Lamiaceae presents essential oils used in the pharmaceutical, perfume, cosmetics and culinary industries. The aim of this paper was to study the fl oral biology and breeding mechanisms of Ocimum canum Sims. in relation to improved plant breeding. Ocimum canum has inflorescences with white, protandrous and hermaphoditic flowers. The osmophores are located at the anthers and stigma. Anthesis occurs between 10:30 and 11:30 a.m. The main fl oral visitors were bees of the Apis and Augochloropsis genuses. Ocimum canum presents a breeding system with a predominance of outcrossing that possibly demonstrates the wide reproductive flexibility of this species.
[Processing and characterization of fried beans varieties Pinto 114, Suave 85 and Tórtola Inia].
Hurtado, M L; Escobar, B; Estévez, A M
2001-06-01
The objective of this study was develop a snack product based on fried beans. For this purpose, three bean varieties were used: Pinto 114, Suave 85 and Tórtola Inia. The beans were treated with two soaking solutions, EDTA disodium salt and a mixture of NaOH/water, to determine if they had some effect on the product's final quality. On the other hand, before the beans were fried, some grains were given thermal treatment (blanched), leaving the other ones without this process (raw); this also had an effect on the final quality of the fried beans. Physical, chemical and sensory characteristics of the final fried products were determined. For three beans varieties, the blanched products had higher water content, higher oil absorption, lower protein content and larger water activity. The soaking solutions had no effect on the quality of manufactured products. The sensory analysis determined that the best treatment for Pinto 114 and Tórtola Inia was NaOH/water-raw grain, and EDTA raw grain for Suave 85.
Basil (Ocimum basilicum L.) oils
Basil (Ocimum basilicum) is one of the most popular and healthy culinary herbs in the world. Essential oil derived from basil (basil oil) through steam distillation has traditionally been used for a wide range of applications such as cooking spices, aromatherapy, perfumery, medicinal treatments, pes...
Population structure, genetic diversity and downy mildew resistance among Ocimum species germplasm.
Pyne, Robert M; Honig, Josh A; Vaiciunas, Jennifer; Wyenandt, Christian A; Simon, James E
2018-04-23
The basil (Ocimum spp.) genus maintains a rich diversity of phenotypes and aromatic volatiles through natural and artificial outcrossing. Characterization of population structure and genetic diversity among a representative sample of this genus is severely lacking. Absence of such information has slowed breeding efforts and the development of sweet basil (Ocimum basilicum L.) with resistance to the worldwide downy mildew epidemic, caused by the obligate oomycete Peronospora belbahrii. In an effort to improve classification of relationships 20 EST-SSR markers with species-level transferability were developed and used to resolve relationships among a diverse panel of 180 Ocimum spp. accessions with varying response to downy mildew. Results obtained from nested Bayesian model-based clustering, analysis of molecular variance and unweighted pair group method using arithmetic average (UPGMA) analyses were synergized to provide an updated phylogeny of the Ocimum genus. Three (major) and seven (sub) population (cluster) models were identified and well-supported (P UPGMA analysis provided best resolution for the 36-accession, DM resistant k3 cluster with consistently strong bootstrap support. Although the k3 cluster is a rich source of DM resistance introgression of resistance into the commercially important k1 accessions is impeded by reproductive barriers as demonstrated by multiple sterile F1 hybrids. The k2 cluster located between k1 and k3, represents a source of transferrable tolerance evidenced by fertile backcross progeny. The 90-accession k1 cluster was largely susceptible to downy mildew with accession 'MRI' representing the only source of DM resistance. High levels of genetic diversity support the observed phenotypic diversity among Ocimum spp. accessions. EST-SSRs provided a robust evaluation of molecular diversity and can be used for additional studies to increase resolution of genetic relationships in the Ocimum genus. Elucidation of population structure
MORPHO-CHEMICAL DESCRIPTION AND ANTIMICROBIAL ACTIVITY OF DIFFERENT OCIMUM SPECIES
Directory of Open Access Journals (Sweden)
KAKARAPARTHI PANDU SASTRY
2012-12-01
Full Text Available Basil is a popular medicinal and culinary herb, and its essential oils have been used extensively for many years in food products, perfumery, dental and oral products. Basil essential oils and their principal constituents were found to exhibit antimicrobial activity against a wide range of Gram-negative and Gram-positive bacteria, yeast, and mould. The essential oils obtained from aerial parts of three different species of Ocimum comprising twenty one germplasm lines were investigated for their essential oil composition and antimicrobial activity during 2010. Essential oils from seventeen germplasm lines in Ocimum basilicum and two each in Ocimum tenuiflorum and Ocimum gratissimum were investigated for anti-microbial activity against four bacterial strains (Staphylococcus aureus, Bacillus sps., Escherichia coli and Pseudomonas aeruginosa. The morpho-chemotypes exhibited wide variability for morphological and chemical traits. Anti-bacterial activity was found to be high for Staphylococcus aureus, moderate for Escherichia coli, low for Bacillus and Pseudomonas aeruginosa was highly resistant. The essential oils of Pale Green-Broad Leaves (O. basilicum and CIM Ayu (O. gratissimum exhibited significant antibacterial activity against both S. aureus and E. coli signifying them promising for anti-bacterial activity. No relationship was observed between chemotype specificity and anti-bacterial activity, indicating that apart from major components of essential oil, minor components and other factors may be responsible for anti-microbial activities.
Directory of Open Access Journals (Sweden)
G. K. Rybakov
2017-06-01
Full Text Available This study considers a remote sensing technique for mean volume estimation based on a very high-resolution (VHR aerial RGB imagery obtained using a small-sized unmanned aerial vehicle (sUAV and a high-resolution photogrammetric digital surface model (DSM as well as an innovative technology for field measurements (Trestima. The study area covers approx. 220 ha of forestland in Finland. The work concerns the entire process from remote sensing and field data acquisition to statistical analysis and forest volume wall-to-wall mapping. The study showed that the VHR aerial imagery and the high-resolution DSM produced based on the application of the sUAV have good prospects for forest inventory. For the sUAV based estimation of forest variables such as Height, Basal Area and mean Volume, Root Mean Square Error constituted 6.6 %, 22.6 % and 26.7 %, respectively. Application of Trestima for estimation of the mean volume of the standing forest showed minor difference over the existing Forest Management Plan at all the selected forest compartments. Simultaneously, the results of the study confirmed that the technologies and the tools applied at this work could be a reliable and potentially cost-effective means of forest data acquisition with high potential of operational use.
Imunno-modulatory effect of Ocimum sanctum against endosulfan induced immunotoxicity in Wistar Rat
Directory of Open Access Journals (Sweden)
Bharath B.K.
2011-02-01
Full Text Available The present experiment was designed to make a systematic study of experimentally induced immunotoxicity of endosulfan and its amelioration with Ocimum sanctum in male Wistar rats at 6, 3 and 1.5 mg / Kg b.wt to groups II, III and IV by mixing in ground nut oil for 6 weeks. To the groups V, VI and VII in addition to endosulfan as above mentioned dose, Ocimum sanctum was given at 200 mg / kg b.wt daily per orally for the same duration to study immuno modulatory effect. Group I served as oil control and Group VIII as Ocimum sanctum control. Significant reduction in the both HA titer and DNCB contact sensitivity score was observed in the endosulfan treated groups indicates endosulfan has immunotoxic effect. But significant improvement in the immunity was observed in the Ocimum sanctum treated groups indicates the immuno modulatory property. [Veterinary World 2011; 4(1.000: 25-27
ANXIOLYTIC ACTIVITY OF OCIMUM SANCTUM LEAF EXTRACT
Chattopadhyay, R.R.
1994-01-01
The anxiolytic activity of Ocimum sanctum leaf extract was studied in mice. O.sanctum leaf extract produced significant anxiolytic activity in plus – maze and open field behaviour test models. The effect was compared with diazepam, a standard antianxiety drug.
Treatment with methanolic extract of Ocimum gratissimum (Linn ...
African Journals Online (AJOL)
2017-01-10
Jan 10, 2017 ... effects can be achieved using a potent antioxidant. Engaging ... experimental evidence on the effects of Ocimum ... animal (Wistar rat) model of drug-induced kidney injury. ...... cyclophosphamide-induced reproductive toxicity.
Directory of Open Access Journals (Sweden)
Jeferson C. Nascimento
2011-09-01
Full Text Available This work describes the chemical composition and antimicrobial activity of the volatile oils of Ocimum canum and Ocimum selloi, both occurring in Jequié/BA, northeastern Brazil. The plants were collected in the winter/2005 andsummer/2006, the oils extracted by steam distillation and further analyzed by GC-MS. A total of 30 and 31 compounds was identified from the oils of O. selloi and O. canum, respectively. It was observed that the oil content of O. canum showed variation during the seasons, while the oils of O. selloi did not. Methylchavicol and linalool were the main chemical components found in the aerial parts and leaves of O. canum. This finding permitted to characterize this specimen as a new chemotype of O. canum. Regarding the aerial parts of O. selloi, eugenol, 1,8-cineole, transcaryophyllene and linalool were identified as their major components. All extracted oils from the aerial parts showed biological activity against gram-positive cocci - Staphylococcus aureus ATCC 25923 - but only the O. canum one showed activity against gram-negative bacilli - Escherichia coli ATCC 25922.Este trabalho descreve a composição química e a atividade antimicrobiana dos óleos voláteis de Ocimum canum e Ocimum selloi, que ocorrem em Jequié/BA, nordeste do Brasil. As plantas foram colhidas no inverno de 2005 e verão de 2006 e os óleos extraídos por destilação a vapor foram posteriormente analisados por GC-MS. Um total de 30 e 31 compostos foi identificado a partir dos óleos de O. selloi e O. canum, respectivamente. Foi observado que o teor de óleo de O. canum apresentou variação durante as estações do ano, enquanto o óleo de O. selloi não. Metilchavicol e linalol foram os principais componentes químicos encontrados na parte aérea e folhas de O. canum. Esta descoberta permitiu caracterizar este espécime como um novo quimiotipo de O. canum. Com relação às partes aéreas de O. selloi, eugenol, 1,8-cineol, trans-cariofileno e
Directory of Open Access Journals (Sweden)
Dube Fitsum
2011-12-01
Full Text Available Abstract Background In the search for plant-based mosquito repellents, volatile emanations were investigated from five plant species, Corymbia citriodora, Ocimum suave, Ocimum lamiifolium, Olea europaea and Ostostegia integrifolia, traditionally used in Ethiopia as protection against mosquitoes. Methods The behaviour of two mosquitoes, the malaria vector Anopheles arabiensis and the arbovirus vector Aedes aegypti, was assessed towards volatiles collected from the headspace of fresh and dried leaves, and the smoke from burning the dried leaves in a two-choice landing bioassay and in the background of human odour. Results Volatile extracts from the smoke of burning dried leaves were found to be more repellent than those from fresh leaves, which in turn were more repellent to mosquitoes than volatiles from dried leaves. Of all smoke and fresh volatile extracts, those from Co. citriodora (52-76% and Oc. suave (58-68% were found to be the most repellent, Os. integrifolia (29-56% to be intermediate while Ol. europaea (23-40% and Os. integrifolia (19-37% were the least repellent. One volatile present in each of the fresh leaf extracts of Co. citriodora, Oc. suave and Os. integrifolia was ß-ocimene. The levels of ß-ocimene reflected the mosquito repellent activity of these three fresh leaf extracts. Female host-seeking mosquitoes responded dose-dependently to ß-ocimene, both physiologically and behaviourally, with a maximal behavioural repulsion at 14% ß-ocimene. ß-ocimene (14% repels mosquitoes in our 6-minute landing assays comparable to the synthetic insect repellent N,N-diethyl-m-toluamide (10% DEET. Conclusions Volatiles in the smoke of burning as well as fresh leaves of Co. citriodora and Oc. suave have significant repellent properties against host seeking An. arabiensis and Ae. aegypti mosquitoes. ß-ocimene, present in the fresh leaf headspace of Co. citriodora, Oc. suave and Os. integrifolia, is a significantly effective volatile mosquito
Metode Cepat Identifikasi Flavonoid dari Daun Ocimum sanctum L. (Selasih
Directory of Open Access Journals (Sweden)
Diah Dhianawaty
2012-03-01
Full Text Available A plant’s effectiveness as a herbal drug comes from its chemical content such as flavonoids. Flavonoids are useful for human body health. Therefore flavonoids content can be used as a marker from the usefulness of a plant, and rapid identification method of flavonoid is needed. The objective of the research was to get a rapid method of flavonoid content identification from Ocimum sanctum. The extraction, isolation and identification of flavonoids from Ocimum sanctum leaves has been done at Medical Chemistry laboratory Faculty of Medicine Universitas Padjadjaran in 2005. Flavonoids were extracted continually by 95% ethanol, were isolated with paper chromatography/cellulose TLC and 2% acetic acid, then continued with elucidation reagents: n-butanol–acetic acid–water, chloroform–acetic acid–water, forestall, 5%, 15%, 35% and 50% acetic acids. Flavonoids were identified with diagnostic reagents and ultraviolet light. Isolation with 2% and 35% acetic acids respectively gave two spots of flavonoids as flavon, FOAc-1 had Rf=0.69 and FOAc-2 had Rf=0.57. The other elucidation reagents gave one spot of flavonoid. In conclusion, isolation with 2% and 35% acetic acids respectively and identification with diagnostic reagent and ultraviolet light is a rapid method for identification of flavonoids content in Ocimum sanctum
An efficient system for in vitro multiplication of Ocimum basilicum ...
African Journals Online (AJOL)
Yomi
2012-03-15
Mar 15, 2012 ... Key words: Axillary shoot sprouting, L-glutamine, medicinal plant, micropropagation, Ocimum basilicum. INTRODUCTION ... different combinations and concentrations in 25 × 145 mm glass .... Glossary of Indian Medicinal.
Wound healing properties of ointment formulations of Ocimum ...
African Journals Online (AJOL)
present work evaluated the phyto-constituents and wound healing properties of ointments formulated with the n-hexane crude bark extract of a plant used folklorically in wound healing, Ocimum gratissimum. The excision wound model was employed in the wound healing studies. The air-dried, size-reduced barks were ...
Sankhalkar, Sangeeta; Vernekar, Vrunda
2016-01-01
Number of secondary compounds is produced by plants as natural antioxidants. Moringa oleifera Lam. and Ocimum tenuiflorum L. are known for their wide applications in food and pharmaceutical industry. To compare phenolic and flavonoid content in M. oleifera Lam and O. tenuiflorum L. by quantitative and qualitative analysis. Phenolic and flavonoid content were studied spectrophotometrically and by paper chromatography in M. oleifera Lam. and O. tenuiflorum L. Higher phenolic and flavonoid content were observed in Moringa leaf and flower. Ocimum flower showed higher phenolic content and low flavonoid in comparison to Moringa. Flavonoids such as biflavonyl, flavones, glycosylflavones, and kaempferol were identified by paper chromatography. Phytochemical analysis for flavonoid, tannins, saponins, alkaloids, reducing sugars, and anthraquinones were tested positive for Moringa and Ocimum leaf as well as flower. In the present study higher phenolic and flavonoid content, indicated the natural antioxidant nature of Moringa and Ocimum signifying their medicinal importance. Moringa oleifera Lam. and Ocimum tenuiflorum L. are widly grown in India and are known for their medicinal properties. Number of secondary metabolites like phenolics and flavonoids are known to be present in both the plants. The present study was conducted with an objective to qualitatively and quantitatively compare the phenolics and flavanoids in these two medicinally important plants.Quantitation of total phenolics and flavanoids was done by spectrophotometrically while qualitative analysis was perfomed by paper chromatography and by phytochemical tests. Our results have shown higher phenolics and flavanoid content in Moringa leaf and flower. However, higher phenolic content was absent in Ocimum flower compared to that of Moringa. Phytochemical analysis of various metabolites such as flavonoids, tanins, sapponins, alkaloids, anthraquinones revealed that both the plant extracts were rich sources of
VOLATILE LEAF OIL CONSTITUENTS OF OCIMUM AMERICANUM ...
African Journals Online (AJOL)
Steam distilled volatile oils from the leaves of Ocimum americanum L. growing in Western Kenya were analysed by GC and GC-MS. A total of 36 compounds, representing a total of 88.51% of the total oil, were identified. The oil was classified as terpinen-4-ol-type according to the terpinen-4-ol content (43.21%). To the best ...
Antimicrobial activity of leaf extracts of Ocimum gratissimum on ...
African Journals Online (AJOL)
The antibacterial activity of different extracts from the leaves of Ocimum gratissimum was tested against Staphylococcus aureus, Escherichia coli, Salmonella typhi and Salmonella typhimurium, pathogenic bacteria that cause diarrhea. These extracts evaluated include cold water extract (CWE), hot water extract (HWE) and ...
Effects of aqueous extract of Ocimum gratissimum on ...
African Journals Online (AJOL)
JTEkanem
2008-04-29
Apr 29, 2008 ... called African basil. It is a shrub commonly found in gardens and around village huts2. Scientifically, it is called. Ocimum gratissimum. It is widely distributed in tropical and warm temperature regions. It is used commonly in folk medicine to treat different diseases such as upper respiratory tract infections ...
Exploring the potential effect of Ocimum sanctum in vincristine-induced neuropathic pain in rats
Directory of Open Access Journals (Sweden)
Jaggi Amteshwar
2010-01-01
Full Text Available Abstract The present study was designed to investigate the ameliorative potential of Ocimum sanctum and its saponin rich fraction in vincristine-induced peripheral neuropathic pain in rats. Peripheral neuropathy was induced in rats by administration of vincristine sulfate (50 μg/kg i.p. for 10 consecutive days. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species (TBARS, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Vincristine administration was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia. Furthermore, vincristine administration was also associated with an increase in oxidative stress and calcium levels. However, administration of Ocimum sanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated vincristine-induced neuropathic pain along with decrease in oxidative stress and calcium levels. It may be concluded that Ocimum sanctum has ameliorative potential in attenuating chemotherapy induced-painful neuropathic state, which may be attributed to decrease in oxidative stress and calcium levels. Furthermore, saponin rich fraction of Ocimum sanctum may be responsible for its noted beneficial effect in neuropathic pain in rats.
Resistance Against Basil Downy Mildew in Ocimum Species.
Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal
2015-06-01
Downy mildew, caused by the oomycete Peronospora belbahrii, is a devastating disease of sweet basil. In this study, 113 accessions of Ocimum species (83 Plant Introduction entries and 30 commercial entries) were tested for resistance against downy mildew at the seedling stage in growth chambers, and during three seasons, in the field. Most entries belonging to O. basilicum were highly susceptible whereas most entries belonging to O. americanum, O. kilimanadascharicum, O. gratissimum, O. campechianum, or O. tenuiflorum were highly resistant at both the seedling stage and the field. Twenty-seven highly resistant individual plants were each crossed with the susceptible sweet basil 'Peri', and the F1 progeny plants were examined for disease resistance. The F1 plants of two crosses were highly resistant, F1 plants of 24 crosses were moderately resistant, and F1 plants of one cross were susceptible, suggesting full, partial, or no dominance of the resistance gene(s), respectively. These data confirm the feasibility of producing downy mildew-resistant cultivars of sweet basil by crossing with wild Ocimum species.
Phytochemical characterization of essential oil from Ocimum selloi
Directory of Open Access Journals (Sweden)
LILIA A.S. MORAES
2002-03-01
Full Text Available Ocimum selloi Benth, a native plant of Brazil, has medicinal uses as anti-diarrheic, antispasmodic and anti-inflammatory product. The yield of essential oils of the inflorescences, containing flowers and seeds, was 0.6%, and the yield of leaves, collected in two different seasons, was 0.25% (June 2000 and 0.20% (January 2001, respectively. The essential oils of the inflorescences and leaves presented as major constituents trans-anethol (41.34%, 45.42%, 58.59% and methyl chavicol (27.10%, 24.14%, 29.96%.Ocimum selloi Benth, planta nativa do Brasil de uso medicinal, tem sido utilizada como antidiarréico, antiespasmódico e antiinflamatório. O rendimento dos óleos essenciais das inflorescências, contendo flores e sementes, foi de 0,6% e das folhas, coletadas em duas épocas do ano, foi de 0,25% (junho/00 e 0,20% (janeiro/01, respectivamente. Os óleos essenciais das inflorescências e folhas apresentaram como constituintes majoritários o trans-anethol (41,34%, 45,42%, 58,59% e methyl chavicol (27,10%, 24,14%, 29,96%.
Variation of Ursolic Acid Content in Eight Ocimum Species from Northeastern Brazil
Directory of Open Access Journals (Sweden)
Selene M. Morais
2008-10-01
Full Text Available Ursolic acid is a very important compound due to its biological potential as an anti-inflammatory, trypanocidal, antirheumatic, antiviral, antioxidant and antitumoral agent. This study presents the HPLC analysis of ursolic acid (UA content in eight different Ocimum species: O. americanum L., O. basilicum L, O. basilicum var purpurascens Benth, O. basilicum var. minimum L, O. gratissimum L, O. micranthum Willd, O. selloi Benth. and O. tenuiflorum L. grown in Northeastern Brazil. In these Ocimum species, UA was detected in different yields, with O. tenuiflorum showing the highest content (2.02%. This yield is very significant when compared with other sources of UA.
Directory of Open Access Journals (Sweden)
Viviane Rodrigues de Sousa
2013-06-01
Full Text Available Calycomyza hyptidis Spencer (Diptera, Agromyzidae: descriptions, redescriptions and first record in Ocimum basilicum (Lamiaceae in Brazil. All phases of the leafminer Calycomyza hyptidis Spencer are for the first time described, including the larva, puparium and adult female. Illustrations are presented for male and female terminalia, mine, larva and pupa. The species is first recorded in leaves of Ocimum basilicum L. (Lamiaceae in Brazil.
In vitro multiplication of Ocimum gratissimum L. through direct ...
African Journals Online (AJOL)
The objective of this study was to develop a rapid system for regeneration of the important medicinal plant, Ocimum gratissimum L, from nodal explant. Single node explants were inoculated on basal MS (Murashige and Skoog, 1962) medium containing 3% (w/v) sucrose, supplemented with different concentrations and ...
Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...
African Journals Online (AJOL)
We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum ...
short communication the effect of ocimum sanctum and ledum
African Journals Online (AJOL)
Preferred Customer
SHORT COMMUNICATION. THE EFFECT OF OCIMUM SANCTUM AND LEDUM PALUSTRE ON SERUM URIC. ACID LEVEL IN PATIENTS ... It is a metabolic disorder characterized by abnormally high levels of uric acid in the blood. The pain and swelling due to gout can be sudden and may appear and disappear over ...
The Effect Of Ocimum Gratissimum (Ram Tulsi) On Sexual ...
African Journals Online (AJOL)
The suspension of the extract of Ocimum gratissimum Linn. was administered orally at the dose of 100, 250, and 500 mg / kg body weight, to different groups of male rats (n = 6) once a day for seven days. The female Swiss Albino mice involved in mating were made receptive by hormonal treatment. The general mating ...
Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer
International Nuclear Information System (INIS)
Reshma, K.; Rao, A.V.; Dinesh, M.; Vasudevan, D.M.
2008-01-01
Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)
Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer
Energy Technology Data Exchange (ETDEWEB)
Reshma, K [Department of Biochemistry, Kasturba Medical College, Mangalore (India); Rao, A V [Fr. Muller' s Medical College, Mangalore (India); Dinesh, M [Department of Oncology, Amritha Institute of Medical Sciences, Cochin (India); Vasudevan, D M [Dept. of Biochemistry, Amritha Institute of Medical Sciences, Cochin (India)
2008-04-15
Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)
Chemical composition, antioxidative and antimicrobial activity of essential oil Ocimum sanctum L.
Directory of Open Access Journals (Sweden)
Beatović Damir V.
2013-01-01
Full Text Available Ocimum sanctum L. (Lamiaceae sin. Ocimum tenuiflorum L. or Tulsi basil is a plant originating from tropical and subtropical areas of India. It is used in both the traditional and official medicine in India. Tulsi is a type of basil that is insufficiently explored and studied in Europe. The goal of this paper is to determine the chemical composition, antioxidative, and antimicrobial activity of the essential oil Ocimum sanctum L. grown in Serbia. The quantity of essential oil in 100 g of herb (v/w is 0.68%, with 41 components identified in the tested essential oil. The most represented chemical group are sesquiturpene hydrocarbonates with 80.47%. Other groups were much less represented. Sesquiturpene hydrocarbonate β-cariophyllene is a predominant component in the essential oil with 63.80%. The quantity of tested essential oil needed to achieve 50% of inhibition of DPPH radicals is 0.35 μg/ml, and it has high potential to neutralize free radicals. The essential oil exhibited antibacterial activity to all tested strains of bacteria, both Gram-positive and Gram-negative. It affected all strains in an inhibitory way in the interval 0.34-41.50 μl/ml, and in a bactericide way within the range 22.50-124.5 μl/ml. The most sensitive strains of bacteria are Salmonella typhimurium and Escherichia coli, while Listeria monocytogenes and Enterococus faecalis showed greatest resistance. The essential oil exhibited antifugal activity on all tested fungi. It affected all tested fungi in an inhibitory way in the interval 4.42-8.83 μl/ml, and in a microbicide way within the range 10.00-50.00 μl/ml. The most sensitive fungi are: Aspergillus ochraceus, Penicillium ochrochloron and Penicilium funiculosum, while the most resistent one is Aspergillus niger. The tested basil essential oil Ocimum sanctum demonstrated significant antioxidative and antimicrobial effect and may be used as a raw material in food, pharmaceutical and chemical industries.
Herb yield and chemical composition of basil ( Ocimum basilicum L ...
African Journals Online (AJOL)
Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia.
In vitro regeneration of a common medicinal plant, Ocimum sanctum ...
African Journals Online (AJOL)
Embracing micro-propagation method for large scale production of plantlets and also for protection of appropriate germplasm is a prerequisite that needs to be undertaken in order to develop a rapid in vitro regeneration protocol for Ocimum sanctum L. Shoot tips as well as nodal segments were subjected to numerous ...
The effect of fresh leaf Ocimum gratissimum and dried buds Eugenia ...
African Journals Online (AJOL)
Bulletin of Animal Health and Production in Africa ... Abstract. The use of antibiotics has lead to antibiotic resistance and residual effects among others in fish tissue thus necessitate the advocate for alternative natural plants for ... Keywords: Antimicrobial, aquaculture, Eugenia caryophyllata, extracts, Ocimum gratissimum ...
Hepatoprotective effect of basil ( Ocimum basilicum L.) on CCl 4 ...
African Journals Online (AJOL)
The hepatoprotective effect of basil (Ocimum basilicum) extract against liver fibrosis-induced by carbon tetrachloride (CCl4) was studied in rats. Rats were allocated into five groups: Group I (control group); Group II [CCl4 group; rats were injected subcutaneously with CCl4 (1 ml/kg b.w.) twice weekly for 4 weeks ...
DEFF Research Database (Denmark)
Casanova, Livia Marques; Gu, Wenqian; Costa, Sônia Soares
2017-01-01
ABSTRACT: Ocimum gratissimum and Ocimum basilicum are plants ethnopharmacologically used to treat diabetes mellitus, a life-threatening disease that affects millions of people worldwide. In order to further understand their antidiabetic potential, which has been previously demonstrated in animal...
Estudio farmacognóstico de ocimum basilicum l. (albahaca blanca
Directory of Open Access Journals (Sweden)
Ester Sánchez Govín
2000-12-01
Full Text Available Ocimum basilicum L. (albahaca blanca es una de las plantas aromáticas que se clasifican por la composición química de su aceite. Se investigó la variedad lactucaefolium que posee propiedades antisépticas, antiinflamatorias y antiespasmódicas. Se determinaron los índices numéricos en esta especie y se estandarizó el perfil cromatográfico a partir de su aceite esencial. El estudio de conservación muestra que el tiempo óptimo de almacenamiento en frasco de vidrio y sobres de polietileno es de 10 meses.Ocimum basilicum L. (white sweet basil is one of the aromatic plants that is classified according to the chemical composition of its oil. The lactucaefolium variety that has antiseptic, antiinflammatory and antispasmodic properties was investigated. The numerical indexes were determined in this species and the chromatographic profile was standardized starting from its essential oil. The conservation study shows that the optimum time of storage in glass flasks and polyethylene bags is of l0 months.
Anti-diabetic Potential of the Aqueous Leaf Extracts of Ocimum ...
African Journals Online (AJOL)
The anti-diabetic potential of aqueous extracts of leaves of both Ocimum gratissimum and Vernonia amygdalina were investigated in rabbits. Ten female rabbits were grouped into five groups (1-5) of two rabbits each. Group 1 is the control. Groups (2-5) was alloxan induced diabetic. Group 3 was then treated with 200mg/kg ...
Energy Technology Data Exchange (ETDEWEB)
Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania); Cobzac, Simona Codruta, E-mail: loredana.soran@itim-cj.r [Babes-Bolyai University, Faculty of Chemistry and Chemical Engineering, 11 Arany Janos, 400028 Cluj-Napoca (Romania)
2009-08-01
Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: {alpha} and {beta}-pinene (mixture), limonene, citronellol, and geraniol.
International Nuclear Information System (INIS)
Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile; Cobzac, Simona Codruta
2009-01-01
Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: α and β-pinene (mixture), limonene, citronellol, and geraniol.
Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice?
Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad
2017-10-01
Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.
Acaricidal Effect of Foam Soap Containing Essential Oil of Ocimum ...
African Journals Online (AJOL)
Acaricidal effect of foam soap containing essential oil of Ocimum gratissimum leaves was tested on Rhipicephalus lunulatus in western highland of Cameroon. Five doses of essential oil (0.00; 0.04; 0.06; 0.08; 0.10 μl/g) with four replications for each dose were tested in vitro. Each replication consisted of 10 ticks in Petri dish ...
Directory of Open Access Journals (Sweden)
Pramono Putro Utomo
2013-12-01
Full Text Available Aloe vera dodol is a traditional food of West Kalimantan that has short shelf life because of its microbial activity. Antimicrobial edible packaging could be used to maintain the quality of packaged food product actively.The purpose of this study is to prolong the shelf life of food products using antimicrobial edible packaging from durian peel and basil (Ocimum sanctum L. essential oil. The research was conducted through 4 phases,i.e. the extraction of pectin from durian peel, basil essential oil distillation, Aspergillus flavus inhibition assay, and antimicrobial edible coating production incorporated with Ocimum sanctum L. essential oil. The results showed that pectin extracted from durian peel at pH 4.5 could give yield of 5.9% with a clear coat (Colourless.The concentration of Ocimum sanctum L. essential oil by 0.6% could inhibit the growth of Aspergillus flavus and prolong the shelf life when applied as an antimicrobial ingredient in edible coating.
Directory of Open Access Journals (Sweden)
Akono Ntonga Patrick
2014-01-01
Full Text Available The biological activities of essential oils from three plants grown in Cameroon: Ocimum basilicum, Ocimum canum, and Cymbopogon citratus were tested against Plasmodium falciparum and mature-stage larvae of Anopheles funestus. Gas chromatography and gas chromatography – mass spectrometry analyses showed that the main compounds are geranial, 1,8-cineole and linalool in C. citratus, O. canum and O. basilicum, respectively. Larvicidal tests carried out according to the protocol recommended by the World Health Organization showed that the essential oil of leaves of C. citratus is the most active against larvae of An. funestus (LC50 values = 35.5 ppm and 34.6 ppm, respectively, for larval stages III and IV after 6 h of exposure. Besides, the in vitro anti-plasmodial activity evaluated by the radioisotopic method showed that the C. citratus oil is the most active against P. falciparum, with an IC50 value of 4.2 ± 0.5 μg/mL compared with O. canum (20.6 ± 3.4 μg/mL and O. basilicum (21 ± 4.6 μg/mL. These essential oils can be recommended for the development of natural biocides for fighting the larvae of malaria vectors and for the isolation of natural products with anti-malarial activity.
Directory of Open Access Journals (Sweden)
Emmanuel Anyachukwu Irondi
2016-12-01
Full Text Available Aim: To evaluate the phenolics composition and inhibitory effect of the leaves extracts of Ocimum basilicum (O. basilicum and Ocimum gratissimum (O. gratissimum on two key enzymes [pancreatic lipase (PL and angiotensin 1-converting enzyme (ACE] involved in obesity and hypertension in vitro. Methods: The phenolics (flavonoids and phenolic acids were quantified using high performance liquid chromatrography coupled with diode array detection (HPLC-DAD. PL and ACE inhibitory effects; and DPPH* and ABTS*+ scavenging activities of the extracts were tested using Spectrophotometric methods. Results: O. basilicum had the following major phenolics: rutin, quercetin and quercitrin (flavonoids; caffeic, chlorogenic and gallic acids (phenolic acids; while O. gratissimum had the following major phenolics: rutin, quercitrin and luteolin (flavonoids; ellagic and chlorogenic acids (phenolic acids. Extracts of both plants inhibited PL and ACE; and scavenged DPPH* in a dose-dependent manner. O. gratissimum extract was more potent in inhibiting PL (IC50: 20.69 μg/mL and ACE (IC50: 29.44 μg/mL than O. basilicum (IC50: 52.14 μg/mL and IC50: 64.99 μg/mL, against PL and ACE, respectively. O. gratissimum also scavenged DPPH* and ABTS*+ more than O. basilicum. Conclusion: O. basilicum and O. gratissimum leaves could be used as functional foods for the management of obesity and obesity-related hypertension. However, O. gratissimum may be more effective than O. basilicum. [J Complement Med Res 2016; 5(4.000: 396-402
Mosquitocidal and water purification properties of Ocimum sanctum and Phyllanthus emblica
Directory of Open Access Journals (Sweden)
Kadarkarai Murugan
2012-12-01
Full Text Available Ocimum sanctum was tested for its larvicidal and water sedimentation properties; the fruit ethanol and methanol extracts of Phyllanthus emblica were tested for phytochemical, larvicidal, oviposition-deterrent and ovicidal activities. Results emphasized that plant extracts have high toxicity against the egg and larvae of the malarial vector Anopheles stephensi and also have water sedimentation properties. LC50 of Phyllanthus emblica against Anopheles stephensi larvae ranged from 33.08 ppm to 81.26 ppm and from 23.44 to 54.19 ppm for ethanol and methanol extracts, respectively. Phyllanthus emblica also showed excellent ovipositional deterrent and ovicidal activities. The oviposition activity index value of ethanol and methanol extracts of Phyllanthus emblica at 500 ppm were -0.80 and -0.92, respectively. Ocimum sanctum includes both insecticidal secondary compounds, amino acids (glycine, lysine, vitamin C and other substances, that make treated water suitable for human consumption. Water quality parameters such as color, turbidity and pH were analyzed in the water samples (pre-treatment and post-treatment of plant extracts taken from the breeding sites of mosquitoes. Hence, the plant product can be used as both mosquitocidal and water purifier.
Directory of Open Access Journals (Sweden)
M. K. Gautam
2014-01-01
Full Text Available The present study was aimed to study the acute and subacute toxicity studies with orally administered 50% ethanolic leaves extract of Ocimum sanctum Linn (OSE. In acute toxicity tests, four groups of mice (n=6/group/sex were orally treated with doses of 200, 600, and 2000 mg/kg, and general behavior, adverse effects, and mortality were recorded for up to 14 days. In subacute toxicity study, rats received OSE by gavage at the doses of 200, 400, and 800 mg/kg/day (n=6/group/sex for 28 days, and biochemical, hematological, and histopathological changes in tissues (liver, kidney, spleen, heart, and testis/ovary were determined. OSE did not produce any hazardous symptoms or death and CNS and ANS toxicities in the acute toxicity test. Subacute treatment with OSE did not show any change in body weight, food and water consumption, and hematological and biochemical profiles. In addition, no change was observed both in macroscopic and microscopic aspects of vital organs in rats. Our result showed that Ocimum sanctum extract could be safe for human use.
First report of Alfalfa mosaic virus infecting basil (Ocimum basilicum L.) in California.
Basil (Ocimum basilicum L.) plants collected from a field in Imperial County, CA in May, 2011 were found to exhibit yellowing, chlorotic sectors and spots on leaves, resulting in plants being unmarketable. Total nucleic acid was extracted from plants and tested by RT-PCR for the presence of Alfalfa...
Morphological and chemical variability of Ocimum basilicum L. (Lamiaceae
Directory of Open Access Journals (Sweden)
Renata Nurzyńska-Wierdak
2013-04-01
Full Text Available Morphological features of 17 sweet basil cultivars as well as essential oil content and composition were determined. The study clearly indicated great variability of Ocimum basilicumL. The content of essential oil in the dried herb was high and varied from 0.75% (O. basilicumvar. piperita to 1.89% (O. basilicumvar. cinnamon. Based of the primary components, three chemotypes were distinguished: citral (‘Lime’, ‘Lemon’ and var. citriodorum, E-methyl cinnamate/linalool (‘Licorice’, var. cinnamon and methyl chavicol (‘Tai’.
Directory of Open Access Journals (Sweden)
Safwan
2016-10-01
Full Text Available We have conducted a research on the effect of the extract of leaves basil (Ocimum sanctum L on male mice to investigate the consentration and motility spermatozoa mice. Twoty male mice which has age about 2 months with wight 20 – 25 g were divided into four groups. The extract was provided orally daily until the 20 th day. At 21th day were sacrificed and determine of consentration and motility. The result of the research showed that the extract of Ocimum sanctum L leaves that being given during 20 days with the dosage of 50 mg/g body weight, 100 mg/g bw, and 250 mg/g bw could signifi increase the consentration and motility spermatozoa mice.
Utilization of heavy metal-rich tannery sludge for sweet basil (Ocimum basilicum L.) cultivation.
Chand, Sukhmal; Singh, Shweta; Singh, Vinay Kumar; Patra, D D
2015-05-01
Unlike food crops, essential oil-bearing crops in which the oil is extracted through hydro-distillation can be a suitable crop to be grown in heavy metal-polluted soils as the oil does not carry any heavy metal. In a field experiment conducted at CIMAP, Lucknow, India during 2011 and 2012, influence of six doses of tannery sludge viz 0, 10, 20, 30, 40, and 50 t ha(-1) were tested, taking sweet basil (Ocimum basilicum) as the test crop. Maximum herb yield was obtained with the application of sludge at 20 t ha(-1). While in root, accumulation of Cd and Pb increased significantly up to 20 t ha(-1), Cr accumulation increased with increasing the dose of tannery sludge reaching maximum at 50 t ha(-1). Essential oil yield of basil (Ocimum basilicum) was significantly affected due to sludge application. Quality of essential oil, in term of chemical constituents, however, was marginally influenced due to tannery sludge application.
Agronomic and physiological impacts of irrigation frequency on green basil (Ocimum basilicum L.)
Gao, Peng; Dodd, Ian
2015-01-01
Water scarcity is a major factor restricting agricultural production and irrigation globally, with sustainable agricultural development calling for less irrigation water use and more production per unit of water applied. Improved understanding of plant physiological responses to water stress, and the effect of irrigation frequency on plant biomass production and quality, may help to optimize irrigation scheduling. Glasshouse-grown basil (Ocimum basilicum L.) received three different irrigatio...
Analyzing the structural aspects of Isoprenoid biosynthesis pathway proteins in Ocimum species
Directory of Open Access Journals (Sweden)
Muktesh Chandra
2017-10-01
Full Text Available Generally thought that the extremely diverse array of secondary metabolites observed within Ocimum species defends against a comparable diverse array of biotic pests, pathogens and herbivores encountered around its natural range. Along with defense the diverse array of secondary metabolite also leads to the therapeutic and remedial property which justifies Ocimum as natural medicinal and aromatic casket. Many of the defense compounds, aroma compounds and medicinal derivatives are secondary metabolites isolated from trichome glands, mainly consist of terpenoids as well as phenylpropanoids. Various pathways fabricating these compounds are known viz. mevalonate pathway (MVA, phenylpropanoid pathway and MEP pathways. The enzyme cascade responsible for various secondary metabolites, need to be explored in various aspects. Here we had studied the MVA pathway enzymes in O. basilicum and O. gratissimum to figure out variations in enzyme structures due to speciation. Hence, in depth analysis of the transcriptome of O. basilicum and O. gratissimum, varrying in qualitative and quantitative aspects of essential oil were carried out. The transcriptome data from NCBI server was assembled using bioinformatic approaches. nr database at NCBI repository used for annotation, which assigned 60% contigs to known functions. Contigs corresponding to Mevalonate pathway enzymes are isolated using perl pipelines developed in our lab, which were further assembled using CLC workbench to remove redundancy and make larger stretch of sequence. Blastx of these larger sequences assigned them function and they are mapped to validated sequences to make full length. Data from both species led us to overall seven enzymes (total 14 of MVA pathway. These enzymes are studied in detail for various physio-chemical properties, steriochemical properties and motif/domain for protein-protein interaction (PPI study. Homolog models of all enzymes were predicted, against templates from RCSB
Ocimum basilicum L. (sweet basil) is an essential oil producing crop used in culinary and fragrance applications. The objective of this controlled environment study was to evaluate the effects of organic and conventional fertilization, (applied at two nitrogen rates, 150 and 250 kg N/ha), on plant g...
Caamal-Herrera, Isabel O; Carrillo-Cocom, Leydi M; Escalante-Réndiz, Diana Y; Aráiz-Hernández, Diana; Azamar-Barrios, José A
2018-02-08
Ocimum micranthum Willd is a plant used in traditional medicine practiced in the region of the Yucatan peninsula. In particular, it is used for the treatment of cutaneous infections and wound healing, however there are currently no existing scientific studies that support these applications. The aim of the present study was to evaluate the antimicrobial and the in vitro proliferative activity (on healthy mammalian cell lines) of the essential oil and extracts (aqueous and ethanolic) of this plant. The minimal inhibitory concentration (MIC) of essential oil and aqueous and ethanolic extracts of Ocimum micranthum leaves against Staphylococcus aureus, Bacillus subtilis, Pseudomonas aeruginosa and Candida albicans was determined using the microdilution technique. The in vitro proliferative activity of human fibroblast (hFB) and Chinese hamster ovary (CHO-K1) cells treated with these extracts was evaluated using the MTT test. The hFB cell line was also evaluated using Trypan Blue assay. Candida albicans was more susceptible to the ethanolic extract and the aqueous extract (MIC value of 5 μL/mL and 80 μL/mL respectively). In the case of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa, the MIC of the aqueous and ethanolic extract was 125 μL/mL. The aqueous extract showed a significant (p essential oil and extracts of Ocimum micranthum leaves are sufficient to cause an antiproliferative effect on the hFB cell line but do not produce an antimicrobial effect against the microorganisms evaluated. More studies are necessary to improve understanding of the mechanism of action of the compounds implicated in the bioactivities shown by the crude extracts.
Antibacterial activity of Ocimum gratissimum L. essential oil
Directory of Open Access Journals (Sweden)
Celso Vataru Nakamura
1999-09-01
Full Text Available The essential oil (EO of Ocimum gratissimum inhibited Staphylococcus aureus at a concentration of 0.75 mg/ml. The minimal inhibitory concentrations (MICs for Shigella flexineri, Salmonella enteritidis, Escherichia coli, Klebsiella sp., and Proteus mirabilis were at concentrations ranging from 3 to 12 mg/ml. The endpoint was not reached for Pseudomonas aeruginosa (>=24 mg/ml. The MICs of the reference drugs used in this study were similar to those presented in other reports. The minimum bactericidal concentration of EO was within a twofold dilution of the MIC for this organism. The compound that showed antibacterial activity in the EO of O. gratissimum was identified as eugenol and structural findings were further supported by gas chromatography/mass spectra retention time data. The structure was supported by spectroscopic methods.
Directory of Open Access Journals (Sweden)
IVÁN ALONSO MONTOYA RESTREPO
2013-01-01
Full Text Available La propuesta teórica que se presenta, se relaciona con la formación de la estrategia desde una pers - pectiva evolutiva y con conexiones entre estrategias deliberadas y emergentes, gracias al empleo de definiciones básicas o raíces, empleando la metodología de sistemas suaves SSM propuesta por Checkland & Scholes (1994. Para ello se propone la interacción de entes “autónomos” y semió - ticos (agentes, organizaciones y entorno en los sistemas real y representacional de interacciones. Estas nociones permiten la elaboración de los conceptos de decisión, actuación e intencionalidad. Se reelaboran las nociones de estrategia deliberada y emergente y se detalla un ciclo de operación entre tales tipos de estrategia.
DEFF Research Database (Denmark)
Nguefack, J.; Dongmo, J. B. Lekagne; Dakole, C. D.
2009-01-01
The food preservative potential of essential oils from three aromatic plants Cymbopogon citratus, Ocimum gratissimum and Thymus vulgaris and their fractions was investigated against two mycotoxigenic strains each of Aspergillus ochraceus, Penicillium expansum and P. verrucosum. The fungicidal...
Tomato chlorotic spot virus (TCSV) has been recently detected in tomato, pepper, hoya and vinca in Florida. Observations of additional crops in 2016 and 2017 revealed TCSV-like symptoms. Testing of these symptomatic plants identified three new hosts of TCSV in Florida: sweet basil (Ocimum basilicu...
Bantis, Filippos; Ouzounis, Theoharis; Radoglou, Kalliopi
2016-01-01
The morphological and phytochemical characteristics of two Ocimum basilicum cultivars (Lettuce Leaf, and Red Rubin-mountain Athos hybrid) under artificial lighting were investigated. Four LED light treatments [AP673L (high red and high red:far-red), G2 (high red and low red:far-red), AP67
Directory of Open Access Journals (Sweden)
Isaac Andrade-González
2012-02-01
Full Text Available Volatile compounds of basil (Ocimum basilicum L. were extracted with solid phase microextraction(SPME and analyzed with gas chromatography-mass spectrometry (GC-MS. TwoSPME fiber coatings, Polydimethylsiloxane/Divinylbenzene (PDMS/DVB, 65 μm and Carbowax/Divinylbenzene (CW/DVB, 65 μm were evaluated in order to compare the extraction ofcomponents. Among the 25 volatile compounds detected were phenylpropanoids, monoterpenes,sesquiterpenes, esters, and aldehydes. There were significant (P Los compuestos volátiles de la albahaca (Ocimum basilicum L. fueron extraídos mediante la microextracción en fase sólida (SPME y analizados con cromatografía de gases-espectrometría de masas (GC-MS. Se evaluaron dos fibras, Polidimetilsiloxano/Divinilbenceno (PDMS/DVB, 65 μm y Carbowax/Divinilbenceno (CW/DVB, 65 μm, para comparar la extracción de componentes. Entre los 25 compuestos volátiles recuperados en la albahaca, se identificaron fenilpropanoides, monoterpenos, sesquiterpenos, ésteres, y aldehídos. Hubieron diferencias significativas (P Cuantitativamente, el componente más importante fue el cinamato de metilo, seguido por el linalol.
Directory of Open Access Journals (Sweden)
José Roberto Pinto de Souza
2005-06-01
Full Text Available Previous studies showed that ethanolic extract of Ocimum gratissimum inhibited growth of Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger and Alternaria sp, isolated from tomato and carrot. The aim of this study was to identify the chemical constituents of Ocimum gratissim. Aerial parts of the plant were treated with hexane-dichloromethane-ethanol mixture (1:3:1 at room temperature. The obtained extract was chromatographed on silica gel column eluted with hexane, dichloromethane and ethanol. Fractions eluted with dichloromethane were rechromatographed on a column of silica gel to yield alyphatic hydrocarbon mixture (C31, C33, C34 e C35, eugenol, caryophyllene oxide and a mixture of stigmasterol and sitosterol. The structures of the compounds were deduced by spectral data analysis and by comparison with literature values. Recent studies showed that eugenol is probably one of the responsibles for antifungal activity of O. gratissimum.Ensaios anteriores de atividade antifúngica do extrato etanólico de Ocimum gratissimum, utilizando a técnica de difusão em meio sólido, evidenciaram a inibição do crescimento de Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger e de duas espécies de Alternaria sp isoladas de tomate e de cenoura. O objetivo deste trabalho foi identificar os possíveis constituintes químicos responsáveis pela atividade antifúngica da planta, por meio de estudo químico do extrato hexano-diclorometano-etanol (1:3:1 das partes aéreas de O. gratissimum. O extrato foi cromatografado em coluna de sílica gel, eluída com hexano, diclorometano e etanol. A purificação em coluna cromatográfica de sílica gel das frações eluídas com diclorometano (5,9g resultou na obtenção de quatro constituintes: uma mistura de hidrocarbonetos saturados de cadeia longa (C31, C33, C34 e C35, eugenol, óxido de cariofileno e uma mistura de estigmasterolsitosterol. Os constituintes foram identificados através das an
Directory of Open Access Journals (Sweden)
Leila Aceneth Durán Gaviria
2016-01-01
Full Text Available The genus Ocimum with over 150 species is characterized by high morphological variability and Chemotypes of great value in the industries of perfumery, cosmetics, food and pharmaceutical features. In order to evaluate the physiological quality of the seeds, in the Experimental Center and the Laboratory of Plant Physiology at the National University of Colombia at Palmira, germination and viability tests were performed with 2,3,5 triphenyl tetrazolium, TTZ. In trials, using a factorial design with five varieties of seeds, three treatments and three replications, the effect of imbibing the seeds for five minutes in Potassium nitrate 0.2% KNO3 and gibberellic acid GA3 250 ppm and 500 ppm respectively as first irrigation and a control (water was evaluated. The results showed that the seeds from the species O. selloi had the highest percentage (90% of viability in TTZ and germination (46.2%. The seeds soaked in 0.2% KNO3 showed the highest values of seed germination in three of the five varieties tested. The best responses were obtained with germination seeds O.selloi species (70% and O. micranthum (58%, followed by Ocimum sp. (26%. The results showed the presence of varying levels of latency, which was partially overcome by the application of potassium nitrate (KNO 3 0.2%.
The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.
Andréa Santos da Costa; Maria de Fátima Arrigoni-Blank; Maria Aparecida Azevedo Pereira da Silva; Mércia Freitas Alves; Darlisson de Alexandria Santos; Péricles Barreto Alves; Arie Fitzgerald Blank
2014-01-01
The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component an...
Directory of Open Access Journals (Sweden)
Asep Kadarohman
2011-06-01
Full Text Available The chemical composition and antibacterial activity of basil oil (Ocimum americanum L. against Escherichia coli, Shigellasonnei and Salmonella enteritidis have been determined. Basil oils were isolated from leaves and stems of basil (Ocimum americanumL. with percolation method and analyzed by FTIR and GC-MS spectrometry. The antibacterial activity of basil oils were obtained byAgar diffusion method with various concentration (v/v 2, 4, 6, 8, and 10% with ethanol p.a. as negative control, thiamfenicol, andtetracycline 500 mg as positive control. The produces essential oils from leaves and stems of basil by percolation are 1.06 and 0.22%,respectively. There are 22 components of basil oil were identifi ed, with a major component are citral (35.58% and neral (29.56% .Basil oil has not effectively against Escherichia coli and Shigella sonnei but effectively against Salmonella enteritidis at concentration 8 and 10%, with inhibition zone diameter are 10.25 and 10.93 mm respectively.
Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum
International Nuclear Information System (INIS)
Sahito, S.; Kazi, G.H.; Kazi, T.; Hafeez-u-Raman Shaikh; Memon, A.N.
2003-01-01
The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)
Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum
Energy Technology Data Exchange (ETDEWEB)
Sahito, S; Kazi, G H; Kazi, T [University of Sindh, Jamshoro (Pakistan). Centre of Excellence in Analytical Chemistry; Shar, G Q [Liaquat Univ. of Health and Sciences, Jamshoro (Pakistan); Shaikh, Hafeez-u-Raman [University of Sindh, Jamshoro (Pakistan). Inst. of Biochemistry; Memon, A N [University of Sindh, Jamshoro (Pakistan). Dept. of Botany
2003-06-01
The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)
Directory of Open Access Journals (Sweden)
Ailton Reis
2007-06-01
Full Text Available O manjericão (Ocimum basilicum L. é uma hortaliça da família Lamiaceae, utilizada na culinária ou como matéria prima para a indústria de fármacos e óleos essenciais. Amostras de plantas de manjericão apresentando sintomas de murcha, seca de hastes e podridão de colo foram coletadas na área rural de Brazlândia (DF durante a estação chuvosa de 2005. Outras duas amostras foram coletadas em plantas cultivadas em campo aberto e casas de vegetação na região de Ponte Alta (DF. Isolados de um fungo, identificado como Fusarium oxysporum, foram obtidos em todas as amostras. Testes de patogenicidade foram conduzidos com mudas das cultivares O. basilicum 'Dark Opal' e 'Italian Large Leaf', e de acessos das espécies O. americanum L. (manjericão de folha miúda, O. campechianum Mill. (alfavaca, Origanum manjorana L. (manjerona, Origanum vulgare L. (orégano, Mentha arvensis L. (menta, Coleus blumei Benth. (tapete, Leonorus sibiricus L. (rubim e Leonotis nepetaefolia (L. W.T. Aiton (cordão-de-frade. Todos os isolados fúngicos mostraram-se altamente virulentos sobre as duas cultivares de manjericão. Em O. campechianum e O. americanum os isolados causaram apenas suave escurecimento vascular e leve redução de crescimento, sendo avirulentos sobre acessos das espécies O. manjorana, O. vulgare, M. arvensis, C. blumei, L. sibiricus e L. nepetaefolia. Este conjunto de dados indicou que o agente causal da doença é o fungo F. oxysporum f. sp. basilici, constituindo-se no primeiro registro formal deste patógeno no Brasil. Os lotes de sementes utilizados nas áreas de ocorrência da doença foram submetidos a um teste de sanidade visando verificar a presença do patógeno. O fungo F. oxysporum f. sp. basilici foi detectado em quatro dos seis lotes e os isolados obtidos das sementes contaminadas mostraram similar sintomatologia e um idêntico perfil de virulência aos verificados em campo e casa de vegetação, sugerindo que as sementes
Directory of Open Access Journals (Sweden)
M. Shyamala
2011-01-01
Full Text Available A comparative study of the inhibitory effect of plant extracts, Ocimum sanctum, Aegle marmelos, and Solanum trilobatum, on the corrosion of mild steel in 1N HCl medium was investigated using weightloss method, electrochemical methods, and hydrogen permeation method. Polarization method indicates plant extracts behave as mixed-type inhibitor. The impedance method reveals that charge-transfer process mainly controls the corrosion of mild steel. On comparison, maximum inhibition efficiency was found in Ocimum sanctum with 99.6% inhibition efficiency at 6.0% v/v concentration of the extract. The plant extracts obey Langmuir adsorption isotherm. The SEM morphology of the adsorbed protective film on the mild steel surface has confirmed the high performance of inhibitive effect of the plant extracts. From hydrogen permeation method, all the plant extracts were able to reduce the permeation current. The reason for the reduced permeation currents in presence of the inhibitors may be attributed to the slow discharge step followed by fast electrolytic desorption step. Results obtained in all three methods were very much in good agreement in the order Ocimum sanctum > Aegle marmelos > Solanum trilobatum.
Directory of Open Access Journals (Sweden)
Rajendra Chandra Padalia
2017-03-01
Full Text Available The essential oils obtained from hydrodistillation of Ocimum basilicum L. harvested at four different growth stages during spring-summer and rain-autumn cropping seasons , were characterized using GC and GC-MS. The e ssential oil yield was found to vary from 0.28–0.32% and 0.40–0.52% during spring-summer and rain-autumn cropping season, respectively with its maximal at full bloom stage. Altogether , forty constituents, comprising 94.9–98.3% were identified represented by ( E -methyl cinnamate (36.6 – 66.4%, linalool (11.2 – 43.8%, and (Z -methyl cinnamate (5.4-7.6% as main constituents. Results showed that growth stages strongly influenced the chemical composition of the essential oil in two cropping seasons, particularly concerning to the content of ( E -methyl cinnamate and linalool. Seed setting stage was optimized for harvesting ( E -methyl cinnamate rich oil (66.4% in rain-winter cropping season. The antimicrobial potential of the essential oil was tested againist eight pathogenic bacteria and three fungal strains. Antimicrobial assay showed that the essential oil possessed good antibacterial activity against Streptococcus mutans, Staphylococcus epidermidis, Escherichia coli , and antifungal activity against Candida kefyr and Candida albicans. Ocimum basilicum , essential oil, ( E - methyl cinnamate, linalool, antibacterial activity, antifungal activity
Rodrigues, Lindaiane Bezerra; Oliveira Brito Pereira Bezerra Martins, Anita; Cesário, Francisco Rafael Alves Santana; Ferreira E Castro, Fyama; de Albuquerque, Thaís Rodrigues; Martins Fernandes, Maria Neyze; Fernandes da Silva, Bruno Anderson; Quintans Júnior, Lucindo José; da Costa, José Galberto Martins; Melo Coutinho, Henrique Douglas; Barbosa, Roseli; Alencar de Menezes, Irwin Rose
2016-09-25
The genus Ocimum are used in cooking, however, their essential oils are utilized in traditional medicine as aromatherapy. The present study was carried out to investigate the chemical composition and systemic anti-inflammatory activity of the Ocimum basilicum essential oil (EOOB) and its major component estragole, as well as its possible mechanisms of action. The Ocimum basilicum essential oil was obtained by hydrodistillation and analyzed by GC-MS. The anti-inflammatory action was verified using acute and chronic in vivo tests as paw edema, peritonitis, and vascular permeability and granulomatous inflammation model. The anti-inflammatory mechanism of action was analyzed by the participation of histamine and arachidonic acid pathways. The chemical profile analysis identified fourteen components present in the essential oil, within them: estragole (60.96%). The in vivo test results show that treatment with EOOB (100 and 50 mg/kg) and estragole (60 and 30 mg/kg) significantly reduced paw edema induced by carrageenan and dextran. The smallest doses of EOOB (50 mg/kg) and estragole (30 mg/kg) showed efficacy in the reduction of paw edema induced by histamine and arachidonic acid, vascular permeability inhibition and leukocyte emigration in the peritoneal fluid. Theses doses were capable of reducing the chronic inflammatory process. The results observed between the EOOB and estragole demonstrate efficacy in anti-inflammatory activity, however, the essential oil is more efficacious in the acute and chronic anti-inflammatory action. This study confirms the therapeutic potential of this plant and reinforces the validity of its use in popular medicine. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
International Nuclear Information System (INIS)
Amini, Zeynab; Ong, Hwai Chyuan; Harrison, Mark D.; Kusumo, Fitranto; Mazaheri, Hoora; Ilham, Zul
2017-01-01
Highlights: • Need for alternative energy has led to explore new feedstock. • Ocimum basilicum seeds oil was used as biodiesel feedstock. • Biodiesel was produced via lipase-catalyzed transesterification by Novozym. • Artificial neural network with genetic algorithm modelling was employed. - Abstract: The increasing global demand for fuel, limited fossil fuel resources, and increasing concern about the upturn in gaseous CO_2 emissions are the key drivers of research and development into sources of renewable liquid transport fuels, such as biodiesel. In the present work, we demonstrate biodiesel production from Ocimum basilicum (sweet basil) seed oil by lipase-catalyzed transesterification. Sweet basil seeds contain 22% oil on a dry weight basis. Artificial neural network with genetic algorithm modelling was used to optimize reaction. Temperature, catalyst concentration, time, and methanol to oil molar ratio were the input factors in the optimization study, while fatty acid methyl ester (FAME) yield was the key model output. FAME composition was determined by gas chromatography mass spectrometry. The optimized transesterification process resulted in a 94.58% FAME yield after reaction at 47 °C for 68 h in the presence of 6% w/w catalyst and a methanol to oil ratio of 10:1. The viscosity, density, calorific value, pour point, and cloud point of the biodiesel derived from sweet basil seed oil conformed to the EN 14214 and ASTM D6751 standard specifications. The antioxidant stability of the biodiesel did not meet these specifications but could be improved via the addition of antioxidant.
The anticancer effect of Ocimum tenuiflorum leaves
Directory of Open Access Journals (Sweden)
Lam, S.N.
2017-11-01
Full Text Available Breast cancer is the leading cause of cancer deaths among females in Malaysia. Ocimum tenuiflorum L., (O. tenuiflorum commonly known as ruku in Malaysia, is usually cultivated as a garden ornamental plant because of its small purplish and some yellowish flower. The specific objective of this research is to investigate the anticancer of O. tenuiflorum against human breast cancer cell lines (MCF-7 and MDA-MB-231 and human fibroblast cell line (HS-27. In addition, another objective is to determine the mineral and heavy metal determination of O. tenuiflorum. O. tenuiflorum exhibited anticancer activity against MCF-7 (a hormone-dependent breast cancer cell line. The viability of MCF-7 cells decreased significantly after treatment with various concentrations of methanolic plant extracts (25 and 100 μg/mL, as shown via 3-(4,5-dimethylthiazol-2-yl2,5-diphenyltetrazolium bromide (MTT assay. The crude extracts show the lower IC50 (less than 100 μg/mL value against the cancer cell lines and show no effect on HS-27. The high content of calcium in the leaves of O. tenuiflorum may play a role in decreasing the risk of certain cancer. The concentrations of heavy metals (Pb and As detected in O. tenuiflorum are safe for consumption.
Optimization of the Ocimum basilicum L. extraction process regarding the antioxidant activity
Directory of Open Access Journals (Sweden)
Vidović Senka S.
2012-01-01
Full Text Available The levels of input variables (temperature and extraction solvent that optimize a particular response (total phenols content, total flavonoids content and antioxidant activity of the Ocimum basilicum L. extraction process were determined by the response surface methodology (RSM. The influence of theextraction temperature on extraction process was investigated in the range from 33.8ºC to 76.2ºC, as well as of extraction solvent ethanol, in the range of concentrations from 21.7% to 78.3%. For the preparation of basil dry extract, characterized with minimal IC50 value, the calculated optimal values of temperature and ethanol concentration were: 75.33ºC and 73.66% (w/w. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013
Directory of Open Access Journals (Sweden)
Idelsy Chil-Núñez
2018-05-01
Full Text Available Context: The blowfly Chrysomya putoria is widely distributed throughout the Neotropical region and, besides transmitting pathogens; they could cause secondary myiasis. Botanical insecticides provide an alternative to synthetic pesticides because the excessive use of synthetic insecticides resulted in a progressive resistance of the pests to these chemicals, diminishing their effectiveness and generating consequences with negative environmental impact. The essential oil extracted from Ocimum sanctum (basil has showed insecticidal activity against some insects but has no reported studies on the activity of this plant against flies. Aims: To evaluate the insecticidal effects of Ocimum sanctum var. cubensis Gomes essential oil on the post embryonic development of Chrysomya putoria. Methods: The colonies of Chrysomya putoria were established and maintained at the Laboratório de Entomologia Médica e Forense (FIOCRUZ, Rio de Janeiro, Brazil. The basil essential oil was tested in six concentrations (4.13, 8.25, 20.63, 41.25, 61.87 and 80,25 mg/mL. Mortality and changes in life cycle were recorded daily. Results: β-caryophyllene, β-selinene and eugenol, were the main constituents of the basil essential oil. The experiments demonstrated that in all concentrations tested, this essential oil shortening the duration of all post embryonic stages having a direct impact in the viability of this fly estimating the LC50 in 7.47 mg/mL of concentration. In addition, the essential oil caused morphological alterations in abdomen, wings and ptilinum at lower concentrations. Conclusions: This essential oil emerge as a good option for the control of the disease vector blowfly Chrysomya putoria.
Sustratos orgánicos como alternativa para la producción de albahaca (Ocimum Selloi Benth)
Campos Mota, Lilián; Flores Sánchez, Diego
2013-01-01
La especie de albahaca Ocimum Selloi Benth ha sido empleada en México por sus propiedades medicinales y como condimento. Por otra parte, el uso de vermicomposta es una alternativa en la producción orgánica de las plantas medicinales; por lo tanto, esta investigación tuvo como objetivo evaluar el efecto de la vermicomposta en el crecimiento de albahaca. Como tratamientos se emplearon 4 sustratos: 1) vermicomposta de café (con base a pulpa proveniente del beneficio húmedo) más cascarilla de caf...
Relaxant effects of Ocimum basilicum on guinea pig tracheal chains and its possible mechanism(s
Directory of Open Access Journals (Sweden)
Mohammad Hossein Boskabady
2005-01-01
Full Text Available Therapeutic effects of Ocimum basilicum on respiratory diseases especially dyspnea have been reported in Iranian ancient medical books. In the present study, the relaxant effects of macerated and soxhlet extracts of this plant on tracheal chains of guinea pigs were evaluated. The relaxant effects of 4 cumulative concentrations of macerated and soxhlet extracts (0.25, 0.5, 0.75 and 1.0 W/V in comparison with saline as negative control and 4 cumulative concentrations of theophylline (0.25, 0.5, 0.75, and 1.0 mM as positive control were examined on precontracted tracheal chains of two groups of 6 guinea pig by 60 mM KCl (group 1 and 10 µM methacholine (group 2. Decrease in contractile tone of tracheal chains was considered as relaxant effect. In group 1 experiments only the last two higher concentrations of theophylline showed significant relaxant effect compared to that of saline (p<0.001 for both concentrations, which were significantly greater than those of macerated and soxhlet extracts (p<0.001 for all cases and in group 2 experiments both macerated and soxhlet extracts showed concentrationdependent relaxant effects compared to that of saline (p<0.05 to p<0.001 for both extracts. There were significant differences between the relaxant effects of both extracts with those of theophylline in group 2 experiments (p<0.01 to p<0.001. The relaxant effects of macerated and soxhlet extracts in group 1 were significantly lower than those of groups 2. These results showed a potent relaxant effect of Ocimum basilicum on tracheal chains of guinea pigs which were lower than theophylline at concentrations used.
Behbahani, Mandana
2014-01-01
The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative ...
Energy Technology Data Exchange (ETDEWEB)
Shafique, M; Khan, S J [Pakistan Councile of Scientific and Industrial Research, Lahore (Pakistan). Dept. of Food and Biotechnology
2011-09-15
The antimicrobial activities of in vitro grown callus extract and in vivo grown Ocimum basilicum L. plant leaves extracts were studied and compared. Effect of extraction solvent was also assessed. These extracts were tested in vitro against eight bacterial strains following disc diffusion method. The results indicated that in vitro grown callus extracts of O. basilicum exhibited higher antimicrobial activity against tested Gram positive microorganisms as compared to in vivo grown plant material extract. These findings indicate towards potential use of biotechnology for natural therapeutic agent production. (author)
International Nuclear Information System (INIS)
Shafique, M.; Khan, S.J.
2011-01-01
The antimicrobial activities of in vitro grown callus extract and in vivo grown Ocimum basilicum L. plant leaves extracts were studied and compared. Effect of extraction solvent was also assessed. These extracts were tested in vitro against eight bacterial strains following disc diffusion method. The results indicated that in vitro grown callus extracts of O. basilicum exhibited higher antimicrobial activity against tested Gram positive microorganisms as compared to in vivo grown plant material extract. These findings indicate towards potential use of biotechnology for natural therapeutic agent production. (author)
Directory of Open Access Journals (Sweden)
shohreh Dadfar
2014-09-01
Conclusion: The results indicated that both essential oil and dried powder of Ocimum basilicum increased the microbial stability of ground meat during storage, whereas dried powder showed more preservative capability at final days of storage. So it is possible to use this kind of natural product instead of synthetic one to reduce the disease of consumers and enhancing the organoleptic features of food
Bantis, Filippos; Ouzounis, Theoharis; Radoglou, Kalliopi
2016-01-01
The morphological and phytochemical characteristics of two Ocimum basilicum cultivars (Lettuce Leaf, and Red Rubin-mountain Athos hybrid) under artificial lighting were investigated. Four LED light treatments [AP673L (high red and high red:far-red), G2 (high red and low red:far-red), AP67 (moderate blue and red and low red:far-red), and NS1 (high blue and green, high red:far-red and 1% ultraviolet)] with different colors mixing UV, blue, green, red and far-red, and fluorescent tubes (FL, high...
Directory of Open Access Journals (Sweden)
Korla Swapnavahini
2010-02-01
Full Text Available The waste originated in temples is presently piled up at one place and then disposed off in water bodies or dumped on land to decay, leading to water and soil pollution. The present work aims to determine the biogas yield and nutrient reduction potential of Ocimum sanctum (basil leaf waste obtained from temples. Laboratory scale digesters of 2.5 L capacity were used and fed with basil leaf waste, which was digested in a batch reactor for a retention period of 30 days at room temperature. Preliminary results indicate that the process is effective in reducing the pollution potential of the basil waste. The process removed up to 73% and 42% of total solids and BOD, respectively, along with biogas production.
U K, Ilyas; Katare, Deepshikha P; Aeri, Vidhu
2015-01-01
Ocimum sanctum Linn (Sanskrit: Tulasi; family: Libiaceae), popularly known as holy basil or Ocimum teinufolium, is found throughout the semitropical and tropical parts of India. In Ayurveda, Tulasi has been well known for its therapeutic potentials. To optimise and develop a standard method to quantify seven polyphenols simultaneously by HPTLC. A three-level factor Box-Behnken statistical design was used for optimisation, where extraction time (min), temperature (°C) and methanol:water ratio (% v/v) are the independent variables with polyphenols as the dependent variable. The separation was archived on a silica-gel 60 F254 HPTLC plate using toluene:ethyl acetate:formic acid:methanol (3:3:0.8:0.2 v/v) as the mobile phase. Densitometric analysis of polyphenols was carried out in the absorbance mode at 366 nm. The quantification of polyphenols was carried out based on peak area with a linear calibration curve at concentration ranges of 60-240, 20-200, 100-1600, 40-200, 200-1400, 10-160, 200-1400, 100-5000 ng/band for caffeic acid, ellagic acid, rutin, kaempferol, catechin, quercetin, eupalitin and epicatechin respectively. The method was validated for peak purity, precision, accuracy, limit of detection (LOD) and quantification (LOQ). Method specificity was confirmed using the retention factor value and visible spectra correlation of marker compounds. A validated HPTLC method was newly developed for simultaneous quantification of seven polyphenols in an Ayurvedic preparation of O. sanctum. The proposed method is simple, precise, specific, accurate, cost-effective, less time consuming and has the ability to separate the polyphenols from other constituents. Copyright © 2015 John Wiley & Sons, Ltd.
The Effect of Mechanical Wounding on the Composition of Essential Oil from Ocimum Minimum L. Leaves
Directory of Open Access Journals (Sweden)
S. Grant Wyllie
2001-01-01
Full Text Available The effect of mechanical damage on the composition of the essential oil obtained from eugenol-rich Ocimum minimum leaves was determined over 48 hours. Changes in the levels of five oil-constituents were detected in the first post-wounding day but only one of those components (camphor exhibited the same behaviour the day after. The levels of eugenol (-4.8% and linalool (+2.5% were affected the most by the wounding process. Principal component analysis (PCA showed the post-wounding response to be independent from the pre-wounding levels of the particular compounds expressing the response and from the overall leaf oil-composition.
Morfología básica de 17 introducciones del género Ocimum en el departamento del Valle
Directory of Open Access Journals (Sweden)
Estrada Edgar Iván
1987-09-01
Full Text Available Los objetivos del trabajo fueron establecer un jardín de introducciones de albahaca y contribuir en la caracterización botánica de las cultivariedades introducidas al banco de germoplasma. La colección se realizó en el departamento del Valle en campos de cultivo, áreas de vegetación natural, huertos caseros y mercados locales. En 6 zonas se recolectaron 17 introducciones, pertenecientes a 5 especies del genero Ocimum tres cultivadas (O. basilicum L., O. americanum Jacq Host y 0. minimum L. y dos ornamentales (O. gratissimum Hook y O. micranthum Willd. Se determinó visualmente alta variación para características fenotípicas tales como arquitectura de plantas, presencia de pubescencia, tipo de inflorescencia, flores, hojas y frutos.The objetives of this work were the collection and stablishment of a garden of albahaca and a contribution to the botanical characteristic of the cultivars introduced in the germoplasm bank .The collection was gathered at cultivated fields, natural vegetation areas, house gardens and local markets. Seventeen (17 species were collected, all belonging to the generous Ocimum from six different zones of Valle del Cauca. Three species are cultivated (O. basilium L., O. americanum Jack Host y O. minimum L. and two are considered ornamentals (O. gratissimum Hook y O. micranthum Willd. Phenotipicaly, high variety was observed in the plant architecture, in its pubescence presence, in the type of inflorescence and in flowers, leaves and fruits.
Directory of Open Access Journals (Sweden)
Letícia de Almeida Gonçalves
2010-12-01
Full Text Available Ocimum selloi Benth. (Lamiaceae é uma espécie nativa da América do Sul e na medicina popular tem sido usada devido suas propriedades analgésica, anti-inflamatória e antiespasmódica. O objetivo do presente trabalho foi identificar os tipos de tricomas glandulares que ocorrem nos órgãos vegetativos e reprodutivos de O. selloi e determinar a ontogenia desses tricomas. Ramos laterais em início de formação, folhas totalmente expandidas, flores em diferentes estádios de diferenciação, amostras de caule e do eixo das inflorescências foram analisados em microscopias de luz e eletrônica de varredura. Tricomas glandulares do tipo peltado e capitado subséssil foram observados no caule, nas folhas, no eixo da inflorescência e na superfície adaxial das sépalas. Nas sépalas foi encontrado, além dos tricomas secretores peltados e capitados subsésseis, o tricoma glandular capitado pedunculado. A ontogenia inicia-se com a expansão de uma célula protodérmica que, de acordo com a seqüência de divisões periclinais e anticlinais (ora simétricas, ora assimétricas, dá origem aos tricomas. A diferenciação dos tricomas glandulares peltados e capitados não é sincrônica e ocorre muito cedo no desenvolvimento da folha, do caule e do eixo floral.Ocimum selloi Benth. (Lamiaceae is native to South America and in traditional medicine has been used due to its analgesic, anti-inflammatory, and antispasmodic properties. The aim of this study was to identify the types of glandular trichomes that occur on the vegetative and reproductive organs of O. selloi and to determine trichome ontogeny. Lateral branches at the initial formation phase, fully opened leaves, flowers at different differentiation stages, and stem and inflorescence axes were analyzed under light and scanning electron microscopy. Glandular trichomes of the peltate and subsessile capitate types were observed on the stem, leaves, inflorescence axis and the adaxial surface of the
UAV-UGV collaboration with a PackBot UGV and Raven SUAV for pursuit and tracking of a dynamic target
Cheung, Carol; Grocholsky, Benjamin
2008-04-01
Fielded military unmanned systems are currently extending the reach of the U.S. forces in surveillance and reconnaissance missions. Providing long-range eyes on enemy operations, unmanned aerial vehicles (UAVs), such as the AeroVironment Raven, have proven themselves indispensable without risking soldiers' lives. Meanwhile, unmanned ground vehicles (UGVs), such as the iRobot PackBot, are quickly joining ranks in Explosive Ordnance Disposal (EOD) missions to identify and dispose of ordnance or to clear roads and buildings. UAV-UGV collaboration and the benefit of force multiplication is increasingly more tangible. iRobot Corporation and CMU Robotics Institute are developing the capability to simultaneously control the Raven small UAV (SUAV) and PackBot UGV from a single operator control unit (OCU) via waypoint navigation. Techniques to support autonomous collaboration for pursuing and tracking a dismounted soldier will be developed and integrated on a Raven-PackBot team. The Raven will survey an area and geolocate an operator-selected target. The Raven will share this target location with the PackBot and together they will collaboratively pursue the target intelligently to maintain track on the target. We will accomplish this goal by implementing a decentralized control and data fusion software architecture. The PackBot will be equipped with on-board waypoint navigation algorithms, a Navigator Payload containing a stereo-vision system, GPS, and a high-accuracy IMU. The Raven will have two on-board cameras, a side-looking and a forward-looking optical camera. The Supervisor OCU will act as the central mission planner, allowing the operator to monitor mission events and override vehicle tasks.
Philip, Daizy; Unni, C.
2011-05-01
Aqueous extract of Ocimum sanctum leaf is used as reducing agent for the environmentally friendly synthesis of gold and silver nanoparticles. The nanoparticles were characterized using UV-vis, transmission electron microscopy (TEM), X-ray diffraction (XRD) and FTIR analysis. These methods allow the synthesis of hexagonal gold nanoparticles having size ∼30 nm showing two surface plasmon resonance (SPR) bands by changing the relative concentration of HAuCl 4 and the extract. Broadening of SPR is observed at larger quantities of the extract possibly due to biosorption of gold ions. Silver nanoparticles with size in the range 10-20 nm having symmetric SPR band centered around 409 nm are obtained for the colloid synthesized at room temperature at a pH of 8. Crystallinity of the nanoparticles is confirmed from the XRD pattern. Biomolecules responsible for capping are different in gold and silver nanoparticles as evidenced by the FTIR spectra.
Directory of Open Access Journals (Sweden)
A.P.S. Souza Filho
2009-01-01
Full Text Available Os óleos essenciais são reconhecidos pelas suas diversificadas ações biológicas. A biodiversidade amazônica é rica em espécies de plantas produtoras de óleos essenciais. Neste trabalho, objetivou-se caracterizar a atividade potencialmente alelopática do óleo essencial de Ocimum americanum (estoraque e determinar seus efeitos sobre a germinação de sementes e o desenvolvimento de duas espécies de plantas daninhas. O óleo essencial foi testado em concentrações variando de 100 a 2.000 mg L-1, considerando seus efeitos sobre a germinação de sementes (25 ºC de temperatura constante e fotoperíodo de 12 horas e o desenvolvimento da radícula e do hipocótilo (25 ºC de temperatura constante e fotoperíodo de 24 horas das plantas daninhas malícia (Mimosa pudica e mata-pasto (Senna obtusifolia. Fatores relacionados a concentração, especificidade das plantas receptoras e parâmetros analisados foram decisivos para os efeitos obtidos. A tendência geral foi de relação positiva entre concentração e efeito inibitório. Malícia foi mais sensível aos efeitos do que mata-pasto. Comparativamente, a germinação, seguida do desenvolvimento da radícula, foi afetada pelo óleo essencial em maior magnitude, ficando o desenvolvimento do hipocótilo como o de menor sensibilidade. Os efeitos observados podem ser atribuídos à presença, no óleo essencial, de monoterpenos, monoterpenos oxigenados, sesquiterpenos, alifáticos e fenilpropanoides, com destaque para os constituintes com atividade alelopática já comprovada, como o limoneno, a cânfora e o linalol.Essential oils are known for their several biological activities. The biodiversity of the Amazon region is rich in essential-oil producing plants.The aim of this work was to study the potentially allelopathic activity of the essential oil of Ocimum americanum and to determine its effects on seed germination and growth of two weed species. Solutions of the essential oil were tested
Basil (Ocimum basilicum L. essential oil and extracts obtained by supercritical fluid extraction
Directory of Open Access Journals (Sweden)
Zeković Zoran P.
2015-01-01
Full Text Available The extracts obtained from sweet basil (Ocimum basilicum L. by hydrodistillation and supercritical fluid extraction (SFE were qualitative and quantitative analyzed by GC-MS and GC-FID. Essential oil (EO content of basil sample, determined by an official method, was 0.565% (V/w. The yields of basil obtained by SFE were from 0.719 to 1.483% (w/w, depending on the supercritical fluid (carbon dioxide density (from 0.378 to 0.929 g mL-1. The dominant compounds detected in all investigated samples (EO obtained by hydrodistillation and different SFE extracts were: linalool, as the major compound of basil EO (content from 10.14 to 49.79%, w/w, eugenol (from 3.74 to 9.78% and ä-cardinene (from 3.94 to 8.07%. The quantitative results of GC-MS from peak areas and by GC-FID using external standard method involving main standards, were compared and discussed. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013
Phenylpropanoid biosynthesis in leaves and glandular trichomes of basil (Ocimum basilicum L.).
Deschamps, Cícero; Simon, James E
2010-01-01
Basil (Ocimum basilicum L.) essential oil phenylpropenes are synthesized and accumulate in peltate glandular trichomes and their content and composition depend on plant developmental stage. Studies on gene expression and enzymatic activity indicate that the phenylpropene biosynthetic genes are developmentally regulated. In this study, the methylchavicol accumulation in basil leaves and the enzyme activities and gene expression of both chavicol O-methyltransferase (CVOMT) and eugenol O-methyltransferase (EOMT) were investigated in all leaves at four plant developmental stages. Methylchavicol accumulation decreased over time as leaves matured. There was a significant correlation between methylchavicol accumulation and CVOMT (r(2) = 0.88) enzyme activity, suggesting that the levels of biosynthetic enzymes control the essential oil content. CVOMT and EOMT transcript expression levels, which decreased with leaf age, followed the same pattern in both whole leaves and isolated glandular trichomes, providing evidence that CVOMT transcript levels are developmentally regulated in basil glandular trichomes themselves and that differences in CVOMT expression observed in whole leaves are not solely the result of differences in glandular trichome density.
Hüe, T; Cauquil, L; Fokou, J B Hzounda; Dongmo, P M Jazet; Bakarnga-Via, I; Menut, C
2015-01-01
The aim of this study was to evaluate the acaricidal activity on the cattle tick Rhipicephalus (Boophilus) microplus of essential oils from three Ocimum species. Acaricidal activity of five essential oils extracted from Ocimum gratissimum L. (three samples), O. urticaefolium Roth, and O. canum Sims was evaluated on 14- to 21-day-old Rhipicephalus microplus tick larvae using larval packet test bioassay. These essential oils were analyzed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC/MS) showing great variations of their chemical compositions according to the botanical species and even within the O. gratissimum species; the acaricidal activity of their main compounds was also evaluated. The essential oils of O. urticaefolium and O. gratissimum collected in Cameroon were the most efficient with respective LC50 values of 0.90 and 0.98%. The two essential oils obtained from O. gratissimum collected in New Caledonia were partially active at a dilution of 5% while the essential oil of O. canum collected in Cameroon showed no acaricidal activity. The chemical analysis shows five different profiles. Whereas the essential oils of O. urticaefolium from Cameroon and O. gratissimum from New Caledonia contain high amounts of eugenol (33.0 and 22.3-61.0%, respectively), 1,8-cineole was the main component of the oil of an O. canum sample from Cameroon (70.2%); the samples of O. gratissimum oils from New Caledonia are also characterized by their high content of (Z)-β-ocimene (17.1-49.8%) while the essential oil of O. gratissimum collected in Cameroon is mainly constituted by two p-menthane derivatives: thymol (30.5%) and γ-terpinene (33.0%). Moreover, the essential oil of O. urticaefolium showed the presence of elemicin (18.1%) as original compound. The tests achieved with the main compounds confirmed the acaricidal activity of eugenol and thymol with residual activity until 0.50 and 1%, respectively, and revealed the acaricidal property of elemicin
The impact of hybridization on the volatile and sensorial profile of Ocimum basilicum L.
da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; da Silva, Maria Aparecida Azevedo Pereira; Alves, Mércia Freitas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald
2014-01-01
The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids ("Cinnamon" × "Maria Bonita," "Sweet Dani" × "Cinnamon," and "Sweet Dani" × "Maria Bonita"). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component analysis. The hybrid "Cinnamon" × "Maria Bonita" exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid "Sweet Dani" × "Maria Bonita," such as canfora and (E)-caryophyllene; (E)-caryophyllene also was a novel compound in the hybrid "Sweet Dani" × "Cinnamon"; this compound was not present in the essential oils of the parents.
Sharopov, Farukh S; Satyal, Prabodh; Ali, Nasser A Awadh; Pokharel, Suraj; Zhang, Hanjing; Wink, Michael; Kukaniev, Muhammadsho A; Setzer, William N
2016-02-01
The aerial parts of Ocimum basilicum L. were collected from four different geographical locations, Sindhuli and Biratnagar (Nepal), Chormaghzak village (Tajikistan), and Sana'a (Yemen). The essential oils were obtained by hydrodistillation and analyzed by gas chromatography/mass spectrometry. A cluster analysis of 179 essential oil compositions revealed six major chemotypes: Linalool, eugenol, estragole, methyl eugenol, 1,8-cineole, and geraniol. All four of the basil oils in this study were of the linalool-rich variety. Some of the basil oils were screened for bioactivity including antimicrobial, cytotoxicity in human cancer cells, brine shrimp lethality, nematicidal, larvicidal, insecticidal, and antioxidant. The basil oils in this study were not notably antibacterial, cytotoxic, antioxidant, nor nematicidal, but were active in the brine shrimp lethality test, and did show larvicidal and insecticidal activities. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.
Singhal, Garima; Bhavesh, Riju; Kasariya, Kunal; Sharma, Ashish Ranjan; Singh, Rajendra Pal
2011-07-01
Development of green nanotechnology is generating interest of researchers toward ecofriendly biosynthesis of nanoparticles. In this study, biosynthesis of stable silver nanoparticles was done using Tulsi ( Ocimum sanctum) leaf extract. These biosynthesized nanoparticles were characterized with the help of UV-vis spectrophotometer, Atomic Absorption Spectroscopy (AAS), Dynamic light scattering (DLS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and Transmission electron microscopy (TEM). Stability of bioreduced silver nanoparticles was analyzed using UV-vis absorption spectra, and their antimicrobial activity was screened against both gram-negative and gram-positive microorganisms. It was observed that O. sanctum leaf extract can reduce silver ions into silver nanoparticles within 8 min of reaction time. Thus, this method can be used for rapid and ecofriendly biosynthesis of stable silver nanoparticles of size range 4-30 nm possessing antimicrobial activity suggesting their possible application in medical industry.
International Nuclear Information System (INIS)
Singhal, Garima; Bhavesh, Riju; Kasariya, Kunal; Sharma, Ashish Ranjan; Singh, Rajendra Pal
2011-01-01
Development of green nanotechnology is generating interest of researchers toward ecofriendly biosynthesis of nanoparticles. In this study, biosynthesis of stable silver nanoparticles was done using Tulsi (Ocimum sanctum) leaf extract. These biosynthesized nanoparticles were characterized with the help of UV–vis spectrophotometer, Atomic Absorption Spectroscopy (AAS), Dynamic light scattering (DLS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and Transmission electron microscopy (TEM). Stability of bioreduced silver nanoparticles was analyzed using UV–vis absorption spectra, and their antimicrobial activity was screened against both gram-negative and gram-positive microorganisms. It was observed that O. sanctum leaf extract can reduce silver ions into silver nanoparticles within 8 min of reaction time. Thus, this method can be used for rapid and ecofriendly biosynthesis of stable silver nanoparticles of size range 4–30 nm possessing antimicrobial activity suggesting their possible application in medical industry.
Energy Technology Data Exchange (ETDEWEB)
Taia, Wafaa K; Kotbi, Abeer M [Alexandria Univ., Faculty of Science, Botany Dept., Alexandria (Egypt); AlZahrani, Hassan S [Faculty of Science, King AbdulAziz Univ., Biology Dept., Jeddah (Saudi Arabia)
2007-07-01
Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)
International Nuclear Information System (INIS)
Taia, Wafaa K; Kotbi, Abeer M; AlZahrani, Hassan S
2007-01-01
Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)
Armazenamento de sementes de Alfavaca-cravo (Ocimum gratissimum L.
Directory of Open Access Journals (Sweden)
J.R Martins
2014-12-01
Full Text Available A espécie Ocimum gratissimum L. é um subarbusto aromático, pertencente à família Lamiaceae, considerado como importante produtor de óleo essencial e largamente utilizado na medicina popular. Devido à escassez de informações sobre a conservação das sementes dessa espécie o presente estudo objetivou analisar a longevidade das sementes submetidas a diferentes condições de armazenamento, por 12 meses, através de avaliações do potencial germinativo e da capacidade de formação de plântulas normais. As sementes foram armazenadas em três tipos de embalagens: sacos de papel, sacos de papel aluminizado, e frascos de vidro, e nas seguintes condições ambientais: balcão de laboratório, geladeira, e câmara fria. Aos 6, 8, 10 e 12 meses de armazenamento foram avaliados os seguintes parâmetros: umidade, porcentagem de germinação, índice de velocidade de germinação e porcentagem de plântulas normais. Durante o período de armazenamento a manutenção da umidade nas sementes foi mantida, bem como a porcentagem de germinação e de plântulas normais em todos os tratamentos avaliados. As sementes armazenadas apresentaram maiores valores de IVG quando comparadas com as recém-colhidas.
Directory of Open Access Journals (Sweden)
Szidónia KŐSZEGHI
2014-12-01
Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.
The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.
Directory of Open Access Journals (Sweden)
Andréa Santos da Costa
2014-01-01
Full Text Available The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L. by quantitative descriptive analysis (QDA of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”. Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey’s test, and principal component analysis. The hybrid “Cinnamon” × “Maria Bonita” exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid “Sweet Dani” × “Maria Bonita,” such as canfora and (E-caryophyllene; (E-caryophyllene also was a novel compound in the hybrid “Sweet Dani” × “Cinnamon”; this compound was not present in the essential oils of the parents.
Tulsi - Ocimum sanctum: A herb for all reasons
Directory of Open Access Journals (Sweden)
Marc Maurice Cohen
2014-01-01
Full Text Available The predominant cause of global morbidity and mortality is lifestyle-related chronic diseases, many of which can be addressed through Ayurveda with its focus on healthy lifestyle practices and regular consumption of adaptogenic herbs. Of all the herbs used within Ayurveda, tulsi (Ocimum sanctum Linn is preeminent, and scientific research is now confirming its beneficial effects. There is mounting evidence that tulsi can address physical, chemical, metabolic and psychological stress through a unique combination of pharmacological actions. Tulsi has been found to protect organs and tissues against chemical stress from industrial pollutants and heavy metals, and physical stress from prolonged physical exertion, ischemia, physical restraint and exposure to cold and excessive noise. Tulsi has also been shown to counter metabolic stress through normalization of blood glucose, blood pressure and lipid levels, and psychological stress through positive effects on memory and cognitive function and through its anxiolytic and anti-depressant properties. Tulsi′s broad-spectrum antimicrobial activity, which includes activity against a range of human and animal pathogens, suggests it can be used as a hand sanitizer, mouthwash and water purifier as well as in animal rearing, wound healing, the preservation of food stuffs and herbal raw materials and traveler′s health. Cultivation of tulsi plants has both spiritual and practical significance that connects the grower to the creative powers of nature, and organic cultivation offers solutions for food security, rural poverty, hunger, environmental degradation and climate change. The use of tulsi in daily rituals is a testament to Ayurvedic wisdom and provides an example of ancient knowledge offering solutions to modern problems.
Essential oil from Ocimum basilicum (Omani Basil): a desert crop.
Al-Maskri, Ahmed Yahya; Hanif, Muhammad Asif; Al-Maskari, Masoud Yahya; Abraham, Alfie Susan; Al-sabahi, Jamal Nasser; Al-Mantheri, Omar
2011-10-01
The focus of the present study was on the influence of season on yield, chemical composition, antioxidant and antifungal activities of Omani basil (Ocimum basilicum) oil. The present study involved only one of the eight Omani basil varieties. The hydro-distilled essential oil yields were computed to be 0.1%, 0.3% and 0.1% in the winter, spring and summer seasons, respectively. The major components identified were L- linalool (26.5-56.3%), geraniol (12.1-16.5%), 1,8-cineole (2.5-15.1%), p-allylanisole (0.2-13.8%) and DL-limonene (0.2-10.4%). A noteworthy extra component was beta- farnesene, which was exclusively detected in the oil extracted during winter and spring at 6.3% and 5.8%, respectively. The essential oil composition over the different seasons was quite idiosyncratic, in which the principal components of one season were either trivial or totally absent in another. The essential oil extracted in spring exhibited the highest antioxidant activity (except DPPH scavenging ability) in comparison with the oils from other seasons. The basil oil was tested against pathogenic fungi viz. Aspergillus niger, A. fumigatus, Penicillium italicum and Rhizopus stolonifer using a disc diffusion method, and by determination of minimum inhibitory concentration. Surprisingly high antifungal values were found highlighting the potential of Omani basil as a preservative in the food and medical industries.
Essential-Oil Variability in a Collection of Ocimum basilicum L. (Basil) Cultivars.
Maggio, Antonella; Roscigno, Graziana; Bruno, Maurizio; De Falco, Enrica; Senatore, Felice
2016-10-01
Ocimum basilicum L. (Lamiaceae) is an aromatic plant of great tradition in the Mediterranean area. Its economic importance is growing up determining an expansion of cultivation. This paper evaluated the morphological traits, the chemical profiles, and antibacterial activity of 21 cultivars of basil belonging to 'Genovese', 'Napoletano', and 'Purple basil' types. The cultivars were characterized by different growth rate and morphological traits. The chemical composition of the oils analyzed by GC and GC/MS analysis, supported by the PCA analysis, underlined the strong influence of chemotype. It is noteworthy that estragole, never present in Genovese and purple basil types, occurred in Napoletano type. The high presence of eugenol, methyl eugenol, and linalool in the majority of cultivars, belonging both to Genovese and to Napoletano types was registered. Of great interest resulted the composition of the purple basil 'Opal'. All the samples tested exhibited similar antibiotic profiles with moderate antibacterial activity. The results enhanced the importance of determination of essential-oil profile in the selection of cultivars characterized by diverse morphological traits and are useful for different purposes. © 2016 Wiley-VHCA AG, Zürich.
Karakterisasi Fraksi Aktif Antioksidan dari Ekstrak Etanol Biji Kemangi (Ocimum Basilicum L.
Directory of Open Access Journals (Sweden)
Dede Sukandar
2016-08-01
Full Text Available Characterization of antioxidant compounds from the seeds of basil (Ocimum basilicum L. has been done. Extraction is done by maceration method using ethanol solvent, fractionation by TLC and column chromatography, antioxidants test using DPPH method, and characterization of antioxidant compound using GCMS. Ethanol extract and results of fractionation ethanol extract of basil seeds using n-hexane, ethyl acetate, n-butanol and methanol-water extracts show that n-butanol extract has the highest antioxidant activity with IC50 values of 41.90 ppm. Results of column chromatography n-butanol extract using n-hexane : ethyl acetate (1:9 as mobile phase yielded 5 fractions with fraction 4 (F4 isolate has dominant stain of active antioxidants after being sprayed DPPH reagent, it had IC50 values of 39,70 ppm and total phenolic content of 0,003 mg/g. Isolate F4 suspected contains two active compounds as antioxidant which is terpenoid and phenolic compound group, namely squalene and 1,4-di-tert-buthyl-phenol identified by GCMS.DOI :http://dx.doi.org/10.15408/jkv.v0i0.3598
Directory of Open Access Journals (Sweden)
Renata C. dos Reis
2012-12-01
Full Text Available The objective of this paper was to model the drying curves of the leaves of basil (Ocimum basilicum L. in the infrared at temperatures of 50, 60, 70 and 80 ºC and to evaluate the influence of drying temperature on the color of dried leaves. Drying was conducted in infrared dryer with temperature and greenhouse air circulation. Experimental data were fitted to eight mathematical models. The magnitude of the coefficient of determination (R², the mean relative error (P, the estimated mean error (SE and chisquare test (χ2 were used to verify the degree of fitness of the models. From the study it was concluded that: a the behavior of the drying curves of basil leaves was similar to most agricultural products, the drying times in the infrared were less than the drying times in an oven with air circulation, b the mathematical drying model proposed by Midilli et al. (2002 was the one which best adjusted to the experimental data, c the diffusion coefficient ranged from 9.10 x 10-12 to 2.92 x 10-11 m² s-1 and d the color of the samples was highly influenced by drying, becoming darker due to loss of chlorophyll with increasing temperature.Objetivou-se, neste trabalho, determinar, modelar as curvas de secagem das folhas de Manjericão (Ocimum basilicum L. por infravermelho nas temperaturas de 50, 60, 70 e 80 ºC e avaliar a influência das temperaturas de secagem na cor das folhas desidratadas. A secagem foi conduzida em secador infravermelho com controle de temperatura e em estufa com circulação de ar. Aos dados experimentais foram ajustados oito modelos matemáticos. As magnitudes do coeficiente de determinação (R², do erro médio relativo (P, do erro médio estimado (SE e do teste do qui-quadrado (χ² foram utilizadas para verificar o grau de ajuste dos modelos. Do estudo concluiu-se que: a o comportamento das curva s de secagem das folhas de manjericão foi semelhante ao da maioria dos produtos agrícolas; os tempos de secagem no infravermelho
Directory of Open Access Journals (Sweden)
Larissa Corrêa do Bomfim Costa
2010-06-01
Full Text Available O atroveran ou elixir-paregórico (Ocimum selloi Benth. é uma espécie aromática nativa do Brasil, produtora de óleo essencial rico em metil-chavicol. Neste trabalho, objetivou-se avaliar a influência da temperatura, luz e tempo de armazenamento em diferentes ambientes sobre a germinação e o vigor de sementes de O. selloi. Inicialmente, testou-se o efeito da presença e ausência de luz branca sob fotoperíodo de 12 horas para determinar o fotoblastismo das sementes em diferentes temperaturas (20, 25, 30 e 35ºC. Em seguida, testou-se a germinação e emergência no armazenamento sob duas temperaturas (ambiente e câmara fria aos 0, 2, 4, 6, 8 10 e 12 meses de armazenamento. A espécie foi classificada como fotoblástica neutra, apresentando germinação em ampla faixa de temperatura (20 a 30ºC. A germinação das sementes manteve-se por doze meses de armazenamento em câmara fria e à temperatura ambiente, entretanto, o vigor decresce a partir de seis meses em armazenamento sob temperatura ambiente."Atroveran" or "elixir-paregórico" (Ocimum selloi Benth. is a Brazilian species that produces an essential oil rich in methyl chavicol. This work aimed to evaluate the influence of light, temperature and time of storage in different environments on the germination and vigor of O. selloi seeds. We initially tested the influence of presence and absence of white light in a 12-hour photoperiod to determine the photoblastism of the seeds under different temperatures (20, 25, 30 and 35ºC. The physiological quality of seeds conserved under two temperatures (room temperature and cold chamber was tested at 0, 2, 4, 6, 8 10 and 12 months of storage. The species was classified as neutral photoblastic with germination at a wide temperature range (20ºC-30°C. Germination was maintained for twelve months of storage in cold chamber at room temperature, but the vigor was reduced in seeds kept at room temperature after the sixth month of storage.
Directory of Open Access Journals (Sweden)
José Luiz S. Carvalho Filho
Full Text Available Ocimum basilicum L. essential oil with high concentration of linalool is valuable in international business. O. basilicum essential oil is widely used as seasoning and in cosmetic industry. To assure proper essential oil yield and quality, it is crucial to determine which environmental and processing factors are affecting its composition. The goal of our work is to evaluate the effects of harvesting time, temperature, and drying period on the yield and chemical composition of O. basilicum essential oil. Harvestings were performed 40 and 93 days after seedling transplantation. Harvesting performed at 8:00 h and 12:00 h provided higher essential oil yield. After five days drying, the concentration of linalool raised from 45.18% to 86.80%. O. basilicum should be harvested during morning and the biomass dried at 40ºC for five days to obtain linalool rich essential oil.
Ocimum basilicum improve chronic stress-induced neurodegenerative changes in mice hippocampus.
Ayuob, Nasra Naeim; El Wahab, Manal Galal Abd; Ali, Soad Shaker; Abdel-Tawab, Hanem Saad
2018-01-22
Alzheimer's disease (AD), one of the progressive neurodegenerative diseases might be associated with exposure to stress and altered living conditions. This study aimed to evaluate the effectiveness of Ocimum basilicum (OB) essential oils in improving the neurodegenerative-like changes induced in mice after exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice divided into four groups (n = 10); the control, CUMS, CUMS + Fluoxetine, CUMS + OB were used. Behavioral tests, serum corticosterone level, hippocampus protein level of the glucocorticoid receptors (GRs) and brain-dreived neurotropic factor (BDNF) were determined after exposure to CUMS. Hippocampus was histopathologically examined. Data were analyzed using statistical package for the social sciences (SPSS) and P value of less than 0.05 was considered significant. OB diminished the depression manifestation as well as impaired short term memory observed in the mice after exposure to the CUMS as evidenced by the forced swimming and elevated plus maze test. OB also up-regulated the serum corticosterone level, hippocampal protein level of the glucocorticoid receptor and the brain-derived neurotropic factor and reduced the neurodegenerative and atrophic changes induced in the hippocampus after exposure to CUMS. Essential oils of OB alleviated the memory impairment and hippocampal neurodegenerative changes induced by exposure to the chronic unpredictable stress indicating that it is the time to test its effectiveness on patients suffering from Alzheimer disease.
Directory of Open Access Journals (Sweden)
Caliskan Omer
2017-11-01
Full Text Available This study was conducted to assess the influence of different salinity and irrigation water treatments on the growth and development of sweet basil (Ocimum basilicum L.. Five salinity levels (0.4, 1.00, 2.50, 4.00 and 8.00 dSm-1 and three different irrigation water regimes (80, 100, 120% of full irrigation were applied in a factorial design with three replications. Dry root weight, aerial part dry weight and aerial part/root ratio were determined and evaluated as experimental parameters at the end of growing period. Results revealed significant decreases in yields with increasing salinity levels. However, basil managed to survive high salt stress. With increasing salinity levels, decreases in growth were higher in roots than in leaves. Changes in the amount of irrigation water also significantly affected the evaluated parameters.
Energy Technology Data Exchange (ETDEWEB)
Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena [Institute of Botany, Faculty of Biology, University of Belgrade, 11000 Belgrade (Serbia)
2008-07-01
The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)
International Nuclear Information System (INIS)
Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena
2008-01-01
The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)
Directory of Open Access Journals (Sweden)
Hamid Soraya
2012-01-01
Full Text Available Background and the purpose of the study: The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI.Methods: The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normalcontrol, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI.Results: Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%.Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both inthe serum and the myocardium.Conclusion: The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.
2012-01-01
Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil) on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI). Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day) for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36%) and flavonoids (1.86%). Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities. PMID:23351503
Directory of Open Access Journals (Sweden)
Fathiazad Fatemeh
2012-12-01
Full Text Available Abstract Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI. Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%. Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.
Comparison of Small Unmanned Aerial Vehicles Performance Using Image Processing
Directory of Open Access Journals (Sweden)
Esteban Cano
2017-01-01
Full Text Available Precision agriculture is a farm management technology that involves sensing and then responding to the observed variability in the field. Remote sensing is one of the tools of precision agriculture. The emergence of small unmanned aerial vehicles (sUAV have paved the way to accessible remote sensing tools for farmers. This paper describes the development of an image processing approach to compare two popular off-the-shelf sUAVs: 3DR Iris+ and DJI Phantom 2. Both units are equipped with a camera gimbal attached with a GoPro camera. The comparison of the two sUAV involves a hovering test and a rectilinear motion test. In the hovering test, the sUAV was allowed to hover over a known object and images were taken every quarter of a second for two minutes. For the image processing evaluation, the position of the object in the images was measured and this was used to assess the stability of the sUAV while hovering. In the rectilinear test, the sUAV was allowed to follow a straight path and images of a lined track were acquired. The lines on the images were then measured on how accurate the sUAV followed the path. The hovering test results show that the 3DR Iris+ had a maximum position deviation of 0.64 m (0.126 m root mean square RMS displacement while the DJI Phantom 2 had a maximum deviation of 0.79 m (0.150 m RMS displacement. In the rectilinear motion test, the maximum displacement for the 3DR Iris+ and the DJI phantom 2 were 0.85 m (0.134 m RMS displacement and 0.73 m (0.372 m RMS displacement. These results demonstrated that the two sUAVs performed well in both the hovering test and the rectilinear motion test and thus demonstrated that both sUAVs can be used for civilian applications such as agricultural monitoring. The results also showed that the developed image processing approach can be used to evaluate performance of a sUAV and has the potential to be used as another feedback control parameter for autonomous navigation.
Tambun, R.; Purba, R. R. H.; Ginting, H. K.
2017-09-01
The goal of this research is to produce oleoresin from basil leaves (Ocimum canum) by using soxhletation method and ethyl acetate as solvent. Basil commonly used in culinary as fresh vegetables. Basil contains essential oils and oleoresin that are used as flavouring agent in food, in cosmetic and ingredient in traditional medicine. The extraction method commonly used to obtain oleoresin is maceration. The problem of this method is many solvents necessary and need time to extract the raw material. To resolve the problem and to produce more oleoresin, we use soxhletation method with a combination of extraction time and ratio from the material with a solvent. The analysis consists of yield, density, refractive index, and essential oil content. The best treatment of basil leaves oleoresin extraction is at ratio of material and solvent 1:6 (w / v) for 6 hours extraction time. In this condition, the yield of basil oleoresin is 20.152%, 0.9688 g/cm3 of density, 1.502 of refractive index, 15.77% of essential oil content, and the colour of oleoresin product is dark-green.
The Effectiveness of Extracts Basil Leaves (Ocimum sanctum Linn) against Saprolegnia sp. by in Vitro
Sudarno; Luthfi Hakim, Muhammad; Kusdarwati, Rahayu
2017-02-01
Saprolegnia SP. is a fungi which is opportunistic and generally as a secondary pathogen on fish. Saprolegnia sp. infects epidermis tissue that begins at the head or fins and can spread over the entire surface of the body. The result of the using of chemicals to control infections of Saprolegnia spp. can cause pollution of the environment and harm the consumer. The purpose of this research was to determine the potential and the minimum concentration of extracts basil leaves (Ocimum sanctum Linn) as antifungi against the growth of Saprolegnia sp. by vitro. The research was held in Fish Quarantine Kelas I Juanda Suarabaya in January 2015. A positive result was obtained in the test of the effectiveness of basil leaves in inhibiting the growth of the fungus Saprolegnia sp. Concentration of the extract given to treatment 90% and 100% was able to inhibit the growth of Saprolegnia sp., indicated by the formation of the inhibitory zones at a concentration of treatment, and had the best results on the concentration of 100%.
Directory of Open Access Journals (Sweden)
Lenise L. Silva
2010-11-01
Full Text Available O óleo essencial das inflorescências de Ocimum gratissimum L., Lamiaceae foi obtido por hidrodestilação e analisado por CG/EM. Os constituintes majoritários identificados foram eugenol (81,94% e γ-muuroleno (12,58%. O óleo essencial das inflorescências demonstrou atividade antibacteriana frente a todas as cepas bacterianas testadas pelo método de microdiluição em caldo. Merece destaque a atividade verificada frente às cepas resistentes de Enterococcus faecalis, Staphylococcus aureus e Escherichia coli. Os valores obtidos de concentração inibitória mínima (CIM e a concentração bactericida mínima (CBM variaram, respectivamente, entre 0,5-2 mg/mL e 1-4 mg/mL. Valores de CL50 de 233,8 (200,7-272,0 µg/mL para o óleo essencial e 186,1 (144,1-228,5 µg/mL para o eugenol, utilizado como controle positivo, foram observados frente à Artemia salina L.The essential oil obtained by hydrodistillation of the inflorescences of Ocimum gratissimum L. was analyzed by GC/MS. The main constituents were eugenol (81.94% and γ-muurolene (12.58%. Antibacterial activity was shown against all assayed strains by the broth microdilution method. It's worth noting the activity against resistant strains of Enterococcus faecalis, Staphylococcus aureus and Escherichia coli. Minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC values ranged between 0.5-2 mg/mL and 1-4 mg/mL, respectively. Preliminary toxicity assayed by the brine-shrimp (Artemia salina L. test showed LC50 values of 233.8 (200.7 - 272.0 µg/mL and 186.1 (144.1 - 228.5 µg/mL, respectively for the essential oil and eugenol (positive control.
Landi, Marco; Guidi, Lucia; Pardossi, Alberto; Tattini, Massimiliano; Gould, Kevin S
2014-11-01
Boron (B) toxicity is an important agricultural problem in arid environments. Excess edaphic B compromises photosynthetic efficiency, limits growth and reduces crop yield. However, some purple-leafed cultivars of sweet basil (Ocimum basilicum) exhibit greater tolerance to high B concentrations than do green-leafed cultivars. We hypothesised that foliar anthocyanins protect basil leaf mesophyll from photo-oxidative stress when chloroplast function is compromised by B toxicity. Purple-leafed 'Red Rubin' and green-leafed 'Tigullio' cultivars, grown with high or negligible edaphic B, were given a photoinhibitory light treatment. Possible effects of photoabatement by anthocyanins were simulated by superimposing a purple polycarbonate filter on the green leaves. An ameliorative effect of light filtering on photosynthetic quantum yield and on photo-oxidative load was observed in B-stressed plants. In addition, when green protoplasts from both cultivars were treated with B and illuminated through a screen of anthocyanic protoplasts or a polycarbonate film which approximated cyanidin-3-O-glucoside optical properties, the degree of photoinhibition, hydrogen peroxide production, and malondialdehyde content were reduced. The data provide evidence that anthocyanins exert a photoprotective role in purple-leafed basil mesophyll cells, thereby contributing to improved tolerance to high B concentrations.
Directory of Open Access Journals (Sweden)
Zainal Berlian
2016-01-01
Full Text Available Fusarium oxysporum Schlecht. a parasitic fungus that cause leaf wilt disease in plants. Meanwhile, basil (Ocimum americanum L. is a plant that contains of the active compound in the form of phenols which have antifungal activity. This study aimed to test whether the extract of leaves of basil have antifungal activity againts Fusarium oxysporum Schlecht. and determine the optimum concentration to inhibit the growth of the fungus Fusarium oxysporum Schlecht. Antifungal test is done by using paper disc diffusion method. The study design used was a completely randomized design with 4 treatments and 6 replications. The treatment is K0 (0% w/v, K1 (5% w/v, K2 (10% w/v, and K3 (15% w/v. The results showed that the leaf extract of basil have antifungal activity against Fusarium oxysporum Schlecht. Inhibition zone on K0, K1, K2, and K3 are each 0,0 mm, 1,49 mm, 2,46 mm, and 2,01 mm. The optimum concentration of antifungal activity of extract of basil, namely the K2 concentration (10% w/v. Based on analysis of variance (ANOVA, the concentration of basil leaf extract provides significant differences (p > 0,05 on fungus Fusarium oxysporum Schlecht., where Fcount > Ftable is 4,5 > 3,1.
Bravo, Elena; Amrani, Souliman; Aziz, Mohammed; Harnafi, Hicham; Napolitano, Mariarosaria
2008-12-01
Macrophage lipid accumulation induced by low density lipoproteins (LDL) plays a pivotal role in atherosclerotic plaque development. Previous work showed that Ocimum basilicum extract, used as hypocholesterolemic agent by traditional medicine in Morocco, has hypolipidemic activity in rat acute hyperlipimidemia. This study investigated the effects of ethanolic extract of O. basilicum on lipid accumulation in human macrophages. As modification of LDL increase atherogenicity of the particles we evaluated the effects of the extract on LDL oxidation. The extract caused a dose-related increase of LDL-resistance to Cu(2+)-induced oxidation. Furthermore, at the dose of 60 microg/ml, significantly decreases the accumulation of macrophage lipid droplets induced by modified LDL evaluated as by red-oil staining. Cholesterol esterification and triacylglycerol synthesis in the cells were not affected. Macrophage treatment with 60 microg/ml, but not 20 microg/ml, of the extract reduced newly synthesized unesterified cholesterol by about 60% and decreased scavenger receptors activity by about 20-30%, evaluated by the internalization of cholesterol carried by [(3)H]CE-aggregated-LDL. The results suggest that O. basilicum ethanolic extract has the capability to reduce foam cell formation through the reduction of cholesterol synthesis and the modulation of the activity of surface scavenger receptors.
Sarkar, Biswatrish; Kumar, Dhananjay; Sasmal, Dinakar; Mukhopadhyay, Kunal
2014-01-01
Anthocyanin extracts (AEs) from Ocimum tenuiflorum (leaf), Hibiscus rosa-sinensis (petal) and Hibiscus sabdariffa (calyx) were investigated and compared for in vitro antioxidant activity and DNA damage protective property. Total phenolic content (TPC) and total anthocyanin content (TAC) of the AEs were determined and the major anthocyanins were characterised. In vitro antioxidant activities were assessed by ferric-reducing antioxidant power (FRAP) assay, 2,2-diphenyl-1-picryl hydrazyl (DPPH) radical-scavenging activity, 2-deoxy-D-ribose degradation assay and lipid peroxidation assay. The protective property of the AEs was also examined against oxidative DNA damage by H2O2 and UV using pUC19 plasmid. All the AEs particularly those from O. tenuiflorum demonstrated efficient antioxidant activity and protected DNA from damage. Strong correlation between antioxidant capacity and TPC and TAC was observed. Significant correlation between antioxidant capacity and TPC and TAC ascertained that phenolics and anthocyanins were the major contributors of antioxidant activity.
Directory of Open Access Journals (Sweden)
Charusheela Ramteke
2013-01-01
Full Text Available The field of nanotechnology is the most active area of research in modern materials science. Though there are many chemical as well as physical methods, green synthesis of nanomaterials is the most emerging method of synthesis. We report the synthesis of antibacterial silver nanoparticles (AgNPs using leaf broth of medicinal herb, Ocimum sanctum (Tulsi. The synthesized AgNPs have been characterized by UV-Vis spectroscopy, transmission electron microscopy (TEM, and X-ray diffractometry. The mean particle of synthesized NPs was found to be 18 nm, as confirmed by TEM. The qualitative assessment of reducing potential of leaf extract has also been carried out which indicated presence of significant amount of reducing entities. FTIR analysis revealed that the AgNPs were stabilized by eugenols, terpenes, and other aromatic compounds present in the extract. Such AgNPs stabilized by Tulsi leaf extract were found to have enhanced antimicrobial activity against well-known pathogenic strains, namely Staphylococcus aureus and E. coli.
Tenore, Gian Carlo; Campiglia, Pietro; Ciampaglia, Roberto; Izzo, Luana; Novellino, Ettore
2017-09-01
The present study is the first effort to a comprehensive evaluation of the antioxidant and antimicrobial activities of 'Napoletano' green and purple basil (Ocimum basilicum L.) varieties. The results obtained revealed that the basil sample extracts were characterised by a generally higher polyphenolic concentration than those reported elsewhere for other more conventional and geographically different basil varieties. Napoletano purple basil revealed higher radical-scavenging and ferric-reducing capacities than the green one probably due to its relevant anthocyanin content. As regards the antimicrobial properties, both basil varieties exhibited activity against a broad spectrum of food-borne and human pathogenic micro-organisms, revealing not only a moderate to high natural preserving capacity, but also potentially beneficial influence on human health. Results indicated Napoletano green and purple basils as a good source of antioxidants of potential nutraceutical interest.
UAV Trajectory Modeling Using Neural Networks
Xue, Min
2017-01-01
Large amount of small Unmanned Aerial Vehicles (sUAVs) are projected to operate in the near future. Potential sUAV applications include, but not limited to, search and rescue, inspection and surveillance, aerial photography and video, precision agriculture, and parcel delivery. sUAVs are expected to operate in the uncontrolled Class G airspace, which is at or below 500 feet above ground level (AGL), where many static and dynamic constraints exist, such as ground properties and terrains, restricted areas, various winds, manned helicopters, and conflict avoidance among sUAVs. How to enable safe, efficient, and massive sUAV operations at the low altitude airspace remains a great challenge. NASA's Unmanned aircraft system Traffic Management (UTM) research initiative works on establishing infrastructure and developing policies, requirement, and rules to enable safe and efficient sUAVs' operations. To achieve this goal, it is important to gain insights of future UTM traffic operations through simulations, where the accurate trajectory model plays an extremely important role. On the other hand, like what happens in current aviation development, trajectory modeling should also serve as the foundation for any advanced concepts and tools in UTM. Accurate models of sUAV dynamics and control systems are very important considering the requirement of the meter level precision in UTM operations. The vehicle dynamics are relatively easy to derive and model, however, vehicle control systems remain unknown as they are usually kept by manufactures as a part of intellectual properties. That brings challenges to trajectory modeling for sUAVs. How to model the vehicle's trajectories with unknown control system? This work proposes to use a neural network to model a vehicle's trajectory. The neural network is first trained to learn the vehicle's responses at numerous conditions. Once being fully trained, given current vehicle states, winds, and desired future trajectory, the neural
UV‐B is Required for Normal Development of Oil Glands in Ocimum basilicum L. (Sweet Basil)
IOANNIDIS, DAPHNE; BONNER, LYNDA; JOHNSON, CHRISTOPHER B.
2002-01-01
Plants of Ocimum basilicum L. grown under glass were exposed to short treatments with supplementary UV‐B. The effect of UV‐B on volatile essential oil content was analysed and compared with morphological effects on the peltate and capitate glandular trichomes. In the absence of UV‐B, both peltate and capitate glands were incompletely developed in both mature and developing leaves, the oil sacs being wrinkled and only partially filled. UV‐B was found to have two main effects on the glandular trichomes. During the first 4 d of treatment, both peltate and capitate glands filled and their morphology reflected their ‘normal’ mature development as reported in the literature. During the following days there was a large increase in the number of broken oil sacs among the peltate glands as the mature glands broke open, releasing volatiles. Neither the number of glands nor the qualitative or quantitative composition of the volatiles was affected by UV‐B. There seems to be a requirement for UV‐B for the filling of the glandular trichomes of basil. PMID:12324268
Chemical Composition and Antifungal Activity of Ocimum basilicum L. Essential Oil
Directory of Open Access Journals (Sweden)
Neveen Helmy Abou El-Soud
2015-07-01
Full Text Available BACKGROUND: The leaves of Ocimum basilicum L. (basil are used in traditional cuisine as spices; its essential oil has found a wide application in perfumery, dental products as well as antifungal agents. AIM: To assess the chemical composition as well as the in vitro antifungal activity of O. basilicum L. essential oil against Aspergillus flavus fungal growth and aflatoxin B1 production. MATERIAL AND METHODS: The essential oil of O. basilicum was obtained by hydrodistillation and analysed using gas chromatography (GC and GC coupled with mass spectrometry (GC/MS. The essential oil was tested for its effects on Aspergillus flavus (A. flavus mycelial growth and aflatoxin B1 production in Yeast Extract Sucrose (YES growth media. Aflatoxin B1 production was determined by high performance liquid chromatography (HPLC. RESULTS: Nineteen compounds, representing 96.7% of the total oil were identified. The main components were as follows: linalool (48.4%, 1,8-cineol (12.2%, eugenol (6.6%, methyl cinnamate (6.2%, α-cubebene (5.7%, caryophyllene (2.5%, β-ocimene (2.1% and α-farnesene (2.0%.The tested oil showed significant antifungal activity that was dependent on the used oil concentration. The complete inhibition of A. flavus growth was observed at 1000 ppm oil concentration, while marked inhibition of aflatoxin B1 production was observed at all oil concentrations tested (500, 750 and 1000 ppm. CONCLUSION: These results confirm the antifungal activities of O. basilicum L. oil and its potential use to cure mycotic infections and act as pharmaceutical preservative against A. flavus growth and aflatoxin B1 production.
Directory of Open Access Journals (Sweden)
Dwiarso Rubiyanto
2014-07-01
Full Text Available Green basil (Ocimum violaceum , Linn. plantis part of the varieties of basil (Ocimum basilicum, Linn.. Green basil essential oil (GBEO contain chemical compounds that have an anti- bacterial activities . Methyl eugenol and methyl chavikol are in green basil oil has the potential to be used as a material which is biologically active. Conversion reaction of the compounds in GBEO with MAOS methods (microwave assisted organic synthesis aims to obtain properties of the main chemical component in a wider sweet basil oil, and are also useful in an attempt to gain more valuable compounds for commercial and higher. The results showed that the optimum reaction conditions on the conversion reaction of compounds in GBEO with MAOS method with ethylene glycol as a solvent is 10 % KF/Al2O3as catalyst and reaction time 3 minutes , while the solvent is glycerol 10 % KF/Al2O3as catalyst and reaction time 2 minutes . Comparison of anti-bacterial activity resulting from this research are : the inhibitory activity to the growth of S. aureus bacteria have the following order : GBEO > green basilEG10-3 > green basil G10-2> amoxicillin with each inhibition zone diameter amounted to 30.7 mm, 21.1 mm, 18.2 mm and 13.4 mm. While the inhibitory activity to the growth of E.coli bacteria are : GBEO> green basil G10-2 >green basil EG10-3 > amoxicillin with each inhibition zone diameter of 21.1 mm, 15.6 mm , 15.2 mm and 7.9 mm . GBEO and its derivatives have minimal inhibitory concentrations below 1.25 %. From the results of the study found that the main derivates obtained are p-methoxy anisaldehyde , caryophyllene oxide , 3-methoxy cinnamaldehyde , humulena oxide and delta cadinol
Directory of Open Access Journals (Sweden)
Shilpi Khare Saikia
2014-01-01
Full Text Available The exploration of rhizospheric microbial flora for crop yield enhancement is well established. Rhizospheric microbes influence the plant physiology by imparting several beneficial effects, namely, Nitrogen fixation, increased nutrient uptake, and secondary metabolites production on their host plants. The present study investigates the response of Bacillus megaterium ATCC No. 13525, Pseudomonas fluorescens ATCC No. 14581, and Trichoderma viride MTCC No. 167 in alone and combined treatments for their effect on growth and yield parameters in a commercially important Ocimum tenuiflorum L. cv. CIM-Ayu. The plant is therapeutically important for its essential oil constituents, namely, eugenol, β-caryophyllene, and various monoterpenes. The combination treatments, T7 (B. megaterium + P. fluorescens and T8 (B. megaterium + P. fluorescens + T. viride, showed maximum enhancement (27.27% of percentage essential oil as compared to untreated control. Nutrient uptake especially N2 content was significantly increased (43% with the treatment T8 (B. megaterium + P. fluorescens + T. viride. Amongst major essential oil constituents, eugenol content was maximally increased by 58.5% as compared to 42.9% (control indicating a cumulative role of microbial inoculants for crop yield boost-up.
Sestili, Piero; Ismail, Tariq; Calcabrini, Cinzia; Guescini, Michele; Catanzaro, Elena; Turrini, Eleonora; Layla, Anam; Akhtar, Saeed; Fimognari, Carmela
2018-06-11
Basil (Ocimum basilicum L., OB) is a plant world widely used as a spice and a typical ingredient of the healthy Mediterranean diet. In traditional medicine, OB is indicated for many maladies and conditions; OB-containing nutritional supplements are increasingly sold. Conversely, safety concerns have been raised about the promutagens and procarcinogens alkenylbenzenes contained in OB. Areas covered: A critical review of the current status of OB as a nutraceutical, the pharmacology of its bioactive components, the rationale for its indications, and its safety. Expert opinion: Due to the polyphenolic and flavonoidic content, OB can be considered as an important ingredient in healthy diets; OB preparations may be effective as chemopreventive agents or adjunctive therapy in the treatment of different clinical conditions. From a toxicological perspective, since the tumorigenic potential of alkenylbenzenes is counteracted by other OB constituents such as nevadensin, it can be concluded that OB consumption in food and preparations is safe. The only concern relates to OB essential oils: in this case, a concentration limit for alkenylbenzenes should be precautionary defined, and the use of plant chemotypes with no or low levels of these alkylbenzenes for the preparation of essential oils should be made compulsory.
Extraction of mosquitocidals from Ocimum canum leaves for the control of dengue and malarial vectors
Directory of Open Access Journals (Sweden)
Pari Madhiyazhagan
2014-09-01
Full Text Available Objective: To assess the potentiality of Ocimum canum (O. canum (Lamiaceae in larvicidal, pupicidal, adulticidal, and repellent activities against the malarial vector, Anopheles stephensi (An. stephensi and the dengue vector, Aedes aegypti (Ae. aegypti. Methods: The mosquitocidal activity of methanol extracts from O. canum against immature and adult An. stephensi and Ae. aegypti (L. were studied. Standard WHO bioassays were used to evaluate the effectiveness of the plant extract against mosquitoes. Results: The methanol extract of O. canum was very effective against the immature stages of An. stephensi (LC50=193.280, 240.551, 303.409, 374.936 and pupa 469.547 mg/L and Ae. aegypti (LC 50=242.071, 287.277, 332.668, 394.061 and pupa 457.879 mg/L. Smoke toxicity assay showed significant mortality rate against adult An. stephensi (86.6% and Ae. aegypti (84.78%. The number of eggs laid by the females were strictly reduced after exposure to smoke. Conclusions: From the observed results we conclude that O. canum can be used as an effective larvicidal and repellent agent against the malarial and dengue vectors.
Inflorescence and leaves essential oil composition of hydroponically grown Ocimum basilicum L
Directory of Open Access Journals (Sweden)
MOHAMMAD BAGHER HASSANPOURAGHDAM
2010-10-01
Full Text Available In order to characterize the essential oils of leaves and inflorescences, water distilled volatile oils of hydroponically grown Ocimum basilicum L. were analyzed by GC/EI-MS. Fifty components were identified in the inflorescence and leaf essential oils of the basil plants, accounting for 98.8 and 99.9 % of the total quantified components respectively. Phenylpropanoids (37.7 % for the inflorescence vs. 58.3 % for the leaves were the predominant class of oil constituents, followed by sesquiterpenes (33.3 vs. 19.4 % and monoterpenes (27.7 vs. 22.1 %. Of the monoterpenoid compounds, oxygenated monoterpenes (25.2 vs. 18.9 % were the main subclass. Sesquiterpene hydrocarbons (25 vs. 15.9 % were the main subclass of sesquiterpenoidal compounds. Methyl chavicol, a phenylpropane derivative, (37.2 vs. 56.7 % was the principle component of both organ oils, with up to 38 and 57 % of the total identified components of the inflorescence and leaf essential oils, respectively. Linalool (21.1 vs. 13.1 % was the second common major component followed by α-cadinol (6.1 vs. 3 %, germacrene D (6.1 vs. 2.7 % and 1,8-cineole (2.4 vs. 3.5 %. There were significant quantitative but very small qualitative differences between the two oils. In total, considering the previous reports, it seems that essential oil composition of hydroponically grown O. basilicum L. had volatile constituents comparable with field grown counterparts, probably with potential applicability in the pharmaceutical and food industries.
Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum).
Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo
2016-12-01
Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions.
Xue, Min; Rios, Joseph
2017-01-01
Small Unmanned Aerial Vehicles (sUAVs), typically 55 lbs and below, are envisioned to play a major role in surveilling critical assets, collecting important information, and delivering goods. Large scale small UAV operations are expected to happen in low altitude airspace in the near future. Many static and dynamic constraints exist in low altitude airspace because of manned aircraft or helicopter activities, various wind conditions, restricted airspace, terrain and man-made buildings, and conflict-avoidance among sUAVs. High sensitivity and high maneuverability are unique characteristics of sUAVs that bring challenges to effective system evaluations and mandate such a simulation platform different from existing simulations that were built for manned air traffic system and large unmanned fixed aircraft. NASA's Unmanned aircraft system Traffic Management (UTM) research initiative focuses on enabling safe and efficient sUAV operations in the future. In order to help define requirements and policies for a safe and efficient UTM system to accommodate a large amount of sUAV operations, it is necessary to develop a fast-time simulation platform that can effectively evaluate requirements, policies, and concepts in a close-to-reality environment. This work analyzed the impacts of some key factors including aforementioned sUAV's characteristics and demonstrated the importance of these factors in a successful UTM fast-time simulation platform.
Directory of Open Access Journals (Sweden)
GURPREET KAUR
2015-03-01
Full Text Available The present study was designed to investigate the ameliorative potential of Ocimumsanctum and its saponin rich fraction in chronic constriction injury-induced neuropathic pain in rats. The chronic constriction injury was induced by placing four loose ligatures around the sciatic nerve, proximal to its trifurcation. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Chronic constriction injury was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia along with an increase in oxidative stress and calcium levels. However, administration of Ocimumsanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated chronic constriction injury-induced neuropathic pain as well as decrease the oxidative stress and calcium levels. It may be concluded that saponin rich fraction of Ocimum sanctum has ameliorative potential in attenuating painful neuropathic state, which may be attributed to a decrease in oxidative stress and calcium levels.
Directory of Open Access Journals (Sweden)
M Goldani
2012-10-01
Full Text Available In order to determine the effect of different irrigation intervals on some morphophysiological traits of basil (Ocimum basilicum L., an experiment was conducted as factorial based on randomized complete block design with three replications under greenhouse conditions during 2010. Treatments included five irrigation intervals with 4, 8, 12, 16 and 20 days intervals and two ecotypes of basil (green and purple. The results showed that by increasing irrigation interval plant height, spike number, spike weight and shoot dry weight between irrigation intervals decreased. Purple basil was more tolerant than basil green ecotype to drought stress. Interaction between irrigation intervals and ecotypes showed that the best treatment related to four days irrigation interval and purple basil ecotype. The effect of irrigation intervals on root area, root diameter mean, total length, root volume and dry weight of root was significant. In all irrigation intervals, purple basil had better performance compared to green ecotype. The results showed that by increasing in irrigation interval decreased root surface area, but increased total root length. It was concluded that increasing irrigation interval up to 12 days decreased shoot and root surface areas. Increasing irrigation interval decreased chlorophyll- a, b and increased prolin amino acid content of basil leaf.
Directory of Open Access Journals (Sweden)
Sérgio Macedo Silva
Full Text Available ABSTRACT For an important and expensive crop such as corn, the resistance of Spodoptera frugiperda J.E. Smith to various pesticides has led to research throughout the world for a potential insecticide from a natural source. For the management of pest resistance, natural compounds associated with synthetic insecticides can be a promising tool because they can reduce the application of the synthetics molecules while maintaining their effectiveness and promoting the control of the pests. Linalool is a potential insecticide that is easily obtained because it is found in high concentrations in the essential oil of Ocimum basilicum L. Therefore, the present study aimed to evaluate the toxicity of this essential oil and its combination with deltamethrin to control S. frugiperda. Through dose response assays, the acute toxicities (LD50 of the essential oil and deltamethrin were estimated. Additionally, the combination of these materials was also assessed, attaining a reduction of 80% of the LD50 of deltamethrin while obtaining the same result as when the pyrethroid was administered alone. From these results, it is expected that the combination of natural compounds and synthetic insecticides will be a promising practice, helping to manage resistance while reducing the environmental impact of toxic compounds.
Meghwani, Himanshu; Prabhakar, Pankaj; Mohammed, Soheb A; Dua, Pamila; Seth, Sandeep; Hote, Milind P; Banerjee, Sanjay K; Arava, Sudheer; Ray, Ruma; Maulik, Subir Kumar
2018-04-17
The study was designed to explore any beneficial effect of Ocimum sanctum (Linn) (OS) in experimental pulmonary hypertension (PH) in rats. OS is commonly known as “holy basil” and “Tulsi” and is used in the Indian System of Medicine as antidiabetic, antioxidant, hepatoprotective, adaptogenic, and cardioprotective. Monocrotaline (MCT) administration caused development of PH in rats after 28 days and rats were observed for 42 days. Treatments (sildenafil; 175 µg/kg, OS; 200 mg/kg) were started from day 29 after the development of PH and continued for 14 days. Parameters to assess the disease development and effectiveness of interventions were echocardiography, right and left ventricular systolic pressures, and right ventricular end diastolic pressure, percentage medial wall thickness (%MWT) of pulmonary artery, oxidative stress markers in lung tissue, NADPH oxidase (Nox-1) protein expression in lung, and mRNA expression of Bcl2 and Bax in right ventricular tissue. OS (200 mg/kg) treatment ameliorated increased lung weight to body weight ratio, right ventricular hypertrophy, increased RVSP, and RVoTD/AoD ratio. Moreover, OS treatment decreases Nox-1 expression and increases expression of Bcl2/Bax ratio caused by MCT. The present study demonstrates that OS has therapeutic ability against MCT-induced PH in rat which are attributed to its antioxidant effect. The effect of OS was comparable with sildenafil.
Directory of Open Access Journals (Sweden)
Szidónia KŐSZEGHI
2014-12-01
Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.
Directory of Open Access Journals (Sweden)
M.S. Maggioni
2014-03-01
Full Text Available Uma das etapas mais importantes na produção do manjericão é o desenvolvimento das mudas. Nesta etapa, o cuidado com o recipiente e o substrato é essencial, pois afetam diretamente o crescimento e a arquitetura do sistema radicular, bem como, o fornecimento de nutrientes. Assim, o objetivo deste trabalho foi avaliar o desenvolvimento de mudas de manjericão (Ocimum basilicum L. influenciadas pelo tipo e densidade de diferentes substratos, cultivadas em bandejas de poliestireno com diferentes números de células. O experimento foi conduzido na área de Jardinocultura da Universidade Federal da Grande Dourados (UFGD em Dourados - MS. O delineamento experimental utilizado foi em blocos casualizados com cinco repetições, sendo os tratamentos dispostos em esquema fatorial 3x3x5, sendo três tipos de bandejas de poliestireno expandido com 72, 128 e 200 células com volumes internos de 124,3; 44,8 e 17,7 mL, respectivamente. Três tipos de substratos comerciais (PlantMax Florestais®; Tropstrato Vida Verde® e PlantMax Hortaliças HA®, e cinco densidades de substratos (0,36; 0,42; 0,48; 0,54 e 0,60 kg dm-3. Decorridos 78 dias após a emergência das plantas avaliou-se alturas das plantas, massa fresca e seca da parte aérea e sistema radicular, e comprimento de raízes. A produção de mudas comerciais de manjericão (Ocimum basilicum L. foi melhor com o uso do substrato Tropstrato Vida Verde® na bandeja de 72 células associado com a densidade de 0,47 kg dm-3.
Jannuzzi, Hermes
2014-01-01
O manjericão (Ocimum basilicum) é uma planta aromática largamente cultivada, devido ao seu grande polimorfismo, originário de polinizações cruzadas, durante séculos de domesticação. A importância dessa espécie está na da arquitetura da planta, coloração e morfologia das folhas e flores, além da composição química de seus óleos essenciais, originando aromas específicos e tendo utilização variada na gastronomia, perfumaria e indústria farmacêutica. Neste trabalho foram realizados dois experimen...
Subbiya, Arunajatesan; Mahalakshmi, Krishnan; Pushpangadan, Sivan; Padmavathy, Kesavaram; Vivekanandan, Paramasivam; Sukumaran, Vridhachalam Ganapathy
2013-01-01
Introduction: The Enterococcus faecalis biofilm in the root canal makes it difficult to be eradicated by the conventional irrigants with no toxicity to the tissues. Hence, plant products with least side effects are explored for their use as irrigants in the root canal therapy. Aim: To evaluate and compare the antibacterial efficacy of Mangifera indica L. kernel (mango kernel) and Ocimum sanctum L. leaves (tulsi) extracts with conventional irrigants (5% sodium hypochlorite (NaOCl) and 2% chlorhexidine) against E. faecalis dentinal biofilm. Materials and Methods: Agar diffusion and broth microdilution assay was performed with the herbal extracts and conventional irrigants (2% chlorhexidine and 5% NaOCl) against E. faecalis planktonic cells. The assay was extended onto 3 week E. faecalis dentinal biofilm. Results: Significant reduction of colony forming units (CFU)/mL was observed for the herbal groups and the antibacterial activity of the herbal groups was at par with 5% NaOCl. Conclusions: The antibacterial activity of these herbal extracts is found to be comparable with that of conventional irrigants both on the biofilm and planktonic counterparts. PMID:24082577
Directory of Open Access Journals (Sweden)
Karine Schoeninger
2011-10-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n1p55 Este trabalho objetivou listar a comunidade de visitantes florais de Ocimum selloi, indicar os potenciais polinizadores e seus padrões de visitação. A coleta dos visitantes florais ocorreu no ano de 2007, em área antropofizada, sendo analisada a constância e a dominância dos táxons. Coletou-se um total de 653 insetos, pertencentes a sete ordens; Hymenoptera, com 370 indivíduos, foi o grupo mais representativo. Foram identificadas 36 famílias, sendo 12 de Hymenoptera e oito de Diptera, as mais diversas. Apidae foi a família com maior constância e dominância compreendida, principalmente, pela abelha Apis mellifera L., 1758 (n = 223, seguida de Halictidae (n = 107. A maior atividade forrageira foi observada no horário entre as 9h e 11h da manhã. Constatou-se que A. mellifera foi o principal visitante floral e potencial polinizador de O. selloi.
Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum)
Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo
2018-01-01
Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions. PMID:29367803
Carvalho, Sofia D; Schwieterman, Michael L; Abrahan, Carolina E; Colquhoun, Thomas A; Folta, Kevin M
2016-01-01
Narrow-bandwidth light treatments may be used to manipulate plant growth, development and metabolism. In this report LED-based light treatments were used to affect yield and metabolic content of sweet basil (Ocimum basilicum L. cv "Ceasar") grown in controlled environments. This culinary herb produces an aroma highly appreciated by consumers, primarily composed of terpenes/terpenoids, phenylpropanoids, and fatty-acid- derived volatile molecules. Basil plants were grown under narrow-bandwidth light conditions, and leaf area, height, mass, antioxidant capacity and volatile emissions were measured at various time points. The results indicate reproducible significant differences in specific volatiles, and in biochemical classes of volatiles, compared to greenhouse grown plants. For example, basil plants grown under blue/red/yellow or blue/red/green wavelengths emit higher levels of a subset of monoterpenoid volatiles, while a blue/red/far-red treatment leads to higher levels of most sesquiterpenoid volatile molecules. Specific light treatments increase volatile content, mass, and antioxidant capacity. The results show that narrow-bandwidth illumination can induce discrete suites of volatile classes that affect sensory quality in commercial herbs, and may be a useful tool in improving commercial production.
Directory of Open Access Journals (Sweden)
JOSÉ D. LIMMA NETTO
2017-08-01
Full Text Available ABSTRACT This study aimed to verify the sedative and anaesthetic effect of the essential oils of basil (Ocimum basilicum (EOOB and lemongrass (Cymbopogum flexuosus (EOCF in Nile tilapia juveniles. The fish were transferred to aquaria containing different concentrations of each essential oil: 10, 25, 50, 100, 200, 400 and 600 μL L-1. The time of sedation ranged from 7 to 31 seconds and the recommended concentration was 10 or 25 μL L-1 for both essential oils. The best times for anaesthesia and recovery were found for the concentrations of 400 μL L-1 for EOOB (135.2 and 199.1 seconds, respectively and 600 μL L-1 for EOCF (327.1 and 374.8 seconds, respectively. In conclusion, we recommend the use of EOOB and EOCF for the sedation and anaesthesia of Nile tilapia at concentrations of 10-25 (for both, 400 and 600 μL L-1, respectively.
Gbadegesin, M A; Odunola, O A
2010-11-25
We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum γ-Glutamyl transferase (γGT), and serum alkaline phosphatase (ALP) activities when compared with the group administered the toxin alone. In addition, treatments of the animals with aqueous or ethanolic extract of O. basilicum before the administration of sodium arsenite resulted in the attenuation of the sodium arsenite-induced aspartate and alanine aminotransferase activities: ALT (from 282.6% to 167.7% and 157.8%), AST (from 325.1% to 173.5% and 164.2%) for the group administered sodium arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium arsenite respectively, expressed as percentage of the negative control. These findings support the presence of hepatoprotective activity in the O.basilicum extracts.
Prokopenko, Yuliya; Jakštas, Valdas; Žvikas, Vaidotas; Georgiyants, Victoriya; Ivanauskas, Liudas
2018-05-18
The aim of research was to study the content of amino acids using in extracts of Fumaria schleicheri L., Ocimum basilicum L., and Corylus avellana L. by HILIC MS/MS method. Separation of amino acids in the samples was carried out with Acquity H-class UPLC system (Waters, Milford, USA) equipped with SeQuant ZIC-Hilic collumn (2.1 × 150 mm, 3.5 μm) (Merck Millipore, Darmstadt, Germany). The MS/MS fragment ion chromatograms of the test solutions established the presence of 19 amino acids. The obtained results have shown that O. basilicum L. characterized the highest concentrations of different neurogenic amino acids (128.1 mg/kg), comparing with F. schleicheri L. and C. avellana L. (57.72 and 52.91 mg/kg, respectively).
Directory of Open Access Journals (Sweden)
Érica dos Anjos Rodrigues
2006-04-01
Full Text Available Avaliou-se o efeito, in vitro, do extrato bruto (EB, autoclavado e esterilizado por filtração, da planta medicinal Ocimum gratissimum e do fungicida iprodione+thiram no crescimento micelial e na esporulação de Bipolaris sorokiniana. Além disso, sementes de trigo naturalmente infectadas com B. sorokiniana foram submetidas aos seguintes tratamentos: 1 fumigação com óleo essencial, 2 imersão em EB autoclavado e 3 não-autoclavado em diferentes concentrações (1%,5%, 10%, 15%, 20%, 25% e 50% m/v, 4 polvilhamento com folhas secas e com fungicida iprodione+thiram. O EB autoclavado proporcionou maior inibição, ainda que parcial, do crescimento micelial em todas as concentrações testadas (1%, 5%, 10%, 15%, 20% e 50% m/v, quando comparado ao EB esterilizado por filtração. Em casa-de-vegetação, as sementes fumigadas por 7 dias apresentaram velocidade de emergência (VE estatisticamente igual à da testemunha (água. Com relação ao tratamento por imersão, não houve diferença estatística entre os parâmetros analisados (VE, porcentagem de emergência, altura, massa fresca e seca e taxa de transmissão (Tt e a testemunha. Sementes tratadas com pó de folhas secas não diferiram estatisticamente do controle químico, em relação aos parâmetros anteriores, mas apresentaram maior Tt do patógeno. Em laboratório, as sementes submetidas à fumigação apresentaram maior número de sementes sadias doque a testemunha, enquanto os tratamentos com imersão em EB e polvilhamento não diferiram em relação ao mesmo parâmetro.The in vitro effect of Ocimum gratissimum medicinal plant CE(autoclaved and sterilized by filtration as well as the iprodione+thiram fungicide on the mycelial growth and sporulation of B. sorokiniana was evaluated. Besides, wheat seeds naturally infected with B. sorokiniana were submitted to the following treatments: 1 fumigation with essential oil; 2 immersion with autoclaved CE and; 3 non autoclaved CE at different
Effect of methyl jasmonate on secondary metabolites of sweet basil (Ocimum basilicum L.).
Kim, Hyun-Jin; Chen, Feng; Wang, Xi; Rajapakse, Nihal C
2006-03-22
The effect of methyl jasmonate (MeJA) in terms of its induction of inherent bioactive chemicals in sweet basil (Ocimum basilicum L.) was evaluated after MeJA was sprayed on healthy basil plants. The total phenolic content of the sweet basil significantly increased after 0.1 and 0.5 mM MeJA treatments compared with the control not subjected to MeJA. Two phenolic compounds, rosmarinic acid (RA) and caffeic acid (CA), were identified as strong antioxidant constituents of the sweet basil. Their amounts also significantly increased after the MeJA treatment. In addition, eugenol and linalool increased 56 and 43%, respectively, by the 0.5 mM MeJA treatment. Due to the accumulation of RA, CA, and eugenol, which possess strong 2,2-diphenyl-1-picrylhydrazyl (DPPH*) free radical scavenging activities, the antioxidant activity of the sweet basil extract was 2.3-fold greater than that of the control after the 0.5 mM MeJA treatment. In the DPPH* assay, the EC50 values of RA, CA, and eugenol were determined as 23, 46, and 59 microM, respectively, which indicated they were 6-, 3-, and 2.4-fold more efficient than BHT (140 microM). Besides, an unidentified HPLC peak in the methanolic extract of the sweet basil was 4.3-fold higher than that of the control after the 0.5 mM MeJA treatment.
Akinrinde, A S; Oyagbemi, A A; Omobowale, T O; Asenuga, E R; Ajibade, T O
2016-07-01
The protective abilities of the chloroform extract of Ocimum gratissimum (COG) and gallic acid against cobalt chloride (CoCl2) - induced cardiac and renal toxicity were evaluated. Rats were exposed to CoCl2 (350ppm) for 7 days, either alone, or in combination with COG (100 and 200mg/kg) or gallic acid (120mg/kg). CoCl2 given alone, caused significant increases (pgallic acid treatment significantly reduced (pgallic acid by modulation of CoCl2-induced alterations in blood pressure, antioxidant status and pro-apoptotic caspase 8 in Wistar rats. Copyright © 2016 Elsevier GmbH. All rights reserved.
Directory of Open Access Journals (Sweden)
Larissa Corrêa Bomfim Costa
Full Text Available The efficacy of Ocimum selloi essential oil was evaluated for controlling the growth of mycelia and spores germination Moniliophthora perniciosa. Six compounds (99.89% of the total oil were identified by GC-MS, of which methyl chavicol, methyl eugenol, β-caryophyllene, germacrene-D, bicyclogermacrene and spathulenol. Essential oil was tested for antifungal activity, which was determined by disc diffusion and minimum inhibitory concentration (MIC determination methods. Application of the oil reduced mycelial growth in a dose dependent manner, with maximum inhibition being observed at concentration of 1,000 ppm. Such antifungal activity could be attributed to methyl chavicol since the pure compound was shown to be similarly effective against Moniliophthora perniciosa at 1,000 ppm. The oil when applied at a concentration of 1,000 ppm, reduced the spore germination of Colletotrichum gloeosporioides and M. perniciosa by 93 and 87%, respectively, but had no effect on the Alternaria alternata. It is concluded that the oil from O. selloi and its major constituent, methyl chavicol, are efficient in inhibiting M. perniciosa, but less effective against C. gloeosporioides and A. alternata. The results obtained from this work may contribute to the development of alternative anti-fungal agents to protect the cacao crop from fungal disease.
Directory of Open Access Journals (Sweden)
Marisol Ronzón Ortega
2012-11-01
Full Text Available In order to promote sustainable aquaculture in production units and to take care of the water resource is needed to integrate biotechnology tools to the activity, as is the aquaponics. In the present study we evaluated the production efficiency of a crop of basil (Ocimum basilicum in a hydroponic system (SH vs. acuaponic system (SA associated with the semi-intensive culture of Malaysian prawn (Macrobrachium rosenbergii. The production of basil was conducted in two geomembrane plastic rectangular tanks (4.0 m long x 0.80 m wide and 0.30 m high, divided into two sections: in the first section setting of the seedlings were done in a substrate of silica sand and volcanic rock , whereas in the second were seeded into plastic containers using the same substrate. SH plants got their nutrients from the metabolites derived from the cultivation of 800 postlarval shrimp in two circular tanks of 25 m3 (16 organisms m-2 (Pond 1: initial weight 0.13 g, Pond 2: 2.19 g; while in the SH was used a commercial nutrient solution (1.5 g L. The results indicate that SH plants initially had higher survival (90%, height and number of leaves per plant (p
Directory of Open Access Journals (Sweden)
Niazi Fateme
2016-10-01
Full Text Available Abstract Background: Angiogenesis is an important biological processes of new blood vessels in many pathological stages of development and embryo development occurs and a complex and dynamic phenomenon that is needed for development and other physiological processes. This study aimed to investigate the effect of alcoholic Ocimum basilicum leaf extract on angiogenesis chick chorioallantoic membrane is done. Materials and Methods: In this experimental study 40 Ross fertilized eggs were randomly divided into four groups: control, sham-exposed and experimental groups were divided. The second day of incubation the eggs window was opened. Eighth day of the alcoholic extract of basil doses of 50 and 150 mg/kg on chick chorioallantoic membrane was injected. On day 12, embryos length and weight and chorioallantoic membrane (CAM was photographed by photostereomicroscope Then the numbers and lengths of vessels in special area on CAM were measured with Image J. analyzed through by t-test and ANOVA (P<0.05. Results: The data does not show significant difference between embryos length and weight in sham compare to all experimental groups. In the study vessels number just with 150 mg/kg observed significant. Conclusion: Alcoholic extract of basil is an increase in the number of vessels and in this sense the healing and growth processes associated with them as well as effective.
Yield and oil composition of 38 basil (Ocimum basilicum L.) accessions grown in Mississippi.
Zheljazkov, Valtcho D; Callahan, Amber; Cantrell, Charles L
2008-01-09
A field experiment was conducted to assess yield, oil content, and composition of 38 genotypes of sweet basil ( Ocimum basilicum L.). Overall, biomass yields were high and comparable to those reported in the literature. However, basil genotypes differed significantly with respect to oil content and composition. Oil content of the tested accessions varied from 0.07% to 1.92% in dry herbage. On the basis of the oil composition, basil accessions were divided into seven groups: (1) high-linalool chemotype [19-73% (-)-linalool], (2) linalool-eugenol chemotype [six chemotypes with 28-66% (-)-linalool and 5-29% eugenol], (3) methyl chavicol chemotype [six accessions with 20-72% methyl chavicol and no (-)-linalool], (4) methyl chavicol-linalool chemotype [six accessions with 8-29% methyl chavicol and 8-53% (-)-linalool], (5) methyl eugenol-linalool chemotype [two accessions with 37% and 91% methyl eugenol and 60% and 15% (-)-linalool], (6) methyl cinnamate-linalool chemotype [one accession with 9.7% methyl cinnamate and 31% (-)-linalool], and (7) bergamotene chemotype [one accession with bergamotene as major constituent, 5% eucalyptol, and basil could be a viable essential oil crop in Mississippi. The availability of various chemotypes offers the opportunity for production of basil to meet the market requirements of specific basil oils or individual compounds such as (-)-linalool, eugenol, methyl chavicol, methyl cinnamate, or methyl eugenol.
Tan, Wenjuan; Gao, Qin; Deng, Chaoyi; Wang, Yi; Lee, Wen-Yee; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L
2018-04-04
In this study, low and high anthocyanin basil ( Ocimum basilicum) varieties (LAV and HAV) were sprayed with 4.8 mg Cu/per pot from Cu(OH) 2 nanowires, Cu(OH) 2 bulk (CuPro), or CuSO 4 and cultivated for 45 days. In both varieties, significantly higher Cu was determined in leaves of CuSO 4 exposed plants (691 and 672.6 mg/kg for LAV and HAV, respectively); however, only in roots of HAV, Cu was higher, compared to control ( p ≤ 0.05). Nanowires increased n-decanoic, dodecanoic, octanoic, and nonanoic acids in LAV, but reduced n-decanoic, dodecanoic, octanoic, and tetradecanoic acids in HAV, compared with control. In HAV, all compounds reduced eugenol (87%), 2-methylundecanal (71%), and anthocyanin (3%) ( p ≤ 0.05). In addition, in all plant tissues, of both varieties, nanowires and CuSO 4 reduced Mn, while CuPro increased chlorophyll contents, compared with controls ( p ≤ 0.05). Results suggest that the effects of Cu(OH) 2 pesticides are variety- and compound-dependent.
Flight-Test Evaluation of Kinematic Precise Point Positioning of Small UAVs
Directory of Open Access Journals (Sweden)
Jason N. Gross
2016-01-01
Full Text Available An experimental analysis of Global Positioning System (GPS flight data collected onboard a Small Unmanned Aerial Vehicle (SUAV is conducted in order to demonstrate that postprocessed kinematic Precise Point Positioning (PPP solutions with precisions approximately 6 cm 3D Residual Sum of Squares (RSOS can be obtained on SUAVs that have short duration flights with limited observational periods (i.e., only ~≤5 minutes of data. This is a significant result for the UAV flight testing community because an important and relevant benefit of the PPP technique over traditional Differential GPS (DGPS techniques, such as Real-Time Kinematic (RTK, is that there is no requirement for maintaining a short baseline separation to a differential GNSS reference station. Because SUAVs are an attractive platform for applications such as aerial surveying, precision agriculture, and remote sensing, this paper offers an experimental evaluation of kinematic PPP estimation strategies using SUAV platform data. In particular, an analysis is presented in which the position solutions that are obtained from postprocessing recorded UAV flight data with various PPP software and strategies are compared to solutions that were obtained using traditional double-differenced ambiguity fixed carrier-phase Differential GPS (CP-DGPS. This offers valuable insight to assist designers of SUAV navigation systems whose applications require precise positioning.
Nguyen, Phuong M; Niemeyer, Emily D
2008-09-24
Many herbs and spices have been shown to contain high levels of polyphenolic compounds with potent antioxidant properties. In the present study, we explore how nutrient availability, specifically nitrogen fertilization, affects the production of polyphenolic compounds in three cultivars (Dark Opal, Genovese, and Sweet Thai) of the culinary herb, basil ( Ocimum basilicum L.). Nitrogen fertilization was found to have a significant effect on total phenolic levels in Dark Opal ( p basil with statistically higher phenolic contents observed when nutrient availability was limited at the lowest (0.1 mM) applied nitrogen treatment. Similarly, basil treated at the lowest nitrogen fertilization level generally contained significantly higher rosmarinic ( p = 0.001) and caffeic ( p = 0.001) acid concentrations than basil treated at other nitrogen levels. Nitrogen fertilization also affected antioxidant activity ( p = 0.002) with basil treated at the highest applied nitrogen level, 5.0 mM, exhibiting lower antioxidant activity than all other nitrogen treatments. The anthocyanin content of Dark Opal basil was not affected by applied nitrogen level, but anthocyanin concentrations were significantly impacted by growing season ( p = 0.001). Basil cultivar was also determined to have a statistically significant effect on total phenolic levels, rosmarinic and caffeic acid concentrations, and antioxidant activities.
Directory of Open Access Journals (Sweden)
Takao Someya
2018-04-01
Full Text Available This data article provides gene expression profiles, determined by using real-time PCR, of fibroblasts and keratinocytes treated with 0.01% and 0.001% extracts of holy basil plant (Ocimum tenuiflorum, sri lankan local name “maduruthala”, 0.1% and 0.01% extracts of malabar nut plant (Justicia adhatoda, sri lankan local name “adayhoda” and 0.003% and 0.001% extracts of emblic myrobalan plant (Phyllanthus emblica, sri lankan local name “nelli”, harvested in Sri Lanka. For fibroblasts, the dataset includes expression profiles for genes encoding hyaluronan synthase 1 (HAS1, hyaluronan synthase 2 (HAS2, hyaluronidase-1 (HYAL1, hyaluronidase-2 (HYAL2, versican, aggrecan, CD44, collagen, type I, alpha 1 (COL1A1, collagen, type III, alpha 1 (COL3A1, collagen, type VII, alpha 1 (COL7A1, matrix metalloproteinase 1 (MMP1, acid ceramidase, basic fibroblast growth factor (bFGF, fibroblast growth factor-7 (FGF7, vascular endothelial growth factor (VEGF, interleukin-1 alpha (IL-1α, cyclooxygenase-2 (cox2, transforming growth factor beta (TGF-β, and aquaporin 3 (AQP3. For keratinocytes, the expression profiles are for genes encoding HAS1, HAS2, HYAL1, HYAL2, versican, CD44, IL-1α, cox2, TGF-β, AQP3, Laminin5, collagen, type XVII, alpha 1 (COL17A1, integrin alpha-6 (ITGA6, ceramide synthase 3 (CERS3, elongation of very long chain fatty acids protein 1 (ELOVL1, elongation of very long chain fatty acids protein 4 (ELOVL4, filaggrin (FLG, transglutaminase 1 (TGM1, and keratin 1 (KRT1. The expression profiles are provided as bar graphs. Keywords: Real-time PCR, Gene expression profile, Fibroblast, Keratinocyte, Holy basil extract, Ocimum tenuiflorum, Maduruthala, Malabar nut plant extract, Justicia adhatoda, Adayhoda, Emblic myrobalan extract, Phyllanthus emblica, Nelli
Energy Technology Data Exchange (ETDEWEB)
Bhartiya, Uma S; Raut, Yogita S; Joseph, Lebana J [Laboratory Nuclear Medicine Section, Radiochemistry and Isotope Group, Bhabha Atomic Research Centre, Tata Memorial Hospital Annexe, Parel, Mumbai (India); Rao, Badanidiyoor S [Radiological Physics and Advisory Division, Bhabha Atomic Research Centre, Mumbai (India)
2006-08-15
Radioprotective effect of aqueous extract of Ocimum sanctum (40 mg/kg body weight, for 15 days) in mice exposed to high-doses (3.7 MBq) of oral {sup 131}Iodine was investigated by studying the organ weights, lipid peroxidation and antioxidant defense enzymes in various target organs like liver, kidneys, salivary glands and stomach at 24 hr after exposure in adult Swiss mice. The mean weight of the salivary glands showed significant increase after {sup 131}Iodine administration. {sup 131}Iodine exposure significantly increased lipid peroxidation in kidneys and salivary glands in comparison to control animals. Pretreatment with O. sanctum in radioiodine exposed group showed significant reduction in lipid peroxidation in both kidneys and salivary glands. In liver, reduced glutathione (GSH) levels showed significant reduction after radioiodine exposure while pretreatment with O. sanctum exhibited less depletion in GSH level even after {sup 131}Iodine exposure. However, no such changes were observed in stomach. The results indicate the possibility of using aqueous extract of O. sanctum for ameliorating {sup 131}lodine induced damage to the salivary glands. (author)
Directory of Open Access Journals (Sweden)
Darclet Teresinha Malerbo-Souza
2004-03-01
Full Text Available The objective of this study was to test repellent substances for honey bees, Apis mellifera, for basil, Ocimum sellowii, and to study the most frequent insects in this crop as well as its behaviors. The frequency of honey bees did not decrease with the application of n.octyl.acetate, citronellal and 2.heptanone, used as repellents, in the concentrations 2.5, 5.0, 7.5 and 10.0% diluted in water. However, when the products (20% were diluted in water (75% and glycerine (5% were effective in repelling those bees of the basil flowers for a period of 20 minutes. The flower lasted, on average, 30 h from the bud phase until the flower withered. The flowers number opened by inflorescence was, on average, 5.65 flowers, and the inflorescence presented, on average, 160 flowers-buds. The basil was visited mainly for the honey bee (98.0%, followed by Augochloropsis electra bee - Halictidae (2.0% and visits sporadics of Diptera and Lepidoptera, collected only nectar. The honey bee frequency increased during the day to 14:00, decreasing soon after, accompanying the curve of the temperature sets registered in the experiment days.O objetivo do experimento foi estudar a polinização em manjericão (Ocimum sellowii, a fim de verificar sua atratividade para as abelhas Apis mellifera, os insetos mais freqüentes, bem como seus comportamentos e testar substâncias repelentes para as abelhas A. mellifera. A flor durou, em média, 30 horas, desde sua abertura até o murchamento. O número de flores abertas por inflorescência foi, em média, 5,65 flores, sendo que a inflorescência possuía, em média, 160 botões florais. O manjericão foi visitado quase que exclusivamente pela abelha A. mellifera africanizada (98,0%, seguida pela abelha Augochloropsis electra-Halictidae (2,0% e visitas esporádicas de dípteros e lepidópteros, sendo que todos coletavam apenas néctar. A freqüência da abelha africanizada aumentou no decorrer do dia até às 14 horas, diminuindo em
Shifting the Role of the Arts in Education.
Goldberg, Merryl; Bossenmeyer, Melinda
1998-01-01
SUAVE (Socios Unidos para Artes Via Educacion--United Community for Arts in Education) is an arts-integrated approach to teaching in multicultural and multilingual settings. A unique professional development project for San Diego-area teachers, SUAVE helps teachers develop ways to integrate the arts into mathematics, science, language arts, and…
Directory of Open Access Journals (Sweden)
Paulo Roberto Pravuschi
2010-10-01
Full Text Available O manjericão (Ocimum basilicum L. é uma planta aromática de importância econômica no Brasil, muito usado como tempero na preparação de alimentos. É também utilizado para a obtenção de óleo essencial, importante na indústria de perfumaria. O objetivo deste experimento foi analisar o efeito de cinco lâminas de irrigação, bem como uma análise da viabilidade econômica da aplicação da irrigação na produção do manjericão. O experimento foi conduzido no período de março a outubro de 2007. As lâminas foram baseadas na evaporação do Tanque Classe A (ECA sendo: 0, 50, 75, 100 e 150% ECA. As variáveis analisadas foram matéria seca das folhas e inflorescências, teor de óleo essencial, massa seca e comprimento de raízes. Foram calculadas a produtividade de óleo essencial e a receita líquida. A terceira colheita foi viável somente utilizando irrigação. A irrigação diáriaexcessiva prejudicou o desenvolvimento da planta. A lâmina de irrigação equivalente a 100% ECA promoveu a máxima produtividade de matéria seca (4.248,67 kg ha-1, assim como a máxima produtividade de óleo essencial (58,26 kg ha-1, apresentando receita líquida anualde R$ 2.543,82 ha-1.Basil (Ocimum basilicum L. is an aromatic plant of economic importance in Brazil, very used as a spice for food preparation. It is also used to obtain essential oil, which important in the perfume industry. The purpose of this experiment was to analyze the effect of five irrigation water depths, as well as an economic viability analysis of the application of irrigation in basil production. The experiment was carried out from March to October 2007. The water depths were based in the cumulative class A pan evaporation (CPE: 0, 50, 75, 100 and 150% CPE. The analyzed variables were dry weight for leaves and flowers, content of essential oil, and dry mass and length of root zone. The essential oil yield and net return were calculated. The third harvest was possible only
Directory of Open Access Journals (Sweden)
Marcio Mazutti
2006-12-01
Full Text Available This work reports extraction yield and chemical characterization of the extracts obtained by high-pressure CO2 extraction of a cultivar of Ocimum basilicum L. The experiments were performed in the temperature range of 20 to 50 °C, from 100 to 250 atm of pressure. Chemical analyses were carried out by gas chromatography coupled to mass spectrometry, permitting to identify 23 compounds that were grouped into five chemical classes. Results showed that temperature and solvent density influenced positively the extraction yield. At 20 °C and 0.41 g cm-3 occurred a rise in the concentration of monoterpenes, oxygenated monoterpenes, sesquiterpenes and oxygenated sesquiterpenes.
Salehi, Fakhreddin; Kashaninejad, Mahdi; Tadayyon, Ali; Arabameri, Fatemeh
2015-08-01
Basil seed (Ocimum basilicum L.) has practical amounts of gum with good functional properties. In this work, extraction of gum from Basil seed was studied. Effect of pH, temperature and water/seed ratio on the kinetic and thermodynamic parameters; entropy, enthalpy and free energy of extraction were investigated. The maximum gum yield was 17.95 % at 50 °C for pH=7 and water/seed ratio 30:1. In this study, the experimental data were fitted to a mathematical model of mass transfer and equations constants were obtained. The kinetic of Basil seed gum extraction was found to be a first order mass transfer model. Statistical results indicated that the model used in this study will be able to predict the gum extraction from Basil seed adequately. It also found that ΔH and ΔS were positive and ΔG was negative indicating that the extraction process was spontaneous, irreversible and endothermic. The ΔH, ΔS and ΔG values were 0.26-7.87 kJ/mol, 8.12-33.2 J/mol K and 1.62-4.42 kJ/mol, respectively.
Kulan, Engin Gökhan
2013-01-01
Bu çalışma Eskişehir Osmangazi Üniversitesi Ziraat Fakültesi Tarla Bitkileri Bölümü deneme alanında 2010 yılında yürütülmüştür. Denemede Eskişehir ekolojik koşullarında yetiştirilen reyhan (Ocimum basilicum L.) bitkisinin verim ve verim özellikleri ile farklı biçim saatlerinin reyhanın uçucu yağı ve uçucu yağ bileşimi üzerine olan etkileri incelenmiştir. Tesadüf bloklarında bölünmüş parseller deneme desenine göre 3 tekerrürlü olarak kurulan denemede reyhan bitkileri çiçeklen...
Directory of Open Access Journals (Sweden)
Hanaa Abbas M Yamani
2016-05-01
Full Text Available In recent years scientists worldwide have realized that the effective life span of any antimicrobial agent is limited, due to increasing development of resistance by microorganisms. Consequently, numerous studies have been conducted to find new alternative sources of antimicrobial agents, especially from plants. The aims of this project were to examine the antimicrobial properties of essential oils distilled from Australian-grown Ocimum teniflorum (Tulsi, to quantify the volatile components present in flower spikes, leaves and the essential oil, and to investigate the compounds responsible for any activity. Broth micro-dilution was used to determine the minimum inhibitory concentration (MIC of Tulsi essential oil against selected microbial pathogens. The oils, at concentrations of 4.5% and 2.25% completely inhibited the growth of Staphylococcus aureus (including MRSA and Escherichia coli, while the same concentrations only partly inhibited the growth of Pseudomonas aeruginosa. Of 54 compounds identified in Tulsi leaves, flower spikes or essential oil, three are proposed to be responsible for this activity; camphor, eucalyptol and eugenol. Since S. aureus (including MRSA, P. aeruginosa and E. coli are major pathogens causing skin and soft tissue infections, Tulsi essential oil could be a valuable topical antimicrobial agent for management of skin infections caused by these organisms.
Directory of Open Access Journals (Sweden)
Laurian Vlase
2014-04-01
Full Text Available This study was designed to examine the in vitro antioxidant and antimicrobial activities and to characterize the polyphenolic composition of the ethanolic extracts of Hyssopus officinalis, Ocimum basilicum and Teucrium chamaedrys. Qualitative and quantitative analysis of the major phenolic compounds were conducted using high-performance liquid chromatography coupled to mass spectrometry (HPLC-MS. The total polyphenols, caffeic acid derivatives and flavonoids content was spectrophotometrically determined. The phenolic profile showed the presence of phenolic acid derivatives (caftaric, gentisic, caffeic, p-coumaric, chlorogenic and ferulic acids, flavonoid glycosides (rutin, isoquercitrin and quercitrin and free flavonoid aglycons (luteolin, quercetin, in different concentrations. DPPH radical scavenging assay, Trolox equivalent antioxidant capacity (TEAC method, hemoglobin ascorbate peroxidase activity inhibition (HAPX assay, and electron paramagnetic resonance (EPR radicals detection were employed, revealing several aspects of the antioxidant activities of these species. The antimicrobial tests were performed using the disk diffusion assay. These extracts contained a large amount of the polyphenolic compounds (77.72, 175.57, and 243.65 mg/g, respectively, and they showed a good antioxidant activity, as witnessed by a number of methods. T. chamaedrys had a high antimicrobial activity. Besides their antioxidant activity, the antimicrobial effect of these extracts confirms the biological activities of these herbal medicinal products.
Directory of Open Access Journals (Sweden)
Zahra FAKHAR
2014-12-01
Full Text Available Increased interest in theuse of natural compounds instead of chemicals is due to concerns about the effect of synthetic ingredients on humans’ health and over environment. Therefore, in this study essential oil from Ocimum basilicum as a natural and safe compound, was applied at three levels (100, 200 and 300 μl/l as vapor and its effects on postharvest quality and storage life of ‘Golden Drop’ plums was evaluated. After application of treatments, the fruits were stored at +1 °C and 80-85% relative humidity for 42 days. During the storage period, samplings were carried out every week and to simulate market condition, they were kept at room temperate for 24 h. Then some of the qualitative and quantitative traits, such as total soluble solids (TSS, titrable acidity (TA, TSS/TA ratio, weight loss, firmness, ascorbic acid, total antioxidants, as well as color (L*, hue angle were measured. Results showed that the basil essential oil contributed to a better maintenance of
Hossain, M Amzad; Kabir, M J; Salehuddin, S M; Rahman, S M Mizanur; Das, A K; Singha, Sandip Kumar; Alam, Md Khorshed; Rahman, Atiqur
2010-05-01
The antibacterial potential of essential oils and methanol extracts of sweet basil Ocimum basilicum L. (Lamiaceae) was evaluated for controlling the growth range of food-borne pathogenic bacteria. Essential oils extracted by hydrodistillation from the leaves and stems were analyzed by GC-MS. Fifty-seven compounds representing 94.9 and 96.1% of the total leaf and stem oils, respectively, were identified, of which methyl chavicol (36.7 and 29.9%), gitoxigenin (9.3 and 10.2%), trimethoquinol (10.3 and 8.4%), beta-guaiene (3.7 and 4.1%), aciphyllene (3.4 and 3.0%), alizarin (3.2 and 4.4%), naphthaline (2.2 and 3.8%), (-)-caryophyllene (2.0 and 1.9%), and mequinol (1.6 and 1.8%) were the major compounds. The essential oils (10 microL/disc of 1:5, v/v dilution with methanol) and methanol extracts (300 microg/disc) of O. basilicum displayed a great potential of antibacterial activity against Bacillius cereus, B. subtilis, B. megaterium, Staphylococcus aureus, Listeria monocytogenes, Escherichia coli, Shigella boydii, S. dysenteriae, Vibrio parahaemolyticus, V. mimicus, and Salmonella typhi with their respective zones of inhibition of 11.2-21.1 mm and MIC values of 62.5-500 microg/mL. The results of this study suggest that the natural products derived from O. basilicum may have potential use in the food and/or pharmaceutical industries as antimicrobial agents.
Essential Oil of Ocimum basilicum L. and (−-Linalool Blocks the Excitability of Rat Sciatic Nerve
Directory of Open Access Journals (Sweden)
Antonio Medeiros Venancio
2016-01-01
Full Text Available The racemate linalool and its levogyrus enantiomer [(−-LIN] are present in many essential oils and possess several pharmacological activities, such as antinociceptive and anti-inflammatory. In this work, the effects of essential oil obtained from the cultivation of the Ocimum basilicum L. (EOOb derived from Germplasm Bank rich in (−-LIN content in the excitability of peripheral nervous system were studied. We used rat sciatic nerve to investigate the EOOb and (−-LIN effects on neuron excitability and the extracellular recording technique was used to register the compound action potential (CAP. EOOb and (−-LIN blocked the CAP in a concentration-dependent way and these effects were reversible after washout. EOOb blocked positive amplitude of 1st and 2nd CAP components with IC50 of 0.38±0.2 and 0.17±0.0 mg/mL, respectively. For (−-LIN, these values were 0.23±0.0 and 0.13±0.0 mg/mL. Both components reduced the conduction velocity of CAP and the 2nd component seems to be more affected than the 1st component. In conclusion EOOb and (−-LIN inhibited the excitability of peripheral nervous system in a similar way and potency, revealing that the effects of EOOb on excitability are due to the presence of (−-LIN in the essential oil.
α-Linalool - a marker compound of forged/synthetic sweet basil (Ocimum basilicum L.) essential oils.
Radulović, Niko S; Blagojević, Polina D; Miltojević, Ana B
2013-10-01
Ocimum basilicum L. (sweet basil) is known to occur as several chemotypes or cultivars that differ in their essential oil composition. The surprising discovery of 3,7-dimethylocta-1,7-dien-3-ol, the rare α isomer of the well-known monoterpene alcohol β-linalool (3,7-dimethylocta-1,6-dien-3-ol), in samples of Serbian basil oil provoked an investigation of the origin of α-linalool in these samples. Three scenarios were considered, namely (a) the existence of a new natural chemotype, (b) an artefactual formation during the isolation procedure and (c) the case of a synthetic/forged oil. Noteworthy amounts (15.1-16.9%) of pure α-linalool were isolated from a commercial sample of basil oil, and detailed spectral analyses (MS, IR, (1) H and (13) C NMR) unequivocally confirmed its identity. The analysis by GC and GC/MS of an additional 20 samples of different O. basilicum oils commercially available on the Serbian market or isolated from plant material cultivated in Serbia resulted in the identification of 149 compounds. The obtained compositional data were compared using multivariate statistical analysis to reveal the possible existence of a new basil chemotype. The results of the chemical and statistical analyses give more pro arguments for the synthetic/forged oil hypothesis and suggest that α-linalool could be used as a marker compound of such O. basilicum oils. © 2013 Society of Chemical Industry.
Pedro, Alessandra C; Moreira, Fernanda; Granato, Daniel; Rosso, Neiva D
2016-05-13
In the current study, response surface methodology (RSM) was used to assess the effects of extraction time and temperature on the content of bioactive compounds and antioxidant activity of purple basil leaf (Ocimum basilicum L.) extracts. The stability of anthocyanins in relation to temperature, light and copigmentation was also studied. The highest anthocyanin content was 67.40 mg/100 g extracted at 30 °C and 60 min. The degradation of anthocyanins with varying temperatures and in the presence of light followed a first-order kinetics and the activation energy was 44.95 kJ/mol. All the extracts exposed to light showed similar half-lives. The extracts protected from light, in the presence of copigments, showed an increase in half-life from 152.67 h for the control to 856.49 and 923.17 h for extract in the presence of gallic acid and phytic acid, respectively. These results clearly indicate that purple basil is a potential source of stable bioactive compounds.
Popović, Zorica; Kostić, Miroslav; Stanković, Sladjan; Milanović, Slobodan; Sivčev, Ivan; Kostić, Igor; Kljajić, Petar
2013-01-01
Abstract Ethanol solutions of five fractions obtained from essential oil of sweet basil Ocimum basilicum L. (Lamiales: Lamiaceae) (F1-F5) were tested for their antifeedant properties against 2(nd) instar gypsy moth larvae, Lymantria dispar L. (Lepidoptera: Lymantriidae), in laboratory non-choice and feeding-choice experiments. Prior to bioassays, the chemical composition of each fraction was determined by gas chromatography analyses. Significant larval deterrence from feeding was achieved by application of tested solutions to fresh leaves of the host plant. The most effective were were F1 (0.5%), F4 (0.05, 0.1, and 0.5%), and F5 (0.1 and 0.5%), which provided an antifeedant index > 80% after five days. A low rate of larval mortality was observed in no-choice bioassay. In situ screening of chlorophyll fluorescence as an indicator of plant stress level (assessed by the induced fluorometry) confirmed that the tested compounds did not cause alternations in the photosynthetic efficiency of treated leaves.
Behbahani, Mandana
2014-01-01
The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231) and normal breast cell line (MCF 10A). The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.
Directory of Open Access Journals (Sweden)
Julio Colivet
2011-12-01
Full Text Available La albahaca (Ocimum basilicum L. es una planta herbácea de la familia de las labiadas (Lamiaceae, muy común en Venezuela. En la presente investigación se evaluó la supervivencia de una cepa de Staphylococcus aureus por la acción antimicrobiana de extractos etanólicos de albahaca fresca y seca. Las muestras frescas fueron sometidas a homogeneización en licuadora. Para la obtención de las muestras secas se utilizó una estufa convencional a temperatura de 55 ºC x 28 horas. Los extractos se obtuvieron por destilación a presión reducida, temperatura de 45 ºC y empleando etanol como solvente. Posteriormente, se emplearon en medios de cultivo contentivos de S. aureus y se monitoreó el crecimiento del microorganismo en el tiempo, obteniéndose los parámetros de crecimiento a través del modelo de Baranyi y Roberts (1994. Los extractos frescos y secos produjeron efecto antimicrobiano sobre S. aureus a concentraciones de 5 y 10 %, afectando los parámetros de crecimiento de la bacteria, presentando diferencias estadísticamente significativas (p < 0,05 con respecto al grupo control.
Anatomia e ultraestrutura foliar de Ocimum gratissimum sob diferentes níveis de radiação luminosa
Directory of Open Access Journals (Sweden)
Valéria Ferreira Fernandes
2014-06-01
Full Text Available Espécies vegetais são capazes de ajustar suas características fisiológicas, anatômicas e ultraestruturais aos fatores ambientais, como, por exemplo, a disponibilidade de radiação luminosa incidente. O objetivo deste estudo foi avaliar a influência de diferentes níveis de radiação luminosa na anatomia e ultraestrutura foliar de Ocimum gratissimum L. (Lamiaceae. As plantas foram cultivadas por 93 dias em quatro níveis de radiação fotossinteticamente ativa (20, 11, 7 e 4mol m-2 d-1. O incremento da intensidade de luz proporcionou aumento no espessamento dos parênquimas paliçádico e esponjoso e do limbo foliar, entretanto, a espessura da epiderme não foi alterada. Em relação aos aspectos ultraestruturais, verificou-se aumento no tamanho dos cloroplastos e grãos de amido e um aumento do empilhamento dos tilacoides com a redução da intensidade de luz. As variações anatômicas e ultraestruturais verificadas confirmam a plasticidade fenotípica dessa espécie em função da intensidade de radiação luminosa.
Directory of Open Access Journals (Sweden)
Julio Colivet
2011-01-01
Full Text Available La albahaca (Ocimum basilicum L. es una planta herbácea de la familia de las labiadas (Lamiaceae, muy común en Venezuela. En la presente investigación se evaluó la supervivencia de una cepa de Staphylococcus aureus por la acción antimicrobiana de extractos etanólicos de albahaca fresca y seca. Las muestras frescas fueron sometidas a homogeneización en licuadora. Para la obtención de las muestras secas se utilizó una estufa convencional a temperatura de 55 ºC x 28 horas. Los extractos se obtuvieron por destilación a presión reducida, temperatura de 45 ºC y empleando etanol como solvente. Posteriormente, se emplearon en medios de cultivo contentivos de S. aureus y se monitoreó el crecimiento del microorganismo en el tiempo, obteniéndose los parámetros de crecimiento a través del modelo de Baranyi y Roberts (1994. Los extractos frescos y secos produjeron efecto antimicrobiano sobre S. aureus a concentraciones de 5 y 10 %, afectando los parámetros de crecimiento de la bacteria, presentando diferencias estadísticamente significativas (p < 0,05 con respecto al grupo control.
Directory of Open Access Journals (Sweden)
Mandana Behbahani
Full Text Available The present investigation was carried out to study the relationship between presence of cytotoxic compounds in Ocimum basilicum, Alhagi maurorum, Calendula officinalis and their parasite Cuscuta campestris. The cytotoxic activity of the pure compounds was performed by MTT assay against breast cancer cell lines (MCF-7 and MDA-MB-231 and normal breast cell line (MCF 10A. The induction of apoptosis was measured by the expression levels of p53, bcl-2, bax and caspase-3 genes using quantitative Real Time PCR. Three active fractions were detected by nuclear magnetic resonance as lutein, lupeol and eugenol, respectively, in C. officinalis, A. maurorum and O. basilicum. These compounds and their epoxidized forms were also detected in their parasite C. campestris. The cytotoxic activity of lutein epoxide, lupeol epoxide and eugenol epoxide was significantly more than lutein, lupeol and eugenol. The mRNA expression level of p53, caspase-3 and bax genes were increased in both cancer cells treated with all pure compounds. However, bcl-2 gene expression decreased in treated breast cancer cells. In conclusion, all the data indicated that the epoxide forms of lupeol, lutein and eugenol are potential drug candidates for inducing apoptosis in human breast cancer cells.
Small UAV Automatic Ground Collision Avoidance System Design Considerations and Flight Test Results
Sorokowski, Paul; Skoog, Mark; Burrows, Scott; Thomas, SaraKatie
2015-01-01
The National Aeronautics and Space Administration (NASA) Armstrong Flight Research Center Small Unmanned Aerial Vehicle (SUAV) Automatic Ground Collision Avoidance System (Auto GCAS) project demonstrated several important collision avoidance technologies. First, the SUAV Auto GCAS design included capabilities to take advantage of terrain avoidance maneuvers flying turns to either side as well as straight over terrain. Second, the design also included innovative digital elevation model (DEM) scanning methods. The combination of multi-trajectory options and new scanning methods demonstrated the ability to reduce the nuisance potential of the SUAV while maintaining robust terrain avoidance. Third, the Auto GCAS algorithms were hosted on the processor inside a smartphone, providing a lightweight hardware configuration for use in either the ground control station or on board the test aircraft. Finally, compression of DEM data for the entire Earth and successful hosting of that data on the smartphone was demonstrated. The SUAV Auto GCAS project demonstrated that together these methods and technologies have the potential to dramatically reduce the number of controlled flight into terrain mishaps across a wide range of aviation platforms with similar capabilities including UAVs, general aviation aircraft, helicopters, and model aircraft.
Directory of Open Access Journals (Sweden)
Cláudio Lúcio Fernandes Amaral
2004-04-01
Full Text Available O Gênero Ocimum, da Família Lamiaceae, compreende plantas ricas em óleos essenciais destinados às industrias para produção de fármacos, perfumes e cosméticos. O conhecimento do sistema reprodutivo é extremamente relevante, pois permite definir estratégias de seleção com base em cruzamentos intra e interpopulacionais. O objetivo deste trabalho foi estudar a biologia floral e os mecanismos reprodutivos do alfavacão com vistas ao melhoramento genético. A atividade floral compreendeu três estádios florais: primeiro, pré-antese, quando ocorreu a polinização; segundo, antese, quando aconteceu a abertura assincrônica de estames e, terceiro, pós-antese, quando houve a fecundação dos óvulos. O processo de antese está intimamente relacionado com as condições climáticas. Os acessos de O. officinalis do Banco de Germoplasma de Plantas Medicinais da UESB, apesar de se reproduzirem, predominantemente, por autofecundação, podem apresentar fecundação cruzada, o que evidencia a ampla versatilidade reprodutiva dessa espécie, acentuando a variabilidade genética, a qual é essencial para sua evoluçãoSome of the plants from Ocimum genus in Lamiaceae family are source of essential oils used in pharmacy, perfume and cosmetics industry. The knowledge of mate systems is extremely important because it allows to define selection strategies based on intra and interpopulation crossbreeding. The aim of this work was to study floral biology and reproductive mechanisms of alfavacão aiming at genetic improvement. The floral activity included three floral stages: first, pre-anthesis, when the pollination happened; second, anthesis, when the asynchronous opening of stamens happened; and third, pos-anthesis, when there was the fecundation of the ova. The anthesis process is intimately related to climatic conditions. The accesses of O. officinalis from Banco de Germoplasma de Plantas Medicinais da UESB (Medicinal Plants Germplasm Bank from UESB
Sakalauskaitė, Jurga; Viskelis, Pranas; Dambrauskienė, Edita; Sakalauskienė, Sandra; Samuolienė, Giedrė; Brazaitytė, Aušra; Duchovskis, Pavelas; Urbonavičienė, Dalia
2013-04-01
The effects of short-term ultraviolet B (UV-B) irradiation on sweet basil (Ocimum basilicum L. cv. Cinnamon) plants at the 3-4 leaf pair and flowering stages were examined in controlled environment growth chambers. Plants were exposed to 0 (reference), 2 and 4 kJ UV-B m(-2) day(-1) over 7 days. Exposure of basil plants to supplementary UV-B light resulted in increased assimilating leaf area, fresh biomass and dry biomass. Stimulation of physiological functions in young basil plants under either applied UV-B dose resulted in increased total chlorophyll content but no marked variation in carotenoid content. At the flowering stage the chlorophyll and carotenoid contents of basil were affected by supplementary UV-B radiation, decreasing with enhanced UV-B exposure. Both total antioxidant activity (2,2-diphenyl-1-picrylhydrazyl free radical assay) and total phenolic compound content were increased by UV-B light supplementation. Young and mature basil plants differed in their ascorbic acid content, which was dependent on UV-B dose and plant age. UV-B radiation resulted in decreased nitrate content in young basil plants (3-4 leaf pair stage). These results indicate that the application of short-exposure UV-B radiation beneficially influenced both growth parameters and biochemical constituents in young and mature basil plants. © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Majid Saeedi
2015-01-01
Full Text Available Polysaccharide mucilage derived from the seeds of Ocimum basilicum L. (family Lamiaceae was investigated for use in matrix formulations containing propranolol hydrochloride. Basil mucilage was extracted and several tablets were formulated. The effect of mucilage on drug release rate was evaluated in comparison with tablets containing two kinds of hydroxypropyl methylcellulose (HPMC K4M and HPMC K100M as standard polymer. The release data were fitted to several models for kinetic evaluation. The results showed that hardness decreased and friability of tablets increased as the concentration of mucilage increased. The rate of release of propranolol HCl from O. basilicm mucilage matrices was mainly controlled by the drug: mucilage ratio. Drug release was slower from the HPMC K4M and HPMCK100M containing tablets compared to the mucilage containing matrices than the drug release from matrices containing O. basilicum seed mucilage in similar ratios. Formulations containing O. basilicm mucilage were found to exhibit suitable release pattern. The results of kinetic analysis showed that in tablets containing O. basilicm mucilage the highest correlation coefficient was achieved with the zero order model. The swelling and erosion studies revealed that, as the proportion of mucilage in tablets was increased, there was a corresponding increase in percent swelling and a decrease in percent erosion of tablets.
Directory of Open Access Journals (Sweden)
Subhrajit Saha
2016-12-01
Full Text Available Traditional agricultural systems are challenged by globally declining resources resulting from climate change and growing population. Alternative agricultural practices such as aquaponics (includes crop plant and aquatic species and hydroponics (includes crop plant only have the potential to generate high yield per unit area using limited land, water, and no soil. A soilless agricultural study was conducted at the Georgia Southern University, Statesboro, GA, USA from August to November, 2015. The growth, yield, quality, and nutrition of basil (Ocimum basilicum L. cultivar Aroma 2, were compared between aquaponic and hydroponic systems using crayfish (Procambarus spp. as the aquatic species. Non-circulating floating raft systems were designed using 95 L polyethylene tanks. Equal amounts of start-up fertilizer dose were applied to both systems. The objective was to understand how the additional nutritional dynamics associated with crayfish influence the basil crop. Both fresh and dry basil plant weights were collected after harvest, followed by leaf nutrient analysis. Leaf chlorophyll content, water pH, nitrogen and temperature were measured periodically. Aquaponic basil (AqB showed 14%, 56%, and 65% more height, fresh weight, and dry weight, respectively, compared to hydroponic basil (HyB. It is logical to assume that crayfish waste (excreta and unconsumed feed has supplied the additional nutrients to AqB, resulting in greater growth and yield. The chlorophyll content (plant quality or leaf nutrients, however, did not differ between AqB and HyB. Further research is needed to investigate aquaponic crayfish yield, overall nutritional dynamics, cost-benefit ratio, and other plant characteristics under soilless systems.
Directory of Open Access Journals (Sweden)
Santanu Kar Mahapatra
2011-01-01
Full Text Available The aim of this present study was to evaluate the immune functions and immune responses in nicotine-induced (10 mM macrophages and concurrently establish the immunomodulatory role of aqueous extract of Ocimum gratissimum (Ae-Og and ascorbic acid. In this study, nitrite generations and some phenotype functions by macrophages were studied. Beside that, release of Th1 cytokines (TNF-α, IL-12 and Th2 cytokines (IL-10, TGF-β was measured by ELISA, and the expression of these cytokines at mRNA level was analyzed by real-time PCR. Ae-Og, at a dose of 10 μg/mL, significantly reduced the nicotine-induced NO generation and iNOSII expression. Similar kinds of response were observed with supplementation of ascorbic acid (0.01 mM. The administration of Ae-Og and ascorbic acid increased the decreased adherence, chemotaxis, phagocytosis, and intracellular killing of bacteria in nicotine-treated macrophages. Ae-Og and ascorbic acid were found to protect the murine peritoneal macrophages through downregulation of Th1 cytokines in nicotine-treated macrophages with concurrent activation of Th2 responses. These findings strongly enhanced our understanding of the molecular mechanism leading to nicotine-induced suppression of immune functions and provide additional rationale for application of anti-inflammatory therapeutic approaches by O. gratissimum and ascorbic acid for different inflammatory disease prevention and treatment during nicotine toxicity.
Cardoso, Nathalia N R; Alviano, Celuta S; Blank, Arie F; Arrigoni-Blank, Maria de Fátima; Romanos, Maria Teresa V; Cunha, Marcel M L; da Silva, Antonio Jorge R; Alviano, Daniela S
2017-12-01
Ocimum basilicum L. (Lamiaceae) has been used in folk medicine to treat headaches, kidney disorders, and intestinal worms. This study evaluates the anti-cryptococcal activity of ethanol crude extract and hexane fraction obtained from O. basilicum var. Maria Bonita leaves. The MIC values for Cryptococcus sp. were obtained according to Clinical and Laboratory Standards Institute in a range of 0.3-2500 μg/mL. The checkerboard assay evaluated the association of the substances tested (in a range of 0.099-2500 μg/mL) with amphotericin B and O. basilicum essential oil for 48 h. The ethanol extract, hexane fraction and associations in a range of 0.3-2500 μg/mL were tested for pigmentation inhibition after 7 days of treatment. The inhibition of ergosterol synthesis and reduction of capsule size were evaluated after the treatment with ethanol extract (312 μg/mL), hexane fraction (78 μg/mL) and the combinations of essential oil + ethanol extract (78 μg/mL + 19.5 μg/mL, respectively) and essential oil + hexane fraction (39.36 μg/mL + 10 μg/mL, respectively) for 24 and 48 h, respectively. The hexane fraction presented better results than the ethanol extract, with a low MIC (156 μg/mL against C. neoformans T 444 and 312 μg/mL against C. neoformans H99 serotype A and C. gattii WM779 serotype C). The combination of the ethanol extract and hexane fraction with amphotericin B and essential oil enhanced their antifungal activity, reducing the concentration of each substance needed to kill 100% of the inoculum. The substances tested were able to reduce the pigmentation, capsule size and ergosterol synthesis, which suggest they have important mechanisms of action. These results provide further support for the use of ethanol extracts of O. basilicum as a potential source of antifungal agents.
Directory of Open Access Journals (Sweden)
Mohammad Aghaei
2012-06-01
Full Text Available The study of genetic relationships is a prerequisite for plant breeding activities as well as for conservation of genetic resources. In the present study, genetic diversity among 50 Iranian basil (Ocimum basilicum L. accessions was determined using inter simple sequence repeat (ISSR markers. Thirty-eight alleles were generated at 12 ISSR loci. The number of alleles per locus ranged from 1 to 5 with an average of 3.17. The maximum number of alleles was observed at the A7, 818, 825 and 849 loci, and their size ranged from 300 to 2500 bp. A similarity matrix based on Jaccard's coefficient for all 50 basil accessions gave values from 1.00-0.60. The maximum similarity (1.00 was observed between the "Urmia" and "Shahr-e-Rey II" accessions as well as between the "Urmia" and "Qazvin II" accessions. The lowest similarity (0.60 was observed between the "Tuyserkan I" and "Gom II" accessions. The unweighted pair- group method using arithmetique average UPGMA clustering algorithm classified the studied accessions into three distinct groups. All of the basil accessions, with the exception of "Babol III", "Ahvaz II", "Yazd II" and "Ardebil I", were placed in groups I and II. Leaf colour was a specific characteristic that influenced the clustering of Iranian basil accessions. Because of this relationship, the results of the principal coordinate analysis (PCoA approximately corresponded to those obtained through cluster analysis. Our results revealed that the geographical distribution of genotypes could not be used as a basis for crossing parents to obtain high heterosis, and therefore, it must be carried out by genetic studies.O estudo das relações genéticas é um pré-requisito para atividades em reprodução de plantas assim como para conservação de recursos genéticos. Neste trabalho a diversidade genética entre 50 acessos de Manejericão Iraniano (Ocimum basilicum L. foram determinadas usando marcadores de Seqüência Simples Repetida Interna (ISSR
Keramati, Sara; Pirdashti, Hemmatollah; Babaeizad, Valliollah; Dehestani, Ali
2016-12-01
Essential oil content and oil composition of paclobutrazol treated sweet basil (Ocimum basilicum L.) plant inoculated with Piriformospora indica under salt stress were investigated by GC-MS. The results show a slight increase in essential oil content when basil plants subjected to moderate salinity stress (3 dS m -1 of NaCl). It decreased signifiicantly with increasing salinity level to 9 dS m -1 . The findings revealed that leaf area, above ground and leaf dry weights, essential oil content and yield were significantly affected by P. indica inoculation, however paclobutrazol application significantly influenced essential oil yield but not content. Fungal symbiosis as well as paclobutrazol application ameliorated the negative effects of salinity on dry matter and essential oil yield. The main constituents found in the volatile oil of O. basilicum in control treatment were Geranial (26.03%), Neral (24.88%) and Estragole (24.78%). The compounds concentrations showed some differences in P. indica and paclobutrazol treatments. The results demonstrate that micorrhiza-like fungi concomitantly increase essential oil production and biomass in sweet basil, a medicinal herb rich in commercially valuable essential oils.
Murugan, Kadarkarai; Aarthi, Narayanan; Kovendan, Kalimuthu; Panneerselvam, Chellasamy; Chandramohan, Balamurugan; Kumar, Palanisamy Mahesh; Amerasan, Duraisamy; Paulpandi, Manickam; Chandirasekar, Ramachandran; Dinesh, Devakumar; Suresh, Udaiyan; Subramaniam, Jayapal; Higuchi, Akon; Alarfaj, Abdullah A; Nicoletti, Marcello; Mehlhorn, Heinz; Benelli, Giovanni
2015-10-01
Each year, mosquito-borne diseases infect nearly 700 million people, resulting to more than 1 million deaths. In this study, we evaluated the larvicidal, pupicidal, and smoke toxicity of Senna occidentalis and Ocimum basilicum leaf extracts against the malaria vector Anopheles stephensi. Furthermore, the antiplasmodial activity of plant extracts was evaluated against chloroquine (CQ)-resistant (CQ-r) and CQ-sensitive (CQ-s) strains of Plasmodium falciparum. In larvicidal and pupicidal experiments, S. occidentalis LC50 ranged from 31.05 (I instar larvae) to 75.15 ppm (pupae), and O. basilicum LC50 ranged from 29.69 (I instar larvae) to 69 ppm (pupae). Smoke toxicity experiments conducted against adults showed that S. occidentalis and O. basilicum coils evoked mortality rates comparable to the pyrethrin-based positive control (38, 52, and 42%, respectively). In antiplasmodial assays, Senna occidentalis 50% inhibitory concentration (IC50) were 48.80 μg/ml (CQ-s) and 54.28 μg/ml (CQ-r), while O. basilicum IC50 were 68.14 μg/ml (CQ-s) and 67.27 μg/ml (CQ-r). Overall, these botanicals could be considered as potential sources of metabolites to build newer and safer malaria control tools.
Directory of Open Access Journals (Sweden)
Daniel I. Hădărugă
2014-11-01
Full Text Available Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed–uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC–MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.
Directory of Open Access Journals (Sweden)
A. K. M. Mominul Islam
2014-01-01
Full Text Available Phytotoxic activity of Ocimum tenuiflorum (Lamiaceae plant extracts was investigated against the germination and seedling growth of cress (Lepidium sativum, lettuce (Lactuca sativa, alfalfa (Medicago sativa, Italian ryegrass (Lolium multiflorum, barnyard grass (Echinochloa crus-galli, and timothy (Phleum pratense at four different concentrations. The plant extracts at concentrations greater than 30 mg dry weight equivalent extract mL−1 reduced significantly the total germination percent (GP, germination index (GI, germination energy (GE, speed of emergence (SE, seedling vigour index (SVI, and coefficient of the rate of germination (CRG of all test species except barnyard grass and GP of lettuce. In contrast, time required for 50% germination (T50 and mean germination time (MGT were increased at the same or higher than this concentration. The increasing trend of T50 and MGT and the decreasing trend of other indices indicated a significant inhibition or delay of germination of the test species by O. tenuiflorum plant extracts and vice versa. In addition, the shoot and root growth of all test species were significantly inhibited by the extracts at concentrations greater than 10 mg dry weight equivalent extract mL−1. The I50 values for shoot and root growth were ranged from 26 to 104 mg dry weight equivalent extract mL−1. Seedling growth was more sensitive to the extracts compared to seed germination. Results of this study suggest that O. tenuiflorum plant extracts have phytotoxic properties and thus contain phytotoxic substances. Isolation and characterization of those substances from this plant may act as a tool for new natural, biodegradable herbicide development to control weeds.
Effects of various organic and chemical fertilizers on growth indices of basil (Ocimum basilicum L.
Directory of Open Access Journals (Sweden)
S.M.K. Tahami
2016-05-01
Full Text Available In order to develop the high intensive agriculture, more chemical fertilizers are applied to the soil that resulting in soil degradation and environment deterioration. Application of organic manure is an important approach for maintaining and improving the soil fertility and increasing fertilizer use efficiency. Therefore, in order to evaluate the effect of organic manures and chemical fertilizer on growth indices and biological yield of basil (Ocimum basilicum L., an experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, during growing season of 2008-2009. A complete randomized block design with six treatments and three replications was used. The treatments were: cow manure, sheep manure, chicken manure, vermicompost, chemical NPK fertilizers and control (no fertilizer. The results showed that the use of organic fertilizers significantly increased seed and biological yield of basil compared with chemical fertilizer and control. The maximum and the minimum dry weights were observed at 105 days after planting, in sheep and cow manures, respectively. Gradually during the period of plant growth and development to reproduction phase percent of stem decreased and dry weight of inflorescence increased. The highest and the lowest leaf area index were observed at 90 days after planting, in cow manure and control, respectively, and then decreased in all treatments. The maximum crop growth rate in most of treatments at 90 days after planting was obtained, except the control which plant growth rate was lowest. Net assimilation rate (NAR in most treatments increased until 75 days after planting and then declined. While the highest and the lowest NAR were observed at 75 days after planting in chicken manure and chemical treatment, respectively.
Hădărugă, Daniel I; Hădărugă, Nicoleta G; Costescu, Corina I; David, Ioan; Gruia, Alexandra T
2014-01-01
Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD) complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed-uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC-MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole) was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.
Directory of Open Access Journals (Sweden)
José Coelho
2018-03-01
Full Text Available Interest in new products from aromatic plants as medical and nutritional compounds is increasing. The aim of this work was to apply different extraction methods, including the use of supercritical carbon dioxide extraction, and to test the antioxidant activity of basil (Ocimum basilicum L. extracts. In vitro efficacy assessments were performed using enzymatic assays. Essential oil obtained by hydrodistillation and volatile oil obtained from supercritical fluid extraction were analyzed by gas chromatography to quantify components. The total phenolic content in the extracts ranged from 35.5 ± 2.9 to 85.3 ± 8.6 mg of gallic acid equivalents and the total flavonoid content ranged from 35.5 ± 2.9 to 93.3 ± 3.9 micromole catechin equivalents per gram of dry weight of extract. All the extracts showed an antioxidant activity with 2,2-diphenyl-1-picrylhydrazyl (DPPH, 2,2-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid (ABTS, and the reducing power test. Extracts obtained from methanol had a higher antioxidant capacity per the DPPH test results (IC50 = 3.05 ± 0.36 mg/mL and the reducing power test assay 306.8 ± 21.8 μmol of trolox equivalents per gram of extract (TE/g compared with ethanolic or supercritical fluid extracts. However, using the ABTS assay, the extract obtained by supercritical fluid extraction had a higher antioxidant capacity with an IC50 of 1.74 ± 0.05 mg/mL. Finally, the examined extracts showed practically no acetylcholinesterase (AChE inhibitory capacity and a slight inhibitory activity against tyrosinase.
Fungal Endophyte Diversity and Bioactivity in the Indian Medicinal Plant Ocimum sanctum Linn.
Directory of Open Access Journals (Sweden)
Kanika Chowdhary
Full Text Available Endophytic mycopopulation isolated from India's Queen of herbs Tulsi (Ocimum sanctum were explored and investigated for their diversity and antiphytopathogenic activity against widespread plant pathogens Botrytis cinerea, Sclerotinia sclerotiorum, Rhizoctonia solani and Fusarium oxysporum. 90 fungal isolates, representing 17 genera were recovered from 313 disease-free and surface sterilised plant segments (leaf and stem tissues from three different geographic locations (Delhi, Hyderabad and Mukteshwar during distinct sampling times in consequent years 2010 and 2011 in India. Fungal endophytes were subjected to molecular identification based on rDNA ITS sequence analysis. Plant pathogens such as F. verticillioides, B. maydis, C. coarctatum, R. bataticola, Hypoxylon sp., Diaporthe phaseolorum, Alternaria tenuissima and A. alternata have occurred as endophyte only during second sampling (second sampling in 2011 in the present study. Bi-plot generated by principal component analysis suggested tissue specificity of certain fungal endophytes. Dendrogram revealed species abundance as a function of mean temperature of the location at the time of sampling. Shannon diversity in the first collection is highest in Hyderabad leaf tissues (H' = 1.907 whereas in second collection it was highest from leaf tissues of Delhi (H' = 1.846. Mukteshwar (altitude: 7500 feet reported least isolation rate in second collection. Nearly 23% of the total fungal isolates were considered as potent biocontrol agent. Hexane extract of M. phaseolina recovered from Hyderabad in first collection demonstrated highest activity against S. sclerotiorum with IC50 value of 0.38 mg/ml. Additionally, its components 2H-pyran-2-one, 5,6-dihydro-6-pentyl and palmitic acid, methyl ester as reported by GC-MS Chromatogram upon evaluation for their antiphytopathogenic activity exhibited IC50 value of 1.002 and 0.662 against respectively S. sclerotiorum indicating their significant role in
Anti-herpes simplex virus activity of extracts from the culinary herbs ...
African Journals Online (AJOL)
This study demonstrates anti-herpes simplex virus activity of dichloromethane and methanol extracts of Ocimum sanctum L., Ocimum basilicum L. and Ocimum americanum L. Green monkey kidney cells were protected from HSV-2 infection by the dichloromethane extract of O. americanum L. and the methanol extract of O.
Kubiça, Thaís F; Alves, Sydney H; Weiblen, Rudi; Lovato, Luciane T
2014-01-01
The bovine viral diarrhoea virus (BVDV) is suggested as a model for antiviral studies of the hepatitis C virus (HCV). The antiviral activity of the essential oil of Ocimum basilicum and the monoterpenes camphor, thymol and 1,8-cineole against BVDV was investigated. The cytotoxicities of the compounds were measured by the MTT (3-(4.5-dimethylthiazol-2-yl)-2.5-diphenyltetrazolium bromide) test, and the antiviral activities were tested by the plaque reduction assay. The oil or compounds were added to the assay in three different time points: a) pre-treatment of the virus (virucidal assay); b) pre-treatment of the cells; or c) post-treatment of the cells (after virus inoculation). The percentage of plaques inhibition for each compound was determined based on the number of plaques in the viral control. The results were expressed by CC50 (50% cytotoxic concentration), IC50 (inhibitory concentration for 50% of plaques) and SI (selectivity index = CC50/IC50). Camphor (CC50 = 4420.12 μg mL(-1)) and 1,8-cineole (CC50 = 2996.10 μg mL(-1)) showed the lowest cytotoxicities and the best antiviral activities (camphor SI = 13.88 and 1,8-cineol SI = 9.05) in the virucidal assay. The higher activities achieved by the monoterpenes in the virucidal assay suggest that these compounds act directly on the viral particle.
Directory of Open Access Journals (Sweden)
S.M.K. Tahami
2016-04-01
Full Text Available In order to have a sustainable agriculture it is necessary to use environmental friendly inputs to improve ecological aspects of environment. Basil (Ocimum basilicum L. is a medicinal and vegetable crop which is cultivated in different parts of the world. An experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in year 2009. A complete randomized block design with six treatments, and three replications was used. The treatments were: control (no fertilizer, cow manure, sheep manure, hen manure, vermin-compost and NPK fertilizers. Results showed that all studied organic manures were high in measured characters in compare with chemical fertilizer. The highest plant height, leaf yield, fresh and dry matter were obtained at vermicompost. Treatments have no significant affect on Essential oil percentage. The highest essential oil yield was obtained in cow manure treatments. Third cut and the first cut had the maximum and the minimum of leaf yield, fresh and dry shoot yield, respectively. Essential oil percentage in the first cut was significantly more than other cuts, but essential oil yield, were the highest in third cut because this cut produced highest leaf yield. There was no significant difference between chemical fertilizers and control treatment in all characters except green area index and fresh and dry leaf weight in a plant.
Verma, Ram Swaroop; Padalia, Rajendra Chandra; Chauhan, Amit
2012-02-01
Two Ocimum basilicum cultivars, 'Vikarsudha' and 'CIM-Saumya', grown in the Kumaon region of western Himalaya were evaluated for their essential oil yield and composition at different stages of plant growth during two distinct cropping seasons (spring-summer and rain-autumn). The highest yield of essential oil was obtained at full bloom stage in both cultivars in both cropping seasons. The essential oils obtained from different stages in two cropping seasons were analysed by capillary gas chromatography with flame ionisation detection, and gas chromatography-mass spectrometry. The major component of cultivar 'Vikarsudha' was methyl chavicol (84.3-94.3%), while for cultivar 'CIM-Saumya' the main components were methyl chavicol (62.5-77.6%) and linalool (14.4-34.1%). This study clearly indicated that cultivar, cropping season, plant ontogeny and plant part had significant effects on the yield and quality of the essential oil of O. basilicum. Further, the amount of methyl chavicol in the cultivars grown in this region was higher than in cultivars from other parts of India. Copyright © 2011 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
A.S. Alvarez
2013-01-01
Full Text Available O impacto provocado nas estruturas secretoras de folhas adultas de Ocimum gratissimum var. macrophyllum após extração dos componentes voláteis utilizando-se diferentes métodos de extração foi investigado através de microscopia eletrônica de varredura (MEV. Secções transversais do ápice, da nervura central, e da margem mostraram superfície com cutícula estriada, estômatos diacíticos, tricomas tectores simples, filiformes, e glandulares peltados. Os peltados, com estrutura envolta por uma cutícula contendo o exsudado celular, variaram de 60 a 80µm de diâmetro sendo formados por uma porção apical multicelular com disposição radial formada por dois círculos concêntricos com 9 a 16 células. Na região central do ápice do tricoma peltado se identificou a presença de 4 células em forma de vértice dispostas sobre o pedúnculo, sendo esta a região mais externa formada por número variável de células. Os componentes voláteis das folhas adultas foram extraídos por hidrodestilação (HD, destilação-extração simultânea (DES, e solvente (SO. Os dados obtidos evidenciaram que o maior impacto nas estruturas secretoras ocorreu após extração por hidrodestilação quando comparado aos outros métodos utilizados. A porcentagem dos principais constituintes químicos, timol e γ-terpineno variaram de acordo com o método de extração: timol (HD = 25,4%, SO = 18,2%, DES = 54,8% e γ-terpineno (HD = 38,2%, SO = ausente, DES = 13,7%.The impact on the secretory structures of mature leaves of Ocimum gratissimum var. macrophyllum, after extraction of the volatile compounds using different extraction methods, was investigated by scanning electron microscopy (SEM. Cross-sections of the apex, the midrib and the margin showed surface with striated cuticle, diacitic stomata, single tector, filiform and glandular peltate trichomes. The peltate trichomes with a structure surrounded by cuticle containing the celllular exudate ranged from
Upadhyay, Atul K; Chacko, Anita R; Gandhimathi, A; Ghosh, Pritha; Harini, K; Joseph, Agnel P; Joshi, Adwait G; Karpe, Snehal D; Kaushik, Swati; Kuravadi, Nagesh; Lingu, Chandana S; Mahita, J; Malarini, Ramya; Malhotra, Sony; Malini, Manoharan; Mathew, Oommen K; Mutt, Eshita; Naika, Mahantesha; Nitish, Sathyanarayanan; Pasha, Shaik Naseer; Raghavender, Upadhyayula S; Rajamani, Anantharamanan; Shilpa, S; Shingate, Prashant N; Singh, Heikham Russiachand; Sukhwal, Anshul; Sunitha, Margaret S; Sumathi, Manojkumar; Ramaswamy, S; Gowda, Malali; Sowdhamini, Ramanathan
2015-08-28
Krishna Tulsi, a member of Lamiaceae family, is a herb well known for its spiritual, religious and medicinal importance in India. The common name of this plant is 'Tulsi' (or 'Tulasi' or 'Thulasi') and is considered sacred by Hindus. We present the draft genome of Ocimum tenuiflurum L (subtype Krishna Tulsi) in this report. The paired-end and mate-pair sequence libraries were generated for the whole genome sequenced with the Illumina Hiseq 1000, resulting in an assembled genome of 374 Mb, with a genome coverage of 61 % (612 Mb estimated genome size). We have also studied transcriptomes (RNA-Seq) of two subtypes of O. tenuiflorum, Krishna and Rama Tulsi and report the relative expression of genes in both the varieties. The pathways leading to the production of medicinally-important specialized metabolites have been studied in detail, in relation to similar pathways in Arabidopsis thaliana and other plants. Expression levels of anthocyanin biosynthesis-related genes in leaf samples of Krishna Tulsi were observed to be relatively high, explaining the purple colouration of Krishna Tulsi leaves. The expression of six important genes identified from genome data were validated by performing q-RT-PCR in different tissues of five different species, which shows the high extent of urosolic acid-producing genes in young leaves of the Rama subtype. In addition, the presence of eugenol and ursolic acid, implied as potential drugs in the cure of many diseases including cancer was confirmed using mass spectrometry. The availability of the whole genome of O.tenuiflorum and our sequence analysis suggests that small amino acid changes at the functional sites of genes involved in metabolite synthesis pathways confer special medicinal properties to this herb.
Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal
2018-01-01
Sweet basil (Ocimum basilicum) is susceptible to downy mildew caused by the oomycete foliar pathogen Peronospora belbahrii. No resistant varieties of sweet basil are commercially available. Here, we report on the transfer of resistance gene Pb1 from the highly resistant tetraploid wild basil O. americanum var. americanum (PI 500945, 2n = 4x = 48) to the tetraploid susceptible O. basilicum 'Sweet basil' (2n = 4x = 48). F1 progeny plants derived from the interspecific hybridization PI 500945 × Sweet basil were resistant, indicating that the gene controlling resistance (Pb1) is dominant, but sterile due to the genetic distance between the parents. Despite their sterility, F1 plants were pollinated with the susceptible parent and 115 first backcross generation to the susceptible parent (BCs1) embryos were rescued in vitro. The emerging BCs1 plants segregated, upon inoculation, 5:1 resistant/susceptible, suggesting that resistance in F1 was controlled by a pair of dominant genes (Pb1A and Pb1A'). Thirty-one partially fertile BCs1 plants were self-pollinated to obtain BCs1-F2 or were backcrossed to Sweet basil to obtain the second backcross generation to the susceptible parent (BCs2). In total, 1 BCs1-F2 and 22 BCs2 progenies were obtained. The BCs1-F2 progeny segregated 35:1 resistant/susceptible, as expected from a tetraploid parent with two dominant resistant genes. The 22 BCs2 progenies segregated 1:1 resistant/susceptible (for a BCs1 parent that carried one dominant gene for resistance) or 5:1 (for a BCs1 parent that carried two dominant genes for resistance) at a ratio of 4:1. The data suggest that a pair of dominant genes (Pb1A and Pb1A') residing on a two homeologous chromosomes is responsible for resistance of PI 500945 against P. belbahrii.
Directory of Open Access Journals (Sweden)
Petrina Kapewangolo
2017-10-01
Full Text Available Latent HIV reservoirs in infected individuals prevent current treatment from eradicating infection. Treatment strategies against latency involve adjuvants for viral reactivation which exposes viral particles to antiretroviral drugs. In this study, the effect of novel triterpenoids isolated from Ocimum labiatum on HIV-1 expression was measured through HIV-1 p24 antigen capture in the U1 latency model of HIV-1 infection and in peripheral blood mononuclear cells (PBMCs of infected patients on combination antiretroviral therapy (cART. The mechanism of viral reactivation was determined through the compound’s effect on cytokine production, histone deacetylase (HDAC inhibition, and protein kinase C (PKC activation. Cytotoxicity of the triterpenoids was determined using a tetrazolium dye and flow cytometry. The isolated triterpene isomers, 3-hydroxy-4,6a,6b,11,12,14b-hexamethyl-1,2,3,4,6,6a,6b,7,8,8a,9,10,11,12,12a,14,14a,14b-octadecahydropicene-4,8a-dicarboxylic acid (HHODC, significantly (p < 0.05 induced HIV-1 expression in a dose-dependent manner in U1 cells at non-cytotoxic concentrations. HHODC also induced viral expression in PBMCs of HIV-1 infected patients on cART. In addition, the compound up-regulated the production of interleukin (IL-2, IL-6, tumour necrosis factor (TNF-α, and interferon (IFN-γ but had no effect on HDAC and PKC activity, suggesting cytokine upregulation as being involved in latency activation. The observed in vitro reactivation of HIV-1 introduces the adjuvant potential of HHODC for the first time here.
Directory of Open Access Journals (Sweden)
Alaleh Mottaghian
2016-03-01
Full Text Available To investigate the effect of organic fertilizer applications on yield and competition indices of basil (Ocimum basilicum L. in different combinations of intercropping with sesame (Sesamum indicum L., an experiment was carried out in split plot based on randomized complete block design with three replicates in 2011. The main plots were six fertilizer treatments consisted of 20 and 40 Mg ha-1 of vermicompost and sewage sludge plus 50% recommended chemical fertilizer, chemical fertilizer alone (100 kg ha-1 of urea, triple super phosphate and potassium sulfate and control (no fertilizer application. Subplots were different planting ratios (sole cropping of basil and sesame, 75% + 25%, 50% + 50 %, 25% + 75% of basil+sesame. In this experiment, the 25% basil+75% sesame and 50% basil + 50%sesame under40 Mg. ha-1 of enriched sewage sludge application had the highest economical yield (up to 3097.47 kg ha-1 with a land equivalent ratio (up to 1.24. According to the aggressivity coefficient estimates of two plant species basil incombination of 25% basil + 75% sesame and sesame in 50% basil + 50% sesame and 75% basil + 25% sesame under organic fertilizer application would be dominant species competitave in ranges of 0.12 to 0.30 and 0.11 to 0.57, respectively.
Cruz, G S; Wanderley-Teixeira, V; Oliveira, J V; Lopes, F S C; Barbosa, D R S; Breda, M O; Dutra, K A; Guedes, C A; Navarro, D M A F; Teixeira, A A C
2016-04-01
Spodoptera frugiperda (Smith 1797) (Lepidoptera: Noctuidae) is a major pest of maize, Zea mays L. Its control is often achieved through repeated applications per season of insecticides, which may lead to adverse effects on the ecosystem. Thus, the study of alternative methods with less environmental impact has expanded to include the use of essential oils. These oils are products of the secondary metabolism in plants, and their insecticidal activity has been widely demonstrated in populations of many pest insects. This study evaluated the insecticidal activities of essential oils from Eucalyptus staigeriana, Ocimum gratissimum, and Foeniculum vulgare on Spodoptera frugiperda. Gas chromatography–mass spectrometry profiles and contact toxicity of these oils as well as their sublethal effects on larvae and reproductive parameters in adults were evaluated. All three oils had sublethal effects on S. frugiperda; however, the oil of O. gratissimum showed the best results at all doses tested. These essential oils may have promise for control of S. frugiperda.
Effects of the exposure of TiO2 nanoparticles on basil (Ocimum basilicum) for two generations.
Tan, Wenjuan; Du, Wenchao; Darrouzet-Nardi, Anthony J; Hernandez-Viezcas, Jose A; Ye, Yuqing; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L
2018-09-15
There is a lack of information about the transgenerational effects of titanium dioxide nanoparticles (nano-TiO 2 ) in plants. This study aimed to evaluate the impacts of successive exposure of nano-TiO 2 with different surface properties to basil (Ocimum basilicum). Seeds from plants exposed or re-exposed to pristine, hydrophobic, or hydrophilic nano-TiO 2 were cultivated for 65 days in soil unamended or amended with 750 mg·kg -1 of the respective particles. Plant growth, concentration of titanium and essential elements, as well as content of carbohydrates and chlorophyll were evaluated. There were no differences on Ti concentration in roots of plants sequentially exposed to pristine or hydrophobic nano-TiO 2 , or in roots of plants exposed to the corresponding particle, only in the second cycle. However, sequential exposure to hydrophilic particles resulted in 65.2% less Ti in roots, compared to roots of plants exposed the same particles, only in the second cycle. The Ti concentrations in shoots were similar in all treatments. On the other hand, pristine and hydrophilic particles reduced Mg in root by 115% and 81%, respectively, while pristine and hydrophobic particles reduced Ni in shoot by 84% and 75%, respectively, compared to unexposed plants in both cycles. Sequential exposure to pristine nano-TiO 2 increased stomatal conductance (214%, p ≤ 0.10), compared to plants that were never exposed. Hydrophobic and hydrophilic nano-TiO 2 reduced chlorophyll b (52%) and total chlorophyll (30%) but increased total sugar (186%) and reducing sugar (145%), compared to unexposed plants in both cycles. Sequential exposure to hydrophobic or hydrophilic nano-TiO 2 resulted in more adverse effects on photosynthesis but in positive effects on plant growth, compared to pristine nano-TiO 2 . Copyright © 2018 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
A. S. IVANITSKIKH
2014-07-01
Full Text Available In plants grown with artificial lighting, variations in light spectral composition can be used for the directed biosynthesis of the target substances including essential oils, e.g. in plant factories. We studied the effect of light spectral quality on the essential oil composition in Ocimum basilicum and Salvia officinalis plants grown in controlled environment. The variable-spectrum light modules were designed using three types of high-power light-emitting diodes (LEDs with emission peaked in red, blue and red light, white LEDs, and high-pressure sodium lamps as reference. Qualitative and quantitative essential oil determinations were conducted using gas chromatography with mass selective detection and internal standard method.Sweet basil plant leaves contain essential oils (са. 1 % including linalool, pinene, eugenol, camphor, cineole, and other components. And within the genetic diversity of the species, several cultivar groups can be identified according to the flavor (aroma perceived by humans: eugenol, clove, camphor, vanilla basil. Essential oil components produce particular flavor of the basil leaves. In our studies, we are using two sweet basil varieties differing in the essential oil qualitative composition – “Johnsons Dwarf” (camphor as a major component of essential oils and “Johnsons Lemon Flavor” (contains large amount of citral defining its lemon flavor.In sage, essential oil composition is also very variable. As for the plant responses to the light environment, the highest amount of the essential oils was observed at the regimes with white and red + blue LED light. And it was three times less with red light LEDs alone. In the first two environments, thujone accumulation was higher in comparison with camphor, while red LED light and sodium lamp light favored camphor biosynthesis (three times more than thujone. The highest amount of eucalyptol was determined in plants grown with red LEDs.
Bernhardt, Botond; Bernáth, Jenő; Gere, Attila; Kókai, Zoltán; Komáromi, Bonifác; Tavaszi-Sárosi, Szilvia; Varga, László; Sipos, László; Szabó, Krisztina
2015-10-01
According to the earlier literature the optimum harvest time for basil is at the full flowering stage if accumulation of essential oil is taken into account. In this research we have investigated our gene-bank stored basil accessions to determine whether the harvest timing is variety specific or not considering their flavonoid accumulation pattern. In our work we have determined by HPLC the content of two main flavonoid compounds, salvigenin and nevadensin, of eight different gene bank accessions from 2013 of Ocimum basilicum L. Data were analysed with the nonparametric Kruskal-Wallis test. Multiple pairwise comparisons were made using the Conover-Iman procedure where the significance level was 5%. We have observed that the optimum harvest time is at the full flowering stage in the case of accessions 'Genovese' and 'Piros', but this was not verified for the others. The result of our experiment has shown that the maximum salvigenin and nevadensin content was detected both at the full- and early flowering period. Almost in all phenological phases the accession 'M. Grünes' accumulated the highest level of nevadensin, while accession 'Lengyel' produced the lowest results in all phenological phases. Generally it could be observed that compared with nevadensin more salvigenin is accumulated, and it is independent of the phenological phases. In the case of salvigenin, 'M. Grünes' accession produced the largest quantity and accession 'Dark Opal' showed the lowest values. Our analyses demonstrated that harvest at different phenological phases may result in different amounts of active agents according to the cultivar.
Chenni, Mohammed; El Abed, Douniazad; Rakotomanomana, Njara; Fernandez, Xavier; Chemat, Farid
2016-01-19
Solvent-free microwave extraction (SFME) and conventional hydro-distillation (HD) were used for the extraction of essential oils (EOs) from Egyptian sweet basil (Ocimum basilicum L.) leaves. The two resulting EOs were compared with regards to their chemical composition, antioxidant, and antimicrobial activities. The EO analyzed by GC and GC-MS, presented 65 compounds constituting 99.3% and 99.0% of the total oils obtained by SFME and HD, respectively. The main components of both oils were linalool (43.5% SFME; 48.4% HD), followed by methyl chavicol (13.3% SFME; 14.3% HD) and 1,8-cineole (6.8% SFME; 7.3% HD). Their antioxidant activity were studied with the 2,2-diphenyl-1-picrylhydrazyl (DPPH(•)) radical scavenging method. The heating conditions effect was evaluated by the determination of the Total Polar Materials (TPM) content. The antimicrobial activity was investigated against five microorganisms: two Gram-positive bacteria, Staphylococcus aureus and Bacillus subtilis, two Gram-negative bacteria, Escherichia coli and Pseudomonas aeruginosa, and one yeast, Candida albicans. Both EOs showed high antimicrobial, but weak antioxidant, activities. The results indicated that the SFME method may be a better alternative for the extraction of EO from O. basilicum since it could be considered as providing a richer source of natural antioxidants, as well as strong antimicrobial agents for food preservation.
Directory of Open Access Journals (Sweden)
Stanley I. R. Okoduwa
2017-10-01
Full Text Available Background: Ocimum gratissimum (OG is used in the traditional management of diabetes in Nigeria. This study investigated the anti-diabetic potential of OG leaf fractions (OGLF in a rat model of Type-2 diabetes (T2D. Method: Methanol crude extract of OG leaf was fractionated with solvents of increasing order of polarity (n-hexane, chloroform, ethyl-acetate, n-butanol and water. The anti-diabetic potential of the fractions was evaluated in vivo. T2D was induced in Albino Wistar rats and treated with OGLF. Result: The T2D rats showed significant elevation in serum levels of fasting blood glucose (FBG, liver and kidney function biomarkers. At 4-weeks of intervention with OGLF, the untreated diabetic control group maintained severe hyperglycaemia in the presence of 61.7% serum insulin, 17.3% pancreatic β-cell function (HOMA-β and 51.5% Insulin sensitivity. The glucose tolerance ability was enhanced in the n-butanol-fraction (OGb treated group. With 74.8% available serum insulin and 38.6% improvement in insulin sensitivity, the OGb treated group had a 63.5% reduction in FBG and it was found to be most effective as it ameliorates a majority of the changes caused in the studied parameters in diabetic rats. Conclusions: The data from this study suggest that OGb fraction is a potential candidate for the development of an effective drug for the management of T2D.
Fratianni, Florinda; Cefola, Maria; Pace, Bernardo; Cozzolino, Rosaria; De Giulio, Beatrice; Cozzolino, Autilia; d'Acierno, Antonio; Coppola, Raffaele; Logrieco, Antonio Francesco; Nazzaro, Filomena
2017-08-15
Leaves of three different sweet basil (Ocimum basilicum L.) cultivars (Italico a foglia larga, Cammeo, and Italiano classico) packed in macro-perforated polyethylene bags were stored at chilling (4°C) or non-chilling temperature (12°C) for 9days. During storage, visual quality, physiological (respiration rate, ethylene production, ammonium content) and chemical (antioxidant activity, total polyphenols and polyphenol profile) parameters were measured. Detached leaves stored at chilling temperature showed visual symptoms related to chilling injury, while ethylene production and ammonium content resulted associated to cultivar sensibility to damage at low temperature. Storage at 4°C caused a depletion in polyphenols content and antioxidant capability, which was preserved at 12°C. Regarding the polyphenols profile, stressful storage conditions did not enhance the phenolic metabolism. However, leaves stored at 12°C did not loss a significant amount of metabolites respect to fresh leaves, suggesting the possibility to extend the storability after the expiration date, for a possible recovery of bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.
Amadei, Gianluca; Ross, Brian M
2012-02-15
Basil (Ocimum basilicum) is an important flavourant plant which constitutes the major ingredient of the pasta sauce 'Pesto alla Genovese'. The characteristic smell of basil stems mainly from a handful of terpenoids (methyl cinnamate, eucalyptol, linalool and estragole), the concentration of which varies according to basil cultivars. The simple and rapid analysis of the terpenoid constituents of basil would be useful as a means to optimise harvesting times and to act as a quality control process for basil-containing foodstuffs. Classical analytical techniques such as gas chromatography/mass spectrometry (GC/MS) are, however, slow, technically demanding and therefore less suitable for routine analysis. A new chemical ionisation technique which allows real-time quantification of traces gases, Selected Ion Flow Tube Mass Spectrometry (SIFT-MS), was therefore utilised to determine its usefulness for the assay of terpenoid concentrations in basil and pesto sauce headspace. Trace gas analysis was performed using the NO(+) precursor ion which minimised interference from other compounds. Character-impacting compound concentration was measured in basil headspace with good reproducibility and statistically significant differences were observed between cultivars. Quantification of linalool in pesto sauce headspace proved more difficult due to the presence of interfering compounds. This was resolved by careful selection of reaction product ions which allowed us to detect differences between various commercial brands of pesto. We conclude that SIFT-MS may be a valid tool for the fast and reproducible analysis of flavourant terpenoids in basil and basil-derived foodstuffs. Copyright © 2011 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Naveen Kumar eKalagatur
2015-09-01
Full Text Available The present study was aimed to establish the antagonistic effects of Ocimum sanctum L. essential oil (OSEO on growth and zearalenone (ZEA production of Fusarium graminearum. GC-MS chemical profiling of OSEO revealed the existence of 43 compounds and the major compound was found to be eugenol (34.7%. DPPH free radical scavenging activity (IC50 of OSEO was determined to be 8.5µg/mL. Minimum inhibitory concentration (MIC and minimum fungicidal concentration (MFC of OSEO on F. graminearum were recorded as 1250 µg/mL and 1800 µg/mL, respectively. Scanning electron microscope observations showed significant micro morphological damage in OSEO exposed mycelia and spores compared to untreated control culture. Quantitative UHPLC studies revealed that OSEO negatively effected the production of ZEA; the concentration of toxin production was observed to be insignificant at 1500 µg/mL concentration of OSEO. On other hand ZEA concentration was quantified as 3.23 µg/mL in OSEO untreated control culture. Reverse transcriptase qPCR analysis of ZEA metabolic pathway genes (PKS4 and PKS13 revealed that increase in OSEO concentration (250 µg/mL to 1500 µg/mL significantly downregulated the expression of PKS4 and PKS13. These results were in agreement with the artificially contaminated maize grains as well. In conlusion, the antifungal and antimycotoxic effects of OSEO on F. graminearum in the present study reiterated that, the essential oil of O. sanctum could be a promising herbal fungicide in food processing industries as well as grain storage centers.
Mohanty, Ipseeta; Arya, Dharamvir Singh; Gupta, Suresh Kumar
2006-01-01
Background In the present investigation, the effect of Curcuma longa (Cl) and Ocimum sanctum (Os) on myocardial apoptosis and cardiac function was studied in an ischemia and reperfusion (I-R) model of myocardial injury. Methods Wistar albino rats were divided into four groups and orally fed saline once daily (sham, control IR) or Cl (100 mg/kg; Cl-IR) or Os (75 mg/kg; Os-IR) respectively for 1 month. On the 31st day, in the rats of the control IR, Cl-IR and Os-IR groups LAD occlusion was undertaken for 45 min, and reperfusion was allowed for 1 h. The hemodynamic parameters{mean arterial pressure (MAP), heart rate (HR), left ventricular end-diastolic pressure (LVEDP), left ventricular peak positive (+) LVdP/dt (rate of pressure development) and negative (-) LVdP/dt (rate of pressure decline)} were monitored at pre-set points throughout the experimental duration and subsequently, the animals were sacrificed for immunohistopathological (Bax, Bcl-2 protein expression & TUNEL positivity) and histopathological studies. Results Chronic treatment with Cl significantly reduced TUNEL positivity (p < 0.05), Bax protein (p < 0.001) and upregulated Bcl-2 (p < 0.001) expression in comparison to control IR group. In addition, Cl demonstrated mitigating effects on several myocardial injury induced hemodynamic {(+)LVdP/dt, (-) LVdP/dt & LVEDP} and histopathological perturbations. Chronic Os treatment resulted in modest modulation of the hemodynamic alterations (MAP, LVEDP) but failed to demonstrate any significant antiapoptotic effects and prevent the histopathological alterations as compared to control IR group. Conclusion In the present study, significant cardioprotection and functional recovery demonstrated by Cl may be attributed to its anti-apoptotic property. In contrast to Os, Cl may attenuate cell death due to apoptosis and prevent the impairment of cardiac performance. PMID:16504000
The X-ray view of the ionization cone in NGC 5252
Matteo Guainazzi; Stefano Bianchi; Massimo Cappi; Mauro Dadina; Giuseppe Malaguti
2008-01-01
Presentamos los resultados de las observaciones realizadas con Chandra en rayos-X suaves del espectacular cono de ionización de la galaxia cercana Seyfert-2 NGC5252. Como se observa invariablemente en los AGN oscurecidos, la emisión de rayos-X suaves exhibe una marcada coincidencia en morfología con el cono de gas ionizado trazado por el HST en las imágenes de O[III]. Imágenes resueltas en energía y espectroscopía de alta resolución sugieren que el gas emitido en rayos-X es fotoio...
International Nuclear Information System (INIS)
Malliga, P.; Selvi, B. Karunai; Pandiarajan, J.; Prithivikumaran, N.; Neyvasagam, K.
2015-01-01
Thin films of TiO 2 were prepared on glass substrates using sol-gel dip coating technique. The films with 10 coatings were prepared and annealed at temperatures 350°C, 450°C and 550°C for 1 hour in muffle furnace. The annealed films were characterized by X – Ray diffraction (XRD), UV – Visible, AFM, Field Effect Scanning Electron Microscopy (FESEM) and EDAX studies. Chlorophyll has many health benefits due to its structural similarity to human blood and its good chelating ability. It has antimutagenic and anticarcinogenic properties. UV light impairs photosynthesis and reduces size, productivity, and quality in many of the crop plant species. Increased exposure of UV light reduces chlorophyll contents a, b and total content in plants. Titanium Dioxide (TiO 2 ) is a wide band gap semiconductor and efficient light harvester. TiO 2 has strong UltraViolet (UV) light absorbing capability. Here, we have studied the performance of TiO 2 thin films as a protective layer to the chlorophyll contents present in medicinal plant, tulsi (Ocimum tenuiflorum L) from UV radiation. The study reveals that crystallite size increases, transmittance decreases and chlorophyll contents increases with increase in annealing temperature. This study showed that TiO 2 thin films are good absorber of UV light and protect the chlorophyll contents a, b and total content in medicinal plants
Cardoso, Nathalia N. R.; Alviano, Celuta S.; Blank, Arie F.; Romanos, Maria Teresa V.; Fonseca, Beatriz B.; Rozental, Sonia; Rodrigues, Igor A.; Alviano, Daniela S.
2016-01-01
The aim of this study was to evaluate the activity of the EO and its major components of Ocimum basilicum var. Maria Bonita, a genetically improved cultivar, against the fluconazole sensitive and resistant strains of Candida albicans and Cryptococcus neoformans. Geraniol presented better results than the EO, with a low MIC (76 μg/mL against C. neoformans and 152 μg/mL against both Candida strains). The combination of EO, linalool, or geraniol with fluconazole enhanced their antifungal activity, especially against the resistant strain (MIC reduced to 156, 197, and 38 μg/mL, resp.). The ergosterol assay showed that subinhibitory concentrations of the substances were able to reduce the amount of sterol extracted. The substances tested were able to reduce the capsule size which suggests they have an important mechanism of action. Transmission electron microscopy demonstrated cell wall destruction of C. neoformans after treatment with subinhibitory concentrations. In C. albicans ultrastructure alterations such as irregularities in the membrane, presence of vesicles, and cell wall thickening were observed. The biofilm formation was inhibited in both C. albicans strains at MIC and twice MIC. These results provide further support for the use of O. basilicum EO and its major components as a potential source of antifungal agents. PMID:27274752
Tan, Wenjuan; Du, Wenchao; Barrios, Ana C; Armendariz, Raul; Zuverza-Mena, Nubia; Ji, Zhaoxia; Chang, Chong Hyun; Zink, Jeffrey I; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L
2017-03-01
Little is known about the effects of surface coating on the interaction of engineered nanoparticles (ENPs) with plants. In this study, basil (Ocimum basilicum) was cultivated for 65 days in soil amended with unmodified, hydrophobic (coated with aluminum oxide and dimethicone), and hydrophilic (coated with aluminum oxide and glycerol) titanium dioxide nanoparticles (nano-TiO 2 ) at 125, 250, 500, and 750 mg nano-TiO 2 kg -1 soil. ICP-OES/MS, SPAD meter, and UV/Vis spectrometry were used to determine Ti and essential elements in tissues, relative chlorophyll content, carbohydrates, and antioxidant response, respectively. Compared with control, hydrophobic and hydrophilic nano-TiO 2 significantly reduced seed germination by 41% and 59%, respectively, while unmodified and hydrophobic nano-TiO 2 significantly decreased shoot biomass by 31% and 37%, respectively (p ≤ 0.05). Roots exposed to hydrophobic particles at 750 mg kg -1 had 87% and 40% more Ti than the pristine and hydrophilic nano-TiO 2 ; however, no differences were found in shoots. The three types of particles affected the homeostasis of essential elements: at 500 mg kg - 1 , unmodified particles increased Cu (104%) and Fe (90%); hydrophilic increased Fe (90%); while hydrophobic increased Mn (339%) but reduced Ca (71%), Cu (58%), and P (40%). However, only hydrophobic particles significantly reduced root elongation by 53%. Unmodified, hydrophobic, and hydrophilic particles significantly reduced total sugar by 39%, 38%, and 66%, respectively, compared with control. Moreover, unmodified particles significantly decreased reducing sugar (34%), while hydrophobic particles significantly reduced starch (35%). Although the three particles affected basil plants, coated particles impacted the most its nutritional quality, since they altered more essential elements, starch, and reducing sugars. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Harshad O Malve
2014-01-01
Full Text Available Background: There has been a steady rise in number of patients suffering from dementia including dementia associated with Alzheimer′s disease. Effective treatment of Alzheimer′s disease dementia is an unmet medical need. Objective: To evaluate effects of formulation containing combination of Phyllanthus emblica (Pe and Tinospora cordifolia (Tc with and without Ocimum sanctum (Os on learning and memory performance of normal and memory impaired rats in complex maze and compare with effects of Tinospora cordifolia and Phyllanthus emblica alone. Materials and Methods: Wistar rats; either sex (100-150 g were divided in seven groups Control, Piracetam, Rivastigmine, Tc, Pe, Formulation 1 (Tc + Pe, and Formulation 2 (Tc + Pe + Os.The study was divided in four parts: In part 1 memory enhancement was tested in normal rats. In part 2, 3, and 4 the effects of drugs were tested in Scopolamine-, Diazepam-, and Cyclosporine-induced amnesia. Hebb-Williams maze was used to test for learning and memory. Time required to trace food and number of errors in maze were noted. Results: In normal rats, all test drugs showed significant reduction in time required to trace the food and number of errors after 24 h compared with vehicle control. Formulations 1 and 2 reduced the time required to trace food and number of errors and the results were comparable with positive control groups and comparators Tc and Pe. Formulations 1 and 2 reversed amnesia produced by Scopolamine, Diazepam, and Cyclosporine when compared with vehicle control and showed comparable results with those of positive control groups and comparators Tc and Pe. Conclusion: Formulations 1 and 2 demonstrated nootropic activity and both the formulations showed comparable nootropic activity with that of Tc and Pe alone.
Warsi; Sholichah, A. R.
2017-11-01
Basil leaf (Ocimum basilicum L.) contains various compounds such as flavonoid, alkaloid, phenol and essential oil, so it needs to be fractionated to find out the flavonoid compound with the greatest potential as an antioxidant. This research was aimed to know the chemical compound, antioxidant potential of ethanolic extract and ethyl acetate fraction from basil leaf. The basil leaf was extracted by maceration using ethanol 70 %. The crude extract was fractionated with ethyl acetate. The ethanolic extract and ethyl acetate fraction were screened of phytochemical content including identification of flavonoids, alkaloids and polyphenolics. The antioxidant activity of the ethanolic extract and ethyl acetate fraction were tested qualitatively with 2,2-diphenyl-1-picrylhydrazyl (DPPH) and phosphomolybdate. Its antioxidant activity was determined quantitatively using DPPH radical scavenging method. Phytochemical screening test showed that ethanolic extract and ethyl acetate fraction from basil leaf contain flavonoids, polyphenolics, and alkaloids. The qualitative analysis of antioxidant activity of ethanolic extract and ethyl acetate fraction from basil leaf showed an antioxidant activity. The IC50 value of ethanolic extract, ethyl acetate fraction and quercetin were 1,374.00±6.20 389.00±1.00 2.10±0.01μg/mL, respectively. The research showed that antioxidant activity of the ethyl acetate fraction more potential than the ethanol extract of the basil leaf, but less than quercetin.
Joshi, Rajesh K
2014-01-01
Ocimum basilicum L. (Lamiaceae) commonly known as sweet basil, has been used as a traditional medicinal plant for the treatment of headaches, coughs, diarrhea, constipation, warts, worms, and kidney malfunctions. The essential oil of the flowering aerial parts of O. basilicum growing in the Western Ghats region of North West Karnataka, India, was obtained by hydro-distillation and analyzed by gas chromatography equipped with flame ionization detector and gas chromatography coupled to mass spectrometry (GC-MS). The oil was tested against six Gram-positive, eight Gram-negative bacteria, and three fungi by the tube-dilution method at a concentration range of 5.00-0.009 mg/mL. Twenty-five constituents were identified in the essential oil of O. basilicum. The major constituents were identified as methyl eugenol (39.3%) and methyl chavicol (38.3%), accounting for 98.6% of the total oil. The oil was found to be active against Gram-positive, Gram-negative bacteria, and fungi with minimal bactericidal concentration values in the range of 0.143 ± 0.031 to 0.572 ± 0.127 mg/mL, 0.781 ± 0.382 to 1.875 ± 0.684 mg/mL, and 0.312 ± 0.171 to 0.442 ± 0.207 mg/mL, respectively. The essential oil of O. basilicum of this region contains methyl eugenol/methyl chavicol chemotype and has bactericidal properties.
Comparative Evaluation of the Nutrients and Phytochemical ...
African Journals Online (AJOL)
Materials and Methods: The leaves (Ocimum gratissmium and Lasianthera africana) were randomly obtained from Umuahia Main Market and Uyo Central Market, respectively. ... Keywords: Phytochemicals, Ocimum gratissmium, Lasianthera africana proximate composition, mineral composition, Beta-carotene, Vitamin C ...
Geología y aspectos geográficos de la isla de san andrés, colombia
Vargas Cuervo, German
2012-01-01
La Isla de San Andrés ha sido definida geológicamente por varios autores en dos unidades calcáreas de características bien marcadas: Una unidad de calizas heterogéneas,denominada como Formación San Andrés de edad Mioceno y una unidad de calizas coralinas de edad Pleistoceno, conocida como Formación San Luis. La primera unidad aflora en la parte central de la isla y representa la zona de colinas suaves con alturas máximas de 87 m.s.n.m y la Formación San Luis constituye la región plana a suave...
Romeu, Marco Antônio Rígola
2000-01-01
Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. A inclusão de ilhas em modelos numéricos de propagação de onda baseados na aproximação parabólica da Equação de Declive Suave é um assunto de grande importância para a costa brasileira. Normalmente as ilhas são representadas por uma fina película de água que implica na arrebentação das ondas. Porém, ilhas com declives laterais íngremes violam a hipóteses do Declive Suave provocando o aparecimento de ruído...
Avoidance behavior to essential oils by Anopheles minimus, a malaria vector in Thailand
Excito-repellency tests were used to characterize behavioral responses of laboratory colonized Anopheles minimus, a malaria vector in Thailand, using four essential oils, citronella (Cymbopogom nadus), hairy basil (Ocimum americanum), sweet basil (Ocimum basilicum), vetiver (Vetiveria zizanioides), ...
Directory of Open Access Journals (Sweden)
Rilvaynia Dantas Soares
2007-08-01
Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were
African Journals Online (AJOL)
DR ASSUMING-BREMPONG
castaneum is worldwide stored product pest ... oil, roots, etc. ... these with similar properties are the Ocimum gratissum (basil), and Ocimum sanctum (holy basil). It is used as an insect repellent during storage. It also works as a mosquito ...
Venâncio, Antônio Medeiros; Onofre, Alexandre Sherlley; Lira, Amintas Figueiredo; Alves, Péricles Barreto; Blank, Arie Fitzgerald; Antoniolli, Angelo Roberto; Marchioro, Murilo; Estevam, Charles dos Santos; de Araujo, Brancilene Santos
2011-05-01
Ocimum basilicum L. is an aromatic herb used in Brazil to treat illnesses such as respiratory and rheumatic problems, vomiting, and pain. In the present study, the chemical composition, acute toxicity, and antinociceptive effects of the essential oil (EO) of the cultivar "Maria Bonita" obtained from O. basilicum L. PI 197442 genotype were evaluated in Swiss mice (20-35 g each). Lethal dose to cause 50 % death (LD50) was calculated from a dose-response curve (100-5000 mg/kg body wt.; n = 6) as 532 mg/kg body wt. In the acetic acid-induced writhing test (0.6 % i. p.), EO (50, 100, and 200 mg/kg body wt., n = 8, s. c.) was effective in reducing the abdominal contractions at all doses (48-78 %). In the hot-plate test, EO significantly increased the latency at 50 mg/kg body wt. at all times (37-52 %, n = 8, s. c.). However, the effects of morphine and EO at 50 mg/kg were reverted in the presence of naloxone, an opioid antagonist. In the formalin test, EO significantly reduced paw licking time in the first and second phases of pain at 200 mg/kg body wt. (38 and 75 %, respectively, n = 8, s. c.). The results suggested that the peripheral and central antinociceptive effects of EO are related to the inhibition of the biosynthesis of pain mediators, such as prostaglandins and prostacyclins, and its ability to interact with opioid receptors. © Georg Thieme Verlag KG Stuttgart · New York.
Lewinsohn, E; Ziv-Raz, I; Dudai, N; Tadmor, Y; Lastochkin, E; Larkov, O; Chaimovitsh, D; Ravid, U; Putievsky, E; Pichersky, E; Shoham, Y
2000-12-07
Sweet basil (Ocimum basilicum L., Lamiaceae) is a common herb, used for culinary and medicinal purposes. The essential oils of different sweet basil chemotypes contain various proportions of the allyl phenol derivatives estragole (methyl chavicol), eugenol, and methyl eugenol, as well as the monoterpene alcohol linalool. To monitor the developmental regulation of estragole biosynthesis in sweet basil, an enzymatic assay for S-adenosyl-L-methionine (SAM):chavicol O-methyltransferase activity was developed. Young leaves display high levels of chavicol O-methyltransferase activity, but the activity was negligible in older leaves, indicating that the O-methylation of chavicol primarily occurs early during leaf development. The O-methyltransferase activities detected in different sweet basil genotypes differed in their substrate specificities towards the methyl acceptor substrate. In the high-estragole-containing chemotype R3, the O-methyltransferase activity was highly specific for chavicol, while eugenol was virtually not O-methylated. In contrast, chemotype 147/97, that contains equal levels of estragole and methyl eugenol, displayed O-methyltransferase activities that accepted both chavicol and eugenol as substrates, generating estragole and methyl eugenol, respectively. Chemotype SW that contains high levels of eugenol, but lacks both estragole and methyl eugenol, had apparently no allylphenol dependent O-methyltransferase activities. These results indicate the presence of at least two types of allylphenol-specific O-methyltransferase activities in sweet basil chemotypes, one highly specific for chavicol; and a different one that can accept eugenol as a substrate. The relative availability and substrate specificities of these O-methyltransferase activities biochemically rationalizes the variation in the composition of the essential oils of these chemotypes.
Kathirvel, Poonkodi; Ravi, Subban
2012-01-01
This study examines the chemical composition and in vitro anticancer activity of the essential oil from Ocimum basilicum Linn. (Lamiaceae), cultivated in the Western Ghats of South India. The chemical compositions of basil fresh leaves were identified by GC-MS: 11 components were identified. The major constituents were found to be methyl cinnamate (70.1%), linalool (17.5%), β-elemene (2.6%) and camphor (1.52%). The results revealed that this plant may belong to the methyl cinnamate and linalool chemotype. A methyl thiazol tetrazolium assay was used for in vitro cytotoxicity screening against the human cervical cancer cell line (HeLa), human laryngeal epithelial carcinoma cell line (HEp-2) and NIH 3T3 mouse embryonic fibroblasts. The IC(50) values obtained were 90.5 and 96.3 µg mL(-1), respectively, and the results revealed that basil oil has potent cytotoxicity.
Martinez-Velazquez, Moises; Castillo-Herrera, Gustavo Adolfo; Rosario-Cruz, Rodrigo; Flores-Fernandez, Jose Miguel; Lopez-Ramirez, Julisa; Hernandez-Gutierrez, Rodolfo; Lugo-Cervantes, Eugenia del Carmen
2011-02-01
Acaricidal activity of essential oils extracted from cumin seeds (Cuminum cyminum), allspice berries (Pimenta dioica) and basil leaves (Ocimum basilicum) were tested on 10-day-old Rhipicephalus (Boophilus) microplus tick larvae using the LPT. Two-fold dilutions of the three essential oils were tested from a starting dilution of 20% down to 1.25%. Results showed a high toxicological effect for cumin, producing 100% mortality in all tested concentrations on R. microplus larvae. Similarly, allspice essential oil produced 100% mortality at all concentrations with the exception of a dramatic decrease at 1.25% concentration. Conversely, basil essential oil was not shown to be toxic against R. microplus larvae. The most common compounds detected by gas chromatography-mass spectrometry were as follows: cumin: cuminaldehyde (22.03%), γ-terpinene (15.69%) and 2-caren-10-al (12.89%); allspice: methyl eugenol (62.7%) and eugenol (8.3%); basil: linalool (30.61%) and estragole (20.04%). Results clearly indicate that C. cyminum and P. dioica essential oils can be used as an effective alternative for R. microplus tick control, and there is a high probability they can be used for other ticks affecting cattle in Mexico and throughout the world, thereby reducing the necessity for traditional and unfriendly synthetic acaricides.
Directory of Open Access Journals (Sweden)
Shilpi Bansal
2017-10-01
Full Text Available Secondary metabolites, the biological compounds secreted by plants as an aid to support their growth and development under stress conditions or as a part of their defense mechanism, now hold equal importance for mankind who employs it immensely for medication, flavorings, aroma, etc. Wide applicability of these compounds instigates one to understand the biosynthesis, structure and regulation of these bioactive molecules. Terpenoids form the largest group of secondary metabolites which comprise of a wide range of structurally and functionally distinct metabolites synthesized either via mevalonate pathway or non-mevalonate pathway. Targeting a key regulatory enzyme of this pathway, modulation of which would alter the carbon flux would be beneficial to enhance our knowledge about the above issue. For this the transcriptome (from SRA of different Ocimum species was mined out for important pathway genes using various bioinformatics approaches. Amongst them 3-hydoxy 3-methyl glutaryl CoA reductase (HMGR was selected which is the rate limiting enzyme in mevalonate pathway which controls the conversion of HMG-CoA to mevalonic acid. Isolation, cloning, protein expression, purification, etc. would be discussed in detail in the meeting. Full length protein was also characterized through bioinformatics tools to study its structure, properties, conserved domains, etc. Increase in secondary metabolite production by alteration of HMGR pool along with transcript modulation studies in planta revealed that HMGR gene governs the biosynthesis of secondary metabolites. Transcriptome mapping of different HMGR homologs which on comparison within member of same genus revealed its divergent nature which could account to its multifunctional role in different plants. Besides, providing a deep insight about the enzyme function combination of such molecular, transgenic and bioinformatics tools would help to develop strategies to engineer the HMGR mediated flux and also
Directory of Open Access Journals (Sweden)
Alexandre José Cichoski
2011-06-01
Full Text Available Different concentrations of basil essential oil (Ocimum basilicum L. (0.19; 0.38; 0.75; 1.87; 3.75 and 6.00 mg.g-1 were evaluated in relation to their antioxidant activity using the DPPH● radical methodology. From the IC50 obtained data, the concentrations of 0.19; 0.38; 0.75; 1.87; 3.75; 6.00 and 12.00 mg.mL-1 were applied directly to the product and these were sensorially evaluated by the test of control difference. The concentrations related to the highest acceptability (0.19; 0.38 and 0.75 mg.g-1 were tested for antioxidant activity in the internal part of Italian type salami - during the processing and after 30 days of storage, in terms of lipid and protein oxidation. The oxidation of lipids was determined using the method of TBARS. The method of carbonyl compounds was employed for proteins oxidation. Five different formulations of salami were elaborated: blank (without the use of antioxidant; control (using sodium eritorbate as antioxidant; and adding 0.19; 0.38 and 0.75 mg.g-1 of basil essential oil. The product was kept between 25 ºC and 18 ºC and UR between 95% and 70%, for 28 days. Analyses were carried out on the processing day and after 2, 7, 14, 21 and 28 days, and also following 30 days of storage. The basil essential oil in vitro presented an antioxidant activity of IC50 12 mg.mL-1. In the internal part of the Italian type salami the commercial antioxidant (control and the formulation containing 0.75 mg.g-1 of basil essential oil presented antioxidant activity in relation to the lipids, but not to the proteins - during processing and storage.
Energy Technology Data Exchange (ETDEWEB)
Malliga, P. [Department of Physics, V.V.Vanniaperumal College for Women, Virudhunagar – 626001 (India); Selvi, B. Karunai [Department of Botany, V.V.Vanniaperumal College for Women, Virudhunagar – 626001 (India); Pandiarajan, J.; Prithivikumaran, N. [Nanoscience Lab, Department of Physics, VHNSN College, Virudhunagar – 626001 (India); Neyvasagam, K., E-mail: srineyvas@yahoo.co.in [Department of Physics, The Madura College, Madurai - 625011 (India)
2015-06-24
Thin films of TiO{sub 2} were prepared on glass substrates using sol-gel dip coating technique. The films with 10 coatings were prepared and annealed at temperatures 350°C, 450°C and 550°C for 1 hour in muffle furnace. The annealed films were characterized by X – Ray diffraction (XRD), UV – Visible, AFM, Field Effect Scanning Electron Microscopy (FESEM) and EDAX studies. Chlorophyll has many health benefits due to its structural similarity to human blood and its good chelating ability. It has antimutagenic and anticarcinogenic properties. UV light impairs photosynthesis and reduces size, productivity, and quality in many of the crop plant species. Increased exposure of UV light reduces chlorophyll contents a, b and total content in plants. Titanium Dioxide (TiO{sub 2}) is a wide band gap semiconductor and efficient light harvester. TiO{sub 2} has strong UltraViolet (UV) light absorbing capability. Here, we have studied the performance of TiO{sub 2} thin films as a protective layer to the chlorophyll contents present in medicinal plant, tulsi (Ocimum tenuiflorum L) from UV radiation. The study reveals that crystallite size increases, transmittance decreases and chlorophyll contents increases with increase in annealing temperature. This study showed that TiO{sub 2} thin films are good absorber of UV light and protect the chlorophyll contents a, b and total content in medicinal plants.
El-Beshbishy, Ha; Bahashwan, Sa
2012-02-01
The present study investigated the in vitro hypoglycemic activity of basil (Ocimum basilicum) aqueous extract. Preliminary phytochemical screening of the extract revealed the presence of reducing sugars, cardiac glycosides, tannins, saponins, glycosides, flavonoids and steroids. The total polyphenols content (TPC), flavonoids content (FC), percentage diphenylpicrylhydrazyl (DPPH( · )) radical inhibition and total antioxidant status (TAS) were estimated. The FC was 41 ± 2.2 rutin/g dry extract, the TPC was 146 ± 5.26 mg catechin/g dry extract and the TAS was 5.12 ± 0.7 mmol/L. The %DPPH( · ) free radical inhibition was 60%, 54%, 49% and 43%, respectively, for different extract concentrations; 20, 18.2, 16.3 and 14.5 mg/ml, respectively. The extract elicited significant dose-dependent pattern against rat intestinal sucrase (RIS; IC(50) = 36.72 mg/ml), rat intestinal maltase (RIM; IC(50) = 21.31 mg/ml) and porcine pancreatic α-amylase (PPA; IC(50) = 42.50 mg/ml) inhibitory activities. The inhibition was greater against maltase compared with sucrase. These effects may be attributed to the high TPC and FC levels. The linear regression analysis revealed strong significant positive correlations between %DPPH( · ) radical inhibition and each of %RIS, %RIM and %PPA inhibiting activity. Also, strong significant positive correlations between %RIS and either %RIM or %PPA inhibition activity were observed. We concluded therefore that basil aqueous extract via antioxidant and possibly α-glucosidase and α-amylase inhibiting activities, offered positive benefits to control diabetes.
Directory of Open Access Journals (Sweden)
Nowak Aleksander
2015-12-01
Full Text Available Nowadays, we can observe an increase in research on the use of small unmanned autonomous vessel (SUAV to patrol and guiding critical areas including harbours. The proposal to “snapshot” RAIM (Receiver Autonomous Integrity Monitoring method for GNSS receivers mounted on SUAV operating in poor space segment geometry is presented in the paper. Existing “snapshot” RAIM methods and algorithms which are used in practical applications have been developed for airborne receivers, thus two main assumptions have been made. The first one is that the geometry of visible satellites is strong. It means that the exclusion of any satellite from the positioning solution don’t cause significant deterioration of Dilution of Precision (DOP coefficients. The second one is that only one outlier could appear in pseudorange measurements. In case of SUAV operating in harbour these two assumptions cannot be accepted. Because of their small dimensions, GNSS antenna is only a few decimetres above sea level and regular ships, buildings and harbour facilities block and reflect satellite signals. Thus, different approach to “snapshot” RAIM is necessary. The proposal to method based on analyses of allowable maximal separation of positioning sub-solutions with using some information from EGNOS messages is described in the paper. Theoretical assumptions and results of numerical experiments are presented.
Directory of Open Access Journals (Sweden)
Eduardo L\\u00F3pez-Blancas
2014-01-01
Full Text Available Actividad antioxidante y enzimática de albahaca “Nufar” ( Ocimum basilicum L. almacenada en refrigeración. El presente estudio tuvo como objetivo evaluar el efecto del almacenamiento en refrigeración sobre la actividad antioxidante y actividad enzimática en albahaca ‘Nufar’. En la Universidad Aut ónoma Chapingo (Texcoco, México, durante el ciclo primavera-verano de 2012, albahaca preciclo primavera-verano de 2012, albahaca previamente empacada en película plástica, se almacenó en cámaras frigoríficas a 5 y 10 °C , y a temperatura ambiente (20 °C - testigo, por dieciocho días. Cada 48 horas, se evaluó el contenido de fenoles totales, capacidad antioxidante y la actividad de las enzimas catalasa, superóxido dismutasa, peroxidasa y polifenol oxidasa. En relación con el tiempo en refrigeración a 5 °C a los dos y cuatro días se presentó la mayor actividad de catalasa (14,3 U/mg/pro y superóxido dismutasa (2,9 U/mg/pro, y a los diez y dieciocho días hubo aumento de la actividad de peroxidasa (57,6 y 74,9 U/ mg/pro. A 10 °C y diez días se incrementó el contenido de fenoles totales de 3,7 a 4,2 mg/kg/PFr; así como la capacidad antioxidante de 47,5 a 79,1 mg VCEAC/g/PFr a ocho días; también aumentó la actividad de la polifenol oxidasa de 11,7 a 31,8 U/mg/pro a diez días. El almacenamiento a 5 °C afectó el contenido de fenoles totales y capacidad antioxidante, así como la actividad enzimática de peroxidasa y polifenol oxidasa, e incrementó la actividad de catalasa y superóxido dismutasa, por lo cual, se sugiere el almacenamiento de albahaca “nufar” a 10 °C para disminuir la actividad de las enzimas oxidativas.
Directory of Open Access Journals (Sweden)
Eleni Fitsiou
2016-08-01
Full Text Available Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil, Mentha spicata (spearmint, Pimpinella anisum (anise and Fortunella margarita (kumquat. GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4% in spearmint, methyl chavicol (74.9% in sweet basil, trans-anethole (88.1% in anise, and limonene (93.8% in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.
Fitsiou, Eleni; Mitropoulou, Gregoria; Spyridopoulou, Katerina; Tiptiri-Kourpeti, Angeliki; Vamvakias, Manolis; Bardouki, Haido; Panayiotidis, Mihalis Ι; Galanis, Alex; Kourkoutas, Yiannis; Chlichlia, Katerina; Pappa, Aglaia
2016-08-16
Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil), Mentha spicata (spearmint), Pimpinella anisum (anise) and Fortunella margarita (kumquat). GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4%) in spearmint, methyl chavicol (74.9%) in sweet basil, trans-anethole (88.1%) in anise, and limonene (93.8%) in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB) assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.
Effects of aqueous extracts of Hibiscus sabdariffa calyces and ...
African Journals Online (AJOL)
The effects of aqueous extracts of the leaves of Ocimum gratissimum and calyces of Hibiscus sabdariffa on intestinal transit were determined in experimental rats The leaves of Ocimum gratissimum were oven dried and then pulverized. The dried calyces of Hibiscus sabdariffa were also pulverized. 10% extracts of both ...
Precuantización en difeologías suaves
Directory of Open Access Journals (Sweden)
Carlos Torre
2009-02-01
Full Text Available We define a prequantization in the category of smooth diffeological spaces ( a category which includes finite an infinite dimensional systems, in the case where the symplectic form is exact, extending, for this case, the results of Kirillov, Kostant and Souriau which are devoloped for finite dimensional Physical systems.
Directory of Open Access Journals (Sweden)
Devendra Kumar
2016-12-01
Full Text Available Aims/Background: Present study investigated the synergistic effect of polyherbal formulations (PHF of Allium sativum L Eugenia jambolana Lam., Momordica charantia L., Ocimum sanctum Linn and Psidium guajava L. in the inhibition/induction of hepatic and intestinal CYPs and Phase-II conjugated drug metabolizing enzymes. Consumption of these herbal remedy has been extensively documented for diabetes treatment in Auyureda. Methodology: PHF of these five herbs was prepared and different doses were orally administered to Sprague Dawley rats of different groups except control group. Expression of mRNA and activity of drug metabolizing enzymes were examined by RT-PCR and HPLC in isolated liver and intestine microsomes in PHF pretreated rats. Results: Activities of hepatic and intestinal Phase-II enzyme levels increased along with mRNA levels except CYP3A mRNA level. PHF administration increases the activity of hepatic and intestinal UDPGT and GST in response to dose and time; however, activity of hepatic SULT increased at higher doses. Conclusions: CYPs and Phase-II conjugated enzymes levels can be modulated in dose and time dependent manner. Observations suggest that poly herbal formulation might be a possible cause of herb-drug interaction, due to changes in pharmacokinetic of crucial CYPs and Phase-II substrate drug. [J Complement Med Res 2016; 5(4.000: 372-382
Étude ethnobotanique, phytochimique et écotoxicologique de ...
African Journals Online (AJOL)
... Plante Médicinale a caractère de Légumes feuilles, gage de bonne santé et de Développement Durable. Mots clés: Ocimum gratissimum ; Légume feuille ; Plante médicinale ; Ethnobotanique ; Cotonou ; Bénin. English Abstract. Objective: The use of Ocimum gratissimum Lamiaceae (African Basil) is widespread in Benin.
Directory of Open Access Journals (Sweden)
Pejić Borivoj
2017-01-01
Full Text Available The experiments showing the effect of drip irrigation on yield, evapotranspiration and water productivity of sweet basil (Ocimum basilicum L. were conducted at the experimental field of the Alternative Crops Department, Institute of Field and Vegetable Crops, Novi Sad. Irrigation was scheduled on the basis of the water balance method. Daily evapotranspiration (ETd was computed from the reference evapotranspiration (ETo and crop coefficient (kc in May, June, July and August of 0.5, 0.6, 1.1 and 1.0, respectively. ETo was calculated using Hargreaves equation. The irrigation depth was restricted to the soil depth of 0.3 m. In other words, irrigation started when readily available water in the soil layer of 0.3 m was completely depleted by plants. The irrigation rate was 30 mm (30 l m-2 while the amount of water added by irrigation during the season was 140 mm. Basil sensitivity to water stress was determined using a yield response factor (Ky. According to the results, the yield of fresh herb of basil under irrigation (32.015 t ha-1 was higher by 9% compared to non-irrigated, control variant (29.364 t ha-1. Worthy of note, basil essential oil yield was significantly affected by irrigation (35.329/28.766 kg ha-1. The content of essential oil was significantly higher in irrigated (6.45 g kg-1 than in non-irrigated variant (5.33 g kg-1 in the first harvest, while no significant difference between irrigated and non-irrigated variants was obtained in the second harvest (6.83 and 6.62 g kg-1 , respectively. Water used on evapotranspiration in irrigation conditions (ETm was 431 mm and 270 mm in non-irrigated, control variant (ETa. The values of irrigation water use efficiency (Iwue and evapotranspiration water use efficiency (ETwue were 1.89 kg m-3 and 1.65 kg m-3 respectively. Ky value (0.22 exhibits all essential characteristics of climate conditions of 2016 rainy year. These preliminary results could be used as a good platform for basil growers in the
Energy Technology Data Exchange (ETDEWEB)
Lung, Ildikó [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Soran, Maria-Loredana, E-mail: loredana.soran@itim-cj.ro [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Opriş, Ocsana; Truşcă, Mihail Radu Cătălin [National Institute for Research and Development of Isotopic and Molecular Technologies, 67-103 Donat Street, Cluj-Napoca 400293 (Romania); Niinemets, Ülo [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Copolovici, Lucian [Institute of Agricultural and Environmental Sciences, Estonian University of Life Sciences, 1 Kreutzwaldi Street, Tartu 51014 (Estonia); Institute of Technical and Natural Sciences Research-Development of “Aurel Vlaicu” University, 2 Elena Drăgoi Street, Arad 310330 (Romania)
2016-11-01
Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the
International Nuclear Information System (INIS)
Lung, Ildikó; Soran, Maria-Loredana; Opriş, Ocsana; Truşcă, Mihail Radu Cătălin; Niinemets, Ülo; Copolovici, Lucian
2016-01-01
Exposure to sustained low intensity microwaves can constitute a stress for the plants, but its effects on plant secondary chemistry are poorly known. We studied the influence of GSM and WLAN-frequency microwaves on emissions of volatile organic compounds and content of essential oil in the aromatic plant Ocimum basilicum L. hypothesizing that microwave exposure leads to enhanced emissions of stress volatiles and overall greater investment in secondary compounds. Compared to the control plants, microwave irradiation led to decreased emissions of β-pinene, α-phellandrene, bornyl acetate, β-myrcene, α-caryophyllene and benzaldehyde, but increased emissions of eucalyptol, estragole, caryophyllene oxide, and α-bergamotene. The highest increase in emission, 21 times greater compared to control, was observed for caryophyllene oxide. The irradiation resulted in increases in the essential oil content, except for the content of phytol which decreased by 41% in the case of GSM-frequency, and 82% in the case of WLAN-frequency microwave irradiation. The strongest increase in response to WLAN irradiation, > 17 times greater, was observed for hexadecane and octane contents. Comparisons of volatile compositions by multivariate analyses demonstrated a clear separation of different irradiance treatments, and according to the changes in the volatile emissions, the WLAN-frequency irradiation represented a more severe stress than the GSM-frequency irradiation. Overall, these results demonstrating important modifications in the emission rates, essential oil content and composition indicate that microwave irradiation influences the quality of herbage of this economically important spice plant. - Highlights: • Microwave irradiation represents a stress for the plants. • Microwave exposure leads to enhanced emissions of stress volatiles. • O. basilicum irradiation with microwaves increases the essential oil content. • Microwave pollution can constitute a threat to the
Adjou, Euloge S; Kouton, Sandrine; Dahouenon-Ahoussi, Edwige; Soumanou, Mohamed M; Sohounhloue, Dominique C K
2013-02-01
The aim of this study was to evaluate the effect of essential oil from fresh leaves of Sweet Fennel (Ocimum gratissimum) on mycoflora and Aspergillus section Flavi populations in stored peanuts. Aspergillus, Fusarium and Mucor spp. were the most common genera identified from peanuts at post-harvest in Benin by using a taxonomic schemes primarily based on morphological characters of mycelium and conidia. The isolated fungi include Aspergillus niger, A. parasiticus, A. flavus, A. ochraceus, Fusarium graminearum, F. solani, F. oxysporum and Mucor spp. The most prevalent fungi recorded were A. niger (94.18 %), A. flavus (83.72 %), A. parasiticus (77.90 %), A. ochraceus (72.09 %), F. graminearum (59.30 %) and F. oxysporum (51.16 %). Antifungal assay, performed by the agar medium assay, indicated that essential oil exhibited high antifungal activity against the growth of A. flavus, A. parasiticus, A. ochraceus and F. oxysporium. The minimal inhibitory concentration (MIC) of the essential oil was found to be 7.5 μl/ml for A. flavus and A. parasiticus and 5.5 μl/ml for A. ochraceus and F. oxysporium. The minimal fungicidal concentration (MFC) was recorded to be 8.0 μl/ml for A. flavus and A. parasiticus, 6,5 μl/ml for A. ochraceus and 6.0 μl/ml for F. oxysporium. The essential oil was found to be strongly fungicidal and inhibitory to aflatoxin production. Chemical analysis by GC/MS of the components of the oil led to the identification of 31 components characterized by myrcene (6.4 %), α-thujene (8.2 %), p-cymene (17.6 %), γ-terpinene (20.0 %), and thymol (26.9 %) as major components. The essential oil of Sweet Fennel, with fungal growth and mycotoxin inhibitory properties, offers a novel approach to the management of storage, thus opening up the possibility to prevent mold contamination in stored peanuts.
Hiawatha Aircraft Anti-Collision System, Phase II
National Aeronautics and Space Administration — For Small Unmanned Aerial Vehicles (SUAVs), the FAA mandate to equip all aircraft with ADS-B Out transmitters by 1 January 2020 to support NextGen goals presents...
Hiawatha Aircraft Anti-Collision System, Phase I
National Aeronautics and Space Administration — For SUAVs, the FAA mandate to equip all aircraft with ADS-B Out transmitters by 1 January 2020 to support NextGen goals presents both logistical and mission security...
Amornrat Intorasoot; Piyaorn Chornchoem; Siriwoot Sookkhee; Sorasak Intorasoot
2017-01-01
Aim: To investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum) and cinnamon (Cinnamomum verum) against four standard strains of Staphylococcus aureus, E...
Directory of Open Access Journals (Sweden)
Khaki Arash
2016-01-01
Full Text Available Objective: Basil herb (Ocimum basilicum has long been used in human nutrition. Nowadays antioxidant role of this herb is known more. The aim of this study was to study the anti-oxidative property of sweet basil to protect central nervous system against oxidative damages of electromagnetic field (EMF and its affective sequences. Materials and Methods: Forty Albino male Wistar rats were randomly allocated to four groups, 10 rats per each. Group 1 received normal diet (control group, group 2 was exposed to 50 Hz EMF for 8 weeks (EMF group. Group 3 was exposed to 50 Hz EMF and fed with basil extract (0.5 g/kg body weight for 8 weeks (treatment group and group 4 was fed with basil extract (0.5 g/kg body weight for 8 weeks and named as herbal group. At the end of eighth week 5 mL blood was taken from all rats for biochemical analysis and for ultra structural study of brain neuron samples was taken. Results: The results showed level of superoxide dismutase (SOD, glutathione (GSH peroxidase and catalase activity (CAT were significantly increased in herbal and treatment groups as compared to EMF group (P < 0.05. Level of malondialdehyde (MDA was significantly decreased in treatment group as compare to EMF group (P < 0.05. Ultra structural evaluation of EMF group showed brain nucleus has a lot of heterochromatic changes and mitochondria have been ovulated and have swelling figure this changes were less in treatment group. Conclusion: Antioxidant capacity of basil extract can cause to decrease oxidative effects of EMF on brain tissue and in rats.
Energy Technology Data Exchange (ETDEWEB)
Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K. [Synthetic and Surface Science Laboratory, Ajmer (India)
2012-08-15
Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E{sub B}), ocimum canum (E{sub C}) and ocimum sanctum (E{sub S}). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E{sub B} is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution.
International Nuclear Information System (INIS)
Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K.
2012-01-01
Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E B ), ocimum canum (E C ) and ocimum sanctum (E S ). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E B is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution
Directory of Open Access Journals (Sweden)
Devendra Kumar
2017-03-01
Full Text Available Aims/Background: This study was evaluated synergistic effect of Polyherbal formulation (PHF of Allium sativum L., Eugenia jambolana Lam., Momordica charantia L., Ocimum sanctum Linn and Psidium guajava L on p-glycoprotein of intestine. These five herbs were traditionally used for diabetes. These herbs are commonly present in ayurvedic product as antidiabetics in India. Methodology: PHF was prepared by five indigenous herbs. Different doses (50, 100 and 200 mg/kg/day of was orally administered to Sprague-Dawley rats of different groups for multiple weeks except control groups. Alteration in Pgp expression was evaluated by RT-PCR and western blotting while modulation in activity of Pgp was evaluated using rhodamine 123 as transport substrate by in-situ absorption and everted gut sac method. Results: In PHF pretreated group received 50, 100 and 200 mg/kg/day for seven days, mRNA level decreased by 1.75, 2.45 and 2.37 fold respectively as compared to control. Similarly when PHF at dose of 100 mg/kg/day was given consequently for four weeks maximum decrease in Pgp expression level was observed only after one week and further increase in the treatment duration did not produce significant decrease compared to first week treatment. Pgp mediated transport of rhodamine 123 was significantly decreased with everted gut sac prepared from PHF pretreated rats (one week compared to those prepared from vehicle treated rats. Conclusions: In conclusion, we report that PHF pretreatment down regulated the expression of intestinal Pgp and this down regulated intestinal Pgp would result in decreased functional activity. Additionally this down regulated Pgp expression might affect the bioavailability of antidiabetic Pgp substrate drugs. [J Complement Med Res 2017; 6(1.000: 68-74
Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak
2017-01-01
Aim: The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum), and cinnamon (Cinnamomum verum) against four standard strains of ...
Directory of Open Access Journals (Sweden)
S. Hälvä
1987-01-01
Full Text Available Agryl P17 fiber-mulching of cold-sensitive herbal plants, basil (Ocimum basilicum L. and marjoram (Origanum majorana L., were studied at three locations in Finland (1984—1985. The growing sites were Helsinki (60° 14' N, Sahalahti (61° 28' N, and Inari (69° 04' N for both species in 1984, and Helsinki for marjoram in 1985. Agryl P17 mulching increased basil yield at all locations. The uncovered basil yielded approximately 54 kg/100 m2 and when grown under the mulch, more than three fold, 191 kg/ 100m2. In the north (Inari, however, basil and marjoram did not give practically any yield. Marjoram did not benefit from mulching either in the south: the yield was 96 kg without and 80 kg/100m2 with mulching. The vegetation under the mulch was severely affected by fungus diseases. The volatile oil content in the dried basil herb ranged from 0.46 to 0.93 %. There were no significant differences in the total oil content whether basil was grown with or without Agryl P17. The oil content in marjoram ranged from 1.94 to 2.55 % the total content being significantly higher when grown under the cover.
Directory of Open Access Journals (Sweden)
Pandu Sastry KAKARAPARTHI
2015-12-01
Full Text Available An experiment was conducted to study the changes in the chemical composition of the essential oil of two varieties of Ocimum basilicum over a period of six months at short harvest intervals for two crop seasons. In variety Vikarsudha, GC/MS analysis revealed the presence of eighteen essential oil constituents. Linalool (23.540.1% and 22.833.7% and methyl chavicol (25.451.9% and 40.052.7% were the major constituents in main and ratoon crops. Similarly, in variety Kuhmohak GC/MS analysis revealed the presence of linalool (19.225.4 % and 16.131.3% and methyl chavicol (34.753.4% and 39.459.2% in large quantities in main and ratoon crops, respectively. β myrcene, limonene, 1,8 cineole, ocimene, camphor, terpinen-4-ol, bornyl acetate, eugenol, methyl eugenol, β elemene, β caryophyllene, α humulene, γ Cadinene and cadinol were present in small quantities. Results pertaining to the zone of inhibition in the antimicrobial activity of essential oil indicated that Chromobacterium violaceum is more sensitive compared to Staphylococcus aureus. Among the fungal strains Aspergillus niger was found to be more sensitive. GC-MS analysis of the fixed oils obtained from the seeds in the ratoon crop revealed the presence of unsaturated and saturated fatty acids. The unsaturated fatty acids averaged 89% consisting of α-linolenic (49.3%52.4%, linoleic (23.4%26.0%, and oleic (10.3%12.3% acids. The most abundant saturated fatty acids were palmitic and stearic acids.
2006-05-01
glyptosperma ribseed sandmat 0 Euphorbia maculata Spotted Spurge 0 Euthamia graminifolia Flat-top Goldentop 6 Fragaria virginiana Wild Strawberry 4...Foxtail UK Setaria viridis Pennisetum viridis Green Foxtail 0 Silene sp. Catchfly UK Sisyrinchium campestre White-eyed Grass 10 Sium suave
Directory of Open Access Journals (Sweden)
M. Bagheri Shirvan
2016-05-01
Full Text Available In order to evaluate intercropping of soybean (Glycine max L. cv. JK with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. with weed interference, an experiment was performed in randomized complete block design with 12 treatments and three replications at a field located 10 km of Shirvan during year of 2011. The treatments were included 75% soybean: 25%sweet basil, 50%soybean: 50% sweet basil, 25% soybean: 75% sweet basil, 75% soybean: 25% borage, 50% soybean: 50% borage and 25% soybean: 75% borage under weed infestation, in addition sole cropping of plants under weed control and weed interference. Intercropped plants had more success in reduction of weed density and biomass compared to monoculture. Soybean50: sweet basil50, reduced the weed density by 47.95% and 52.9%, and reduced the weed biomass by 68.91% and 61.87% more than sweet basil and soybean pure stand, respectively. Investigation of dry matter accumulation showed that increasing of plant proportion in intercropping caused increasing of plant dry matter. The height of soybean and borage was increased in intercropping and weed interference, while the highest height of sweet basil was observed in monoculture at second harvest. Biological and economical yield of soybean in intercropping with sweet basil was higher than intercropping with borage. The highest harvest index was related to 50:50 soybean: sweet basil ratio. In this ratio, the harvest index increased 4.9% compared to soybean monoculture. Yield of sweet basil and borage decreased with increasing of soybean rows in intercropping. Based on area-time equivalent ratio, soybean 75% with sweet basil and borage 25% (based on borage seed yield had 3% and 4% advantage compared to monoculture.
Al Jaouni, Soad; Saleh, Ahmed M; Wadaan, Mohammed A M; Hozzein, Wael N; Selim, Samy; AbdElgawad, Hamada
Many studies have discussed the influence of elevated carbon dioxide (eCO 2 ) on modeling and crop plants. However, much less effort has been dedicated to herbal plants. In this study, a robust monitoring for the levels of 94 primary and secondary metabolites and minerals in two medicinal herbs, basil (Ocimum basilicum L.) and peppermint (Mentha piperita L.), grwon under both ambient (aCO 2 , 360 ppm) and eCO 2 (620 ppm) was performed. We also assessed how the changes in herbal tissue chemistry affected their biological activity. Elevated CO 2 significantly increased herbal biomass, improved the rates of photosynthesis and dark respiration, and altered the tissue chemistry. Principal Component Analysis of the full data set revealed that eCO 2 induced a global change in the metabolomes of the two plants. Moreover, Hierarchical Clustering Analyses showed quantitative differences in the metabolic profiles of the two plants and in their responsiveness to eCO 2 . Out of 94 metabolites, 38 and 31 significantly increased in basil and peppermint, respectively, as affected by eCO 2 . Regardless of the plant species, the levels of non-structural carbohydrates, fumarate, glutamine, glutathione, ascorbate, phylloquinone (vitamin K1), anthocyanins and a majority of flavonoids and minerals were significantly improved by eCO 2 . However, some metabolites tended to show species specificity. Interestingly, eCO 2 caused enhancement in antioxidant, antiprotozoal, anti-bacterial and anticancer (against urinary bladder carcinoma; T24P) activities in both plants, which was consequent with improvement in the levels of antioxidant metabolites such as glutathione, ascorbate and flavonoids. Therefore, this study suggests that the metabolic changes triggered by eCO 2 in the target herbal plants improved their biological activities. Copyright © 2018 Elsevier GmbH. All rights reserved.
Rabbani, Mohammed; Sajjadi, Seyed Ebrahim; Vaezi, Arefeh
2015-01-01
Ocimum basilicum belongs to Lamiaceae family and has been used for the treatment of wide range of diseases in traditional medicine in Iranian folk medicine. Due to the progressive need to anti-anxiety medications and because of the similarity between O. basilicum and Salvia officinalis, which has anti-anxiety effects, we decided to investigate the anxiolytic and sedative activity of hydroalcoholic extract and essential oil of O. basilicum in mice by utilizing an elevated plus maze and locomotor activity meter. The chemical composition of the plant essential oil was also determined. The essential oil and hydroalcoholic extract of this plant were administered intraperitoneally to male Syrian mice at various doses (100, 150 and 200 mg/kg of hydroalcoholic extract and 200 mg/kg of essential oil) 30 min before starting the experiment. The amount of hydroalcoholic extract was 18.6% w/w and the essential oil was 0.34% v/w. The major components of the essential oil were methyl chavicol (42.8%), geranial (13.0%), neral (12.2%) and β-caryophyllene (7.2%). HE at 150 and 200 mg/kg and EO at 200 mg/kg significantly increased the time passed in open arms in comparison to control group. This finding was not significant for the dose of 100 mg/kg of the extract. None of the dosages had significant effect on the number of entrance to the open arms. Moreover, both the hydroalcoholic extract and the essential oil decreased the locomotion of mice in comparison to the control group. This study shows the anxiolytic and sedative effect of hydroalcoholic extract and essential oil of O. basilicum. The anti-anxiety and sedative effect of essential oil was higher than the hydroalcoholic extract with the same doses. These effects could be due to the phenol components of O. basilicum.
Keziah, Ezeike Amarachi; Nukenine, Elias Nchiwan; Danga, Simon Pierre Yinyang; Younoussa, Lame; Esimone, Charles Okechukwu
2015-01-01
Mosquitoes are the most deadly vectors of parasites that cause diseases such as malaria, yellow fever, and filariasis. In view of the recent increased interest in developing plant origin insecticides as an alternative to chemical insecticides, the objective of this study was to determine the repellent activity of creams formulated with methanol crude extract (MCE), hexane fraction (HF), and ethyl acetate fractions (EAFs) of Ocimum gratissimum and Lantana camara leaves in single and combined actions against female Aedes aegypti. Evaluation was carried out in the net cages (30 by 30 by 30 cm) containing 60 blood-starved female mosquitoes each and were assayed in the laboratory condition following World Health Organization 2009 protocol. All formulations (single and mixture) were applied at 2, 4, 6, and 8 mg/cm(2) in the exposed area of human hands. Only acetone + white soft paraffin served as negative control and odomos (12% DEET) as positive control. All the formulations presented good protection against mosquito bites without any allergic reaction by the human volunteers. The repellent activity was dependent on the strength of the extracts and fractions. Among the tested formulations, the maximum protection time was observed in MCE (120 min) and EAF (150 min) of O. gratissimum; MCE:MCE (150 min) and HF:HF (120 min) mixtures of both plants. In addition, MCE:MCE and HF:HF mixtures from both plants showed possible synergistic effect. From the results, the combination of O. gratissimum and L. camara to formulate natural mosquito repellent using small amount of extracts can be encouraging to be an alternative to conventional DEET. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.
1540-IJBCS-Article-Do Moukpevi Réné+
African Journals Online (AJOL)
hp
acide désoxyribonucléique (ADN). Aïdam AV. 2005. Etablissement des cultures organisées d'Ocimum gratissimum L. et d'Ocimum basilicum L. en vue de la production de composés d'intérêts thérapeutiques et phytosanitaires. Thèse de doctorat en Physiologie et. Biotechnologie végétales, Université de. Lomé, Togo, 158 p ...
Pyne, Robert; Honig, Josh; Vaiciunas, Jennifer; Koroch, Adolfina; Wyenandt, Christian; Bonos, Stacy; Simon, James
2017-01-01
Limited understanding of sweet basil (Ocimum basilicum L.) genetics and genome structure has reduced efficiency of breeding strategies. This is evidenced by the rapid, worldwide dissemination of basil downy mildew (Peronospora belbahrii) in the absence of resistant cultivars. In an effort to improve available genetic resources, expressed sequence tag simple sequence repeat (EST-SSR) and single nucleotide polymorphism (SNP) markers were developed and used to genotype the MRI x SB22 F2 mapping population, which segregates for response to downy mildew. SNP markers were generated from genomic sequences derived from double digestion restriction site associated DNA sequencing (ddRADseq). Disomic segregation was observed in both SNP and EST-SSR markers providing evidence of an O. basilicum allotetraploid genome structure and allowing for subsequent analysis of the mapping population as a diploid intercross. A dense linkage map was constructed using 42 EST-SSR and 1,847 SNP markers spanning 3,030.9 cM. Multiple quantitative trait loci (QTL) model (MQM) analysis identified three QTL that explained 37-55% of phenotypic variance associated with downy mildew response across three environments. A single major QTL, dm11.1 explained 21-28% of phenotypic variance and demonstrated dominant gene action. Two minor QTL dm9.1 and dm14.1 explained 5-16% and 4-18% of phenotypic variance, respectively. Evidence is provided for an additive effect between the two minor QTL and the major QTL dm11.1 increasing downy mildew susceptibility. Results indicate that ddRADseq-facilitated SNP and SSR marker genotyping is an effective approach for mapping the sweet basil genome.
Dicty_cDB: Contig-U15883-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi
Energy Technology Data Exchange (ETDEWEB)
Rastogi, Shipra; Shukla, Yogeshwer; Paul, Bhola N; Chowdhuri, D Kar; Khanna, Subhash K [Industrial Toxicology Research Centre, Mahatma Gandhi Marg, P.O. Box 80, Lucknow-226001 (India); Das, Mukul [Industrial Toxicology Research Centre, Mahatma Gandhi Marg, P.O. Box 80, Lucknow-226001 (India)
2007-11-01
A study on the protective effect of alcoholic extract of the leaves of Ocimum sanctum on 3-mthylcholanthrene (MCA), 7,12-dimethylbenzanthracene (DMBA) and aflatoxin B{sub 1} (AFB{sub 1}) induced skin tumorigenesis in a mouse model has been investigated. The study involved pretreatment of mice with the leaf extract prior to either MCA application or tetradecanoyl phorbol acetate (TPA) treatment in a two-stage tumor protocol viz a viz, DMBA/TPA and AFB1/TPA. The results of the present study indicate that the pretreatment with alcoholic extract of the leaves of O. sanctum decreased the number of tumors in MCA, DMBA/TPA and AFB1/TPA treated mice. The skin tumor induced animals pretreated with alcoholic extract led to a decrease in the expression of cutaneous {gamma}-glutamyl transpeptidase (GGT) and glutathione-S-transferase-P (GST-P) protein. The histopathological examination of skin tumors treated with leaf extract showed increased infiltration of polymorphonuclear, mononuclear and lymphocytic cells, decreased ornithine decarboxylase activity with concomitant enhancement of interleukin-1{beta} (IL-1{beta}) and tumor necrosis factor-{alpha} (TNF-{alpha}) in the serum, implying the in vivo antiproliferative and immunomodulatory activity of leaf extract. The decrease in cutaneous phase I enzymes and elevation of phase II enzymes in response to topical application of leaf extract prior to MCA, AFB1, DMBA/TPA and AFB1/TPA treatment indicate the possibility of impairment in reactive metabolite(s) formation and thereby reducing skin carcinogenicity. Furthermore, pretreatment of leaf extract in the carcinogen induced animals resulted in elevation of glutathione levels and decrease in lipid peroxidation along with heat shock protein expression, indicating a scavenging or antioxidant potential of the extract during chemical carcinogenesis. Thus it can be concluded that leaf extract of O. sanctum provides protection against chemical carcinogenesis in one or more of the
Directory of Open Access Journals (Sweden)
Gabriel Mañana Guichón
1993-07-01
Full Text Available Se presentan los algoritmos desarrollados para el trazado de lineas suaves y aplicación de texto sobre imágenes, como ejemplo del trabajo de investigación que se lleva a cabo en el campo del filtrado de imágenes o antialiasing.
Larvicidal Activity of essential oils from Brazilian plants against Aedes aegypti L.
Directory of Open Access Journals (Sweden)
Eveline Solon Barreira Cavalcanti
2004-08-01
Full Text Available Aedes aegypti L. is the major vector of dengue fever, an endemic disease in Brazil. In an effort to find effective and affordable ways to control this mosquito, the larvicidal activities of essential oils from nine plants widely found in the Northeast of Brazil were analyzed by measurement of their LC50. The essential oils were extracted by steam distillation and their chemical composition determined by GL-chromatography coupled to mass spectroscopy. The essential oils from Cymbopogon citratus and Lippia sidoides, reported in the literature to have larvicidal properties against A. aegypti, were used for activity comparison. The results show that Ocimum americanum and Ocimum gratissimum have LC50 of 67 ppm and 60 ppm respectively, compared to 63 ppm for L. sidoides and 69 ppm for C. citratus. These results suggest a potential utilization of the essential oil of these two Ocimum species for the control of A. aegypti.
Codes of conduct: An extra suave instrument of EU governance?
DEFF Research Database (Denmark)
Borras, Susana
able to coordinate actors successfully (effectiveness)? and secondly, under what conditions are codes of conduct able to generate democratically legitimate political processes? The paper examines carefully a recent case study, the “Code of Conduct for the Recruitment of Researchers” (CCRR). The code...... establishes a specific set of voluntary norms and principles that shall guide the recruiting process of researchers by European research organizations (universities, public research organizations and firms) in the 33 countries of the single market minded initiative of the European Research Area. A series...
Ghasemzadeh, Ali; Ashkani, Sadegh; Baghdadi, Ali; Pazoki, Alireza; Jaafar, Hawa Z E; Rahmat, Asmah
2016-09-09
Sweet basil (Ocimum basilicum Linnaeus) is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV)-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m²) and durations (4, 6, 8, and 10-h) was applied at the post-harvest stage. Total flavonoid content (TFC) and total phenolic content (TPC) were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS) activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7) were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assays and MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) assays, respectively. UV-B irradiation at an intensity of 3.60 W/m² increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold), catechin (0.85-fold), kaempferol (0.65-fold) rutin (0.68-fold) and luteolin (1.00-fold) content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid) was observed in the 3.60 W/m² of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h) except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m² of UV-B irradiation. UV
Mitigación de NaCl por efecto de un bioestimulante en la germinación de Ocimum basilicum L.
Directory of Open Access Journals (Sweden)
Daulemys Batista Sánchez
2017-10-01
Full Text Available Los bioestimulantes vegetales activan el proceso de germinación de las semillas; accionan funciones fisiológicas en las plantas, contienen sustancias propias del metabolismo vegetal, que mejoran el uso de nutrientes y son una opción para mitigar estrés por salinidad. El objetivo del estudio fue evaluar el efecto de un bioestimulante de origen natural (FitoMas-E®, como atenuante de la salinidad en la germinación de las variedades de albahaca (Ocimum basilicum L. Emily, Napoletano y Nufar. Las semillas se sometieron a concentraciones de NaCl (0, 50, 100 y 150 mM y dosis de FitoMas-E® (0, 0.5, 1 y 1.5 mL L-1, en un diseño completamente al azar con arreglo factorial con cuatro repeticiones, en condiciones controladas. Se evaluó porcentaje y tasa de germinación, altura de la plántula, longitud de radícula, biomasa fresca y seca de la radícula, biomasa fresca y seca de la parte aérea. Los resultados mostraron que la altura de la planta, longitud de la radícula, biomasa fresca de parte aérea y biomasa seca de la radícula con 150 mM de NaCl fueron las más dañadas. Napoletano y Nufar mostraron longitud de radícula mayor en 0 mM y conforme la concentración de NaCl incrementó, la longitud de radícula disminuyó significativamente para las tres variedades. Las plántulas de semillas tratadas con FitoMas-E®, incrementaron longitud de radícula, destacando Napoletano en 1 mL L‑1 y Nufar con 0.5 mL L 1. Napoletano mostró biomasa fresca de parte aérea mayor en 0 mM con 0.5 mL L-1 de FitoMas-E®. Las plántulas de Napoletano de semillas tratadas con 0.5 mL L‑1 de FitoMas-E® incrementaron la biomasa seca de radícula en 0 y 50 mM de NaCl. Se concluye que el FitoMas-E® con dosis de 0.5 y 1 mL L-1 mitiga el efecto del estrés salino de moderado a severo en semillas de albahaca.
Directory of Open Access Journals (Sweden)
Ali Ghasemzadeh
2016-09-01
Full Text Available Sweet basil (Ocimum basilicum Linnaeus is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m2 and durations (4, 6, 8, and 10-h was applied at the post-harvest stage. Total flavonoid content (TFC and total phenolic content (TPC were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7 were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH assays and MTT (3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide assays, respectively. UV-B irradiation at an intensity of 3.60 W/m2 increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold, catechin (0.85-fold, kaempferol (0.65-fold rutin (0.68-fold and luteolin (1.00-fold content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid was observed in the 3.60 W/m2 of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m2 of UV-B irradiation. UV
In vitro antiplasmodial activity of medicinal plants native to or naturalised in South Africa
CSIR Research Space (South Africa)
Clarkson, C
2004-06-01
Full Text Available Leucas martinicensis (L.) R.Br. BP01204 Whole plant DCM/MeOH (1:1) 0.813.3 Water 0.7 > 100 Ocimum americanum L. var. americanum BP01210 Whole plant DCM/MeOH (1:1) 0.14.2 Water 0.8 > 100 Salvia repens Burch. ex Benth. BP00998 Whole plant DCM/MeOH (1:1) 1... al., 1997) and Ocimum americanum L. var. ameri- canum (Lamiaceae) (Vieira et al., 2003), there are no reports on their antiplasmodial activity. Several representatives Table 2 Native or naturalised South African plants with high antiplasmodial...
Chaudhary, Sachin; Semwal, Amit; Kumar, Hitesh; Verma, Harish Chandra; Kumar, Amit
2016-12-01
The study introduced anti-hyperglycemic influence of aqueous extract of Ocimum basilicum seeds (AEOBS) in Streptozotocin (STZ) induced diabetic rats and estimating its potential to ameliorate altered level of biochemical parameters, serum electrolytes level and haematological indices along with its effect on body weight of treated rats. The albino rats were selected to observe oral glucose tolerance test by oral intake of aq. glucose solution (4g/kg, body weight) in normal rats and estimation of blood glucose level after administration of AEOBS at 250mg/kg, 500mg/kg and standard drug glibenclamide at 0.6mg/kg, body weight. Antidiabetic activity was evaluated in chronic study models by STZ induced diabetes in rats followed by blood glucose estimation. Chronic study model was selected to carry out further studies to evaluate the effect of AEOBS at 250mg/kg, 500mg/kg and standard drug on body weight, alterations in biochemical parameters including AST, ALT, ALP, total bilirubin and total protein, alterations in serum electrolytes like Na + , K + , Cl - , HCO 3 - along with estimation of haematological indices like red blood cells (RBC), white blood cells (WBC), hemoglobin (Hb), lymphocytes, neutrophils, eosinophils, monocytes and basophils. AEOBS significantly reduced the blood glucose level of diabetic rats at both doses. Body weight was also improved significantly. Similarly, the levels of biochemical parameters, serum electrolytes, and haematological indices were significantly ameliorated at both doses of AEOBS. The histopathological results revealed reconstitution of pancreatic islets towards normal cellular architecture in rats treated with AEOBS. The results illustrated that AEOBS have eminent antidiabetic potential in STZ effectuated diabetes in rats and can be extensively used for the treatment of diabetes mellitus-II and its associated complications including anaemia, diabetic nephropathy, liver dysfunction, and immunosuppression. Copyright © 2016 Elsevier
Energy values and estimation of power generation potentials of some non-woody biomass species
Energy Technology Data Exchange (ETDEWEB)
Kumar, M; Patel, S K [National Institute of Technology, Rourkela (India)
2008-07-01
In view of high energy potentials in non-woody biomass species and an increasing interest in their utilization for power generation, an attempt has been made in this study to assess the proximate analysis and energy content of different components of Ocimum canum and Tridax procumbens biomass species (both non-woody), and their impact on power generation and land requirement for energy plantations. The net energy content in Ocimum canum was found to be slightly higher than that in Tridax procumbens. In spite of having higher ash contents, the barks from both the plant species exhibited higher calorific values. The results have shown that approximately 650 and 1,270 hectares of land are required to generate 20,000 kWh/day electricity from Ocimum canum and Tridax procumbens biomass species. Coal samples, obtained from six different local mines, were also examined for their qualities, and the results were compared with those of studied biomass materials. This comparison reveals much higher power output with negligible emission of suspended particulate matters (SPM) from biomass materials.
Application of grey system theory on the influencing parameters of aerobic granulation in SBR.
Bindhu, B K; Madhu, G
2017-09-01
Aerobic granulation is a promising technology for wastewater treatment. Four operational parameters were selected as influencing factors for this study. Aerobic granulation was experimented with three different values of organic loading rate (3, 6 and 9 kg COD m -3 d -1 ), superficial upflow air velocity (SUAV) (2, 3 and 4 cm s -1 ), settling time (3, 5 and 10 min) and volume exchange ratio (25%, 50% and 75%) in sequencing batch reactor in nine trials for the optimal performance of aerobic granulation. The influence of compared parameters on five reference parameters (sludge volume index (SVI), time taken for the appearance of granules, size and specific gravity of granules and chemical oxygen demand (COD) removal) was analyzed using grey system theory. The grey relational coefficients and grey entropy relational grade of each parameter were calculated. Hydrodynamic shear force in terms of SUAV was found to have the greatest influence on granule appearance, specific gravity of granules and COD removal efficiency. SVI is greatly affected by settling time. The optimal scopes of all the compared parameters were found.
WIND TUNNEL EVALUATION FOR CONTROL TRANSITION FROM ELEVATOR TO STABILATOR OF SMALL UAV
Directory of Open Access Journals (Sweden)
ZULHILMY SAHWEE
2017-06-01
Full Text Available Faulty control surface actuator in a small Unmanned Aerial Vehicles (sUAV could be overcome with a few techniques. Redundant actuators, analytical redundancy or combination of both are normally used as fault accommodation techniques. In this paper, the accommodation technique of faulty elevator actuator is presented. This technique uses a standby control surface as temporary control reallocation. Wind tunnel measurement facility is set up for the experimental validation and it is compared with FoilSim software. Flat plate airfoil which was used as horizontal stabilizer, is simulated using numerical model and it is validated using the wind tunnel test. Then, a flat airfoil is designed to be used as stabilator for the recovery of faulty elevator actuator. Results show the different deflection angle is needed when transferring from one control surface to another. From the analysis, the proposed method could be implemented without affecting the pitch stability during control surface transition. The alternate control surface accommodation technique proves to be promising for higher reliability sUAV in the case of a faulty on-board actuator.
Pandey, Renu; Chandra, Preeti; Srivastava, Mukesh; Mishra, D K; Kumar, Brijesh
2015-01-01
Ocimum sanctum L., with phenolic acids, flavonoids, propenyl phenols and terpenoids as active pharmacological constituents, is a popular medicinal herb and is present as an ingredient in many herbal formulations. Therefore, development of a reliable analytical method for simultaneous determination of the pharmacologically active constituents of O. sanctum is of high importance. To develop and validate a new, rapid, sensitive and selective UPLC-ESI/MS/MS method for simultaneous determination of 23 bioactive markers including phenolic acids, flavonoids, propenyl phenol and terpenoid in the leaf extract and marketed herbal formulations of O. sanctum. An UPLC-ESI/MS/MS method using negative electrospray ionisation (ESI) in multiple-reaction-monitoring (MRM) mode was used for simultaneous determination. Chromatographic separation was achieved on an Acquity UPLC BEH C18 -column using a gradient elution with 0.1% formic acid in water and 0.1% formic acid in acetonitrile. Principal component analysis (PCA) was applied to correlate and discriminate eight geographical collections of O. sanctum based on quantitative data of the analytes. The developed method was validated as per International Conference on Harmonization guidelines and found to be accurate, with overall recovery in the range 95.09-104.84% (RSD ≤ 1.85%), precise (RSD ≤ 1.98%) and linear (r(2) ≥ 0.9971) over the concentration range of 0.5-1000 ng/mL. Ursolic acid was found to be the most abundant marker in all the samples investigated, except for the marketed tablet. The method established is simple, rapid and sensitive, hence it can be reliably utilised for the quality control of O. sanctum and derived herbal formulations. Copyright © 2015 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
S. Beigi
2016-02-01
Full Text Available Introduction: Medicinal plants are rich in active substances and primarily have been used in the manufacture of many drugs. Basil (Ocimum basilicum L. is one of the important medicinal plants whichbelongs to the Lamiaceae family. Basil essential oil content (between 0.5 to 1.5 percent varies according to climatic conditions of habitat location. Basilneeds a lot of water during growth period and it is very sensitive to water stress and shows wilting symptoms very soon after water shortage. Iran is located in an arid and semi-arid region which has little precipitation that is not enough for crop water requirements. Nowadays, the use of superabsorbent polymers is one of the ways to create sustainable agriculture and increase irrigation efficiency. They can store high water or aqueous solutions in root zone of plants and to reduce negative effects of drought stress. So, improvement of plant growth, increasing of irrigation intervals, reducing water loss and costs of irrigation is due to the application of superabsorbent polymers. Mucilages are also the herbal polysaccharides, soluble in water, and commonly include carbohydrates and can be used as hydrophilic polymers. The aims of this investigation were to study the effects of hydrophilic polymers on water use efficiency, morphological characteristics (dry matter, leaf area, and leaf number, essential oil quantity and yield of basil to harden plant to drought stress and to evaluate its potential to cultivate in arid regions. In addition, taking steps forward towards sustainable agriculture, by reducing the cost of agricultural production, helps protecting the environment. Materials and Methods: This research was conducted as a pot experiment at the department of Horticultural Science‚ college of Agricultural‚ Ferdowsi University of Mashhad‚ Iran, during 2012-2013.The research was set out in a factorial experiment on the basis of completely randomized block design with three replications
Anti-fungal activity of some medicinal plants on different pathogenic fungi
International Nuclear Information System (INIS)
Hussain, F.; Abid, M.; Farzana, A.; Shaukat, S.; Akbar, M.
2015-01-01
The antifungal activity of different medicinal and locally available plants extracts (leaves, fruit, seeds) which are usually found in the surrounding of fields or in the fields on some fungi were tested in lab conditions. Six different plants were selected for testing these plants were Acacia nilotica (Lamk.) Willd. Azadirachta indica (A.) Juss. Crotalaria juncea L. Eucalyptus camaldulensis Dehnh. Ocimum basilicum L. and Prosopis juliflora (Sw.) Dc. These plants showed antifungal activity against the Aspergillus flavus, A. niger, Fusarium solani, Macrophomina phaseolina and Rhizoctonia solani. These plants crude extracts of leaves showed inhibition activity against the fungi and suppressed the myclial growth. Over all selected plants exhibited moderate type of inhibition against these above mentioned pathogens. Among these plants, Azadirachta indica, Ocimum basilicum and Crotalaria juncea showed the most effective results against the Aspergillus, Fusarium and Rhizoctonia sp. of fungal pathogens. Whereas, Acacia nilotica, Eucalyptus camaldulensis and Prosopis juliflora showed least potential of inhibition against all above mentioned fungal pathogens. It is investigated in present studies that Azadirachta indica, Ocimum basilicum and Crotalaria juncea can be utilized against the management of fungal diseases particularly Aspergillus flavus, A. niger, Fusarium solani, Macrophomina phaseolina and Rhizoctonia solani. (author)
Reinforcement Learning with Autonomous Small Unmanned Aerial Vehicles in Cluttered Environments
Tran, Loc; Cross, Charles; Montague, Gilbert; Motter, Mark; Neilan, James; Qualls, Garry; Rothhaar, Paul; Trujillo, Anna; Allen, B. Danette
2015-01-01
We present ongoing work in the Autonomy Incubator at NASA Langley Research Center (LaRC) exploring the efficacy of a data set aggregation approach to reinforcement learning for small unmanned aerial vehicle (sUAV) flight in dense and cluttered environments with reactive obstacle avoidance. The goal is to learn an autonomous flight model using training experiences from a human piloting a sUAV around static obstacles. The training approach uses video data from a forward-facing camera that records the human pilot's flight. Various computer vision based features are extracted from the video relating to edge and gradient information. The recorded human-controlled inputs are used to train an autonomous control model that correlates the extracted feature vector to a yaw command. As part of the reinforcement learning approach, the autonomous control model is iteratively updated with feedback from a human agent who corrects undesired model output. This data driven approach to autonomous obstacle avoidance is explored for simulated forest environments furthering autonomous flight under the tree canopy research. This enables flight in previously inaccessible environments which are of interest to NASA researchers in Earth and Atmospheric sciences.
Medicinal plants used in treatment and management of cancer in Kakamega County, Kenya.
Ochwang'i, Dominic O; Kimwele, Charles N; Oduma, Jemimah A; Gathumbi, Peter K; Mbaria, James M; Kiama, Stephen G
2014-02-12
Traditional medicine plays a critical role in treatment of chronic debilitating and life threatening conditions and diseases. Cancer is one such condition whose therapeutic intervention is commonly through inexpensive traditional herbal remedies. Increasingly industrialised societies are developing drugs and chemotherapeutics from these traditional herbal plants. Plant biogeography determines the abundance and availability of medicinal plants which in turn determine their use by local communities. The present study was carried out in Kakamega County of Kenya to identify and document medicinal plants used for treatment and management of cancer states by communities living adjacent to Kakamega Tropical rainforest of Kakamega County, Kenya. An ethnobotanical survey was done using semi-structured questionnaires administered to 32 randomly selected herbalists from Kakamega County. Sixty five (65) plants of 59 genera and 32 families were identified as candidates in therapeutic intervention against cancer states. Most commonly cited plant species were Spathodea campanulata P. Beauv. ssp. nilotica (Seem), Microglossa pyrifolia (Lam.) Kuntze, Harungana madagascariensis Lam. ex poir, Prunus africana (Hook. f.) kalkman, Cyphostemma serpens (A. Rich), Catharanthus roseus (L.) G. Don and Aloe volkensii Engl. The following were documented for the first time; Aeschynomene abyssinica (A. Rich.) Vatke, Synsepalum cerasiferum (welw.) T. D penn., Albizia coriaria Welw. ex Oliv., Aloe volkensii Engl. Bridelia micrantha (Hochst.) Baill, Croton macrostachyus Delile, Cyphostemma serpens (A. Rich), Dicliptera laxata C.B. Clarke, Ekebergia capensis Sparrm., Gardenia volkensii K. schum. ssp. volkensii, Glycine wightii (wight & Arn.), Ocimum gratissimum Suave, Olea hotcsh spp. hochstetteri, Pavetta abyssinica Fresen., Phyllanthus fischeri Pax, Psydrax schimperiana (A. Rich), Rhus vulgaris Meikle, Senna didymobotyra (Fresen.) Irwin and Barneby, Solanecio nandensis (S. Moore) C. Jeffrey
2009-06-01
Border Initiative SUAV Small Unmanned Aerial Vehicle SAR Synthetic Aperture Radar TTPs Tactics, Techniques, And Procedures TRVS Trailer Remote...2008). 4 3. Overview of Illegal Activities According to the CBP, 178,770 pounds of cocaine, 2,178 pounds of heroin, 2,471,931 pounds of marijuana ...Raytheon Company Web Site) Another component of Predator B is the high- resolution Lynx Synthetic Aperture Radar (SAR). In their study, Tsunoda, et
Abdollahi Mandoulakani, Babak; Eyvazpour, Elham; Ghadimzadeh, Morteza
2017-07-01
Basil (Ocimum basilicum L.), a medicinal plant of the Lamiaceae family, is used in traditional medicine; its essential oil is a rich source of phenylpropanoids. Methylchavicol and methyleugenol are the most important constituents of basil essential oil. Drought stress is proposed to enhance the essential oil composition and expression levels of the genes involved in its biosynthesis. In the current investigation, an experiment based on a completely randomized design (CRD) with three replications was conducted in the greenhouse to study the effect of drought stress on the expression level of four genes involved in the phenylpropanoid biosynthesis pathway in O. basilicum c.v. Keshkeni luvelou. The genes studied were chavicol O-methyl transferase (CVOMT), eugenol O-methyl transferase (EOMT), cinnamate 4-hydroxylase (C4H), 4-coumarate coA ligase (4CL), and cinnamyl alcohol dehydrogenase (CAD). The effect of drought stress on the essential oil compounds and their relationship with the expression levels of the studied genes were also investigated. Plants were subjected to levels of 100%, 75%, and 50% of field capacity (FC) at the 6-8 leaf stage. Essential oil compounds were identified by gas chromatography/mass spectrometry (GC-MS) at flowering stage and the levels of gene expression were determind by real time PCR in plant leaves at the same stage. Results showed that drought stress increased the amount of methylchavicol, methyleugenol, β-Myrcene and α-bergamotene. The maximum amount of these compounds was observed at 50% FC. Real-time PCR analysis revealed that severe drought stress (50% FC) increased the expression level of CVOMT and EOMT by about 6.46 and 46.33 times, respectively, whereas those of CAD relatively remained unchanged. The expression level of 4CL and C4H reduced under drought stress conditions. Our results also demonstrated that changes in the expression levels of CVOMT and EOMT are significantly correlated with methylchavicol (r = 0.94, P ≤ 0
Directory of Open Access Journals (Sweden)
D. Batista-Sánchez
2015-01-01
Full Text Available El uso de bioestimulantes vegetales estimula la emergencia y el crecimiento vegetal debido a que están compuestos por sustancias naturales como carbohidratos, péptidos de bajo peso molecular y aminoácidos, activadores de las funciones fisiológicas de las plantas, por lo que su aplicación permite un mejor aprovechamiento de los nutrientes y representa una opción para enfrentar problemas de estrés abiótico por salinidad. El objetivo de este estudio fue determinar el efecto del bioestimulante FitoMas-E® derivado de la caña de azúcar como atenuante de la salinidad en la emergencia y el crecimiento de plántulas de variedades de albahaca (Ocimum basilicum L. con respuesta diferencial al estrés por salinidad. Tres variedades de albahaca: Napoletano, Emily y Nufar se sometieron a cuatro concentraciones de NaCl (0, 50, 100 y 150 mM y cuatro dosis de FitoMas-E® (0, 0.5, 1.0 y 1.5 mL L-1 en un diseño completamente al azar con arreglo factorial con cuatro repeticiones. El trabajo se desarrolló en una estructura de malla sombra y las variables que se midieron fueron: porcentaje y tasa de emergencia, longitud de radícula, altura de la plántula, biomasa fresca y seca de radícula y de parte aérea. Los resultados evidenciaron que en condiciones de estrés salino (NaCl de moderado a severo, las variables disminuyeron significativamente. Largo de raíz, altura de planta y biomasa seca de raíz en 150 mM de NaCl fueron las más afectadas. Se observó que cuando se aplicó FitoMas-E® las plantas incrementaron significativamente sus valores en las variables, largo de raíz 32% y altura de planta 41%, lo que revela el efecto estimulante del FitoMas-E®, siendo 0.5 mL L-1 la dosis estimulante para la variedad Napoletano y 1.0 mL L-1 para la variedad Emily, aún y cuando se encontraban en condiciones de estrés salino hasta 100 mM de NaCl. Para la concentración de 150 mM se evidenció una afectación extrema para las variedades Emily y Nufar.
Directory of Open Access Journals (Sweden)
Arie F. Blank
2004-03-01
Full Text Available O manjericão (Ocimum basilicum L. pode ser considerado cultura anual ou perene, conforme o local de cultivo. Existem diversas finalidades para seu uso na culinária, como planta ornamental, medicinal e aromática, sendo o seu oleo essencial valorizado no mercado internacional pelo teor de linalol. Caracterizou-se morfológica e agronômicamente, acessos de Ocimum sp. visando a seleção de genótipos com alto rendimento de óleo essencial rico em linalol. O delineamento experimental foi de blocos casualizados, com duas repetições, avaliando 55 genótipos do Banco de Germoplasma de Ocimum da UFS. Avaliou-se a altura de plantas, peso da matéria seca da parte aérea, teor e rendimento de óleo essencial. Observou-se grande diversidade entre os genótipos para todas as variáveis morfológicas e agronômicas avaliadas. Houve grande amplitude entre os genótipos quanto ao teor de óleo essencial, variando de 0,202 a 2,536 ml/100g e para o rendimento de óleo essencial, variando de 1,103 a 21,817 l/ha. Avaliando as variáveis teor e rendimento de óleo essencial de O. basilicum pode-se selecionar os genótipos NSL6421, PI197442, PI358464, PI414194, PI531396 e 'Fino Verde' para o programa de melhoramento genético que visa a obtenção de novas cultivares de manjericão com alto rendimento de óleo essencial rico em linalol.The sweet basil (Ocimum basilicum L., can be an annual or a perennial plant depending on the place where it is grown. This plant has several culinary, ornamental, medicinal and aromatic uses. The value of its essential oil in the international market depends on the percentage of linalool. We characterized the morphologic and agronomic qualities of the Ocimum accessions, to select genotypes with higher yield of essential oil rich in linalool. Experiment design consisted of randomized blocks with two replications, evaluating 55 genotypes of the Germplasm Bank of Ocimum from the Universidade Federal do Sergipe, Brazil. The plant
anti-inflammatory and analgesic activities: chemical constituents of ...
African Journals Online (AJOL)
a
*Corresponding author. E-mail: bedisag@yahoo.fr. ANTI-INFLAMMATORY AND ANALGESIC ACTIVITIES: CHEMICAL CONSTITUENTS OF ESSENTIAL OILS OF OCIMUM GRATISSIMUM,. EUCALYPTUS CITRIODORA AND CYMBOPOGON GIGANTEUS INHIBITED. LIPOXYGENASE L-1 AND CYCLOOXYGENASE OF ...
Clásicos colombianos para la infancia
Directory of Open Access Journals (Sweden)
Carlos Arturo Caparroso
1960-02-01
Full Text Available El pueblecito, sosegadamente recostado en una pendiente de nuestro Ande Oriental, goza de una suave temperatura, fresca, acariciante. Se congregan sus casas, tranquilas y sumisas, en torno a una amplia y generosa plaza. Irregulares callejuelas, lanzadas de los próximos campos, desembocan en ella. La rodean algunos comercios, la iglesia parroquial con su discreta torre, las oficinas de gobierno del municipio, una escuela pública de niños.
986-IJBCS-Article-Dr Niebie Roger
African Journals Online (AJOL)
DR GATSING
basilicum L. sur le rendement d'extraction, la composition chimique de l'huile essentielle et son pouvoir ... parfumerie cosmétique et pesticides (Darrah, ...... Protective effect of basil (Ocimum ... composition and antimicrobial properties.
African Journals Online (AJOL)
home
2014-12-21
Dec 21, 2014 ... Natural plant extracts are promising alternatives for chemical food additives and ... pesticides. ..... Table 2: Determination of antifungal properties of oil extracts by disk .... concentration of sweet basil (Ocimum basilicum), cassia.
Protection of swimming-induced oxidative stress in some vital ...
African Journals Online (AJOL)
Protection of swimming-induced oxidative stress in some vital organs by the treatment of composite extract of Withania somnifera, Ocimum sanctum and Zingiber officinalis in male rat. D Misra, B Maiti, D Ghosh ...
UTILISATION DE POUDRES ET D'EXTRAITS TOTAUX ISSUS DE ...
African Journals Online (AJOL)
AISA
EXTRAITS TOTAUX. ISSUS DE PLANTES LOCALES DES GENRES Ocimum sp. ET Mentha sp. COMME BIOPESTICIDES DANS LA LUTTE. CONTRE Callosobruchus maculatus FAB. F. JOHNSON, B. SERI-KOUASSI, L. R. N. ABOUA, K. FOUA-BI.
Oral acute toxicity study of selected botanical pesticide plants used ...
African Journals Online (AJOL)
aghomotsegin
The widely used plants were identified and selected for biosafety assessments namely: Ocimum ... estimated that hardly 0.1% of the agrochemicals used for .... electric motor. ... amounts of the vehicle substances (distilled water for ethanol and.
Cuba: Multidimensional numerical integration library
Hahn, Thomas
2016-08-01
The Cuba library offers four independent routines for multidimensional numerical integration: Vegas, Suave, Divonne, and Cuhre. The four algorithms work by very different methods, and can integrate vector integrands and have very similar Fortran, C/C++, and Mathematica interfaces. Their invocation is very similar, making it easy to cross-check by substituting one method by another. For further safeguarding, the output is supplemented by a chi-square probability which quantifies the reliability of the error estimate.
new polythiophenes with oligo(oxyethylene) side chains
African Journals Online (AJOL)
USER
1Egerton University, Department of Chemistry, P.O. Box 536, Njoro, Kenya. 2Egerton ... War [13]. However, there is little data available about the chemical characterization of the essentials of the Ocimum .... Institute for Capacity Development).
African Journals Online (AJOL)
-flowering ocimum graveolens methanol extracts, Abstract. KD Mwambete, CM Nshimo, L George. Vol 26, No 2 (2012), A missed case of achalasia in an eight year old girl: a case report, Abstract. F Fredrick, AH Mwanga, LO ...
Research Paper ISSN 0189-6016©2008
African Journals Online (AJOL)
Prof. Adewunmi
) of 13 populations of different silvicultural zones ... The present work reports the antimicrobial activity of the essential oil of Ocimum gratissimum L., and the chemical ..... 'Some Medicinal Forest Plants of Africa and Latin America.' 7. Harjula, H.
Chemical composition and antibacterial activity of essential oils against human pathogenic bacteria
Sokovic, M.; Marin, P.D.; Brkic, D.; Griensven, van L.J.L.D.
2008-01-01
The chemical composition and antibacterial activity of essential oils from 10 aromatic plants Matricaria chamommilla, Mentha piperita, M. spicata, Lavandula angustifolia, Ocimum basilicum, Thymus vulgaris, Origanum vulgare, Salvia officinalis, Citrus limon and C. aurantium have been determined.
Sokovic, M.; Glamoclija, J.; Marin, P.D.; Brkic, D.; Griensven, van L.J.L.D.
2010-01-01
The chemical composition and antibacterial activity of essential oils from 10 commonly consumed herbs: Citrus aurantium, C. limon, Lavandula angustifolia, Matricaria chamomilla, Mentha piperita, M. spicata, Ocimum basilicum, Origanum vulgare, Thymus vulgaris and Salvia officinalis have been
Investigating South African plants as a source of new antimalarial drugs
CSIR Research Space (South Africa)
Pillay, P
2008-10-01
Full Text Available such as Catha edulis (Vahl) Forssk. Ex. Endl. (Celastraceae) and Ocimum americanum L. var. americanum (Lamiaceae), were not previously reported to show antiplasmodial activity. In addition to identifying further species within genera viz. Vernonia...
In vitro comparative effect of extracts of the seeds of Embelia rowlandii
African Journals Online (AJOL)
user2
2012-10-16
Oct 16, 2012 ... This traditional treatment is based on eating the seeds each time one suffers from ... using a grinding machine. The powder was sieved ..... Anthelmintic activity of essential oil of Ocimum gratissimum L. and euguenol against ...
Directory of Open Access Journals (Sweden)
JF Sanchez-Suarez
2013-03-01
Full Text Available Background: The leishmanicidal and cytotoxic activity of ten essential oils obtained from ten plant specimens were evaluated.Methods: Essential oils were obtained by the steam distillation of plant leaves without any prior processing. Cytotoxicity was tested on J774 macrophages and leishmanicidal activity was assessed against four species of Leishmania associated with cutaneous leishmaniasis. Results: Seven essential oils exhibited activity against Leishmania parasites, five of which were toxic against J774 macrophages. Selectivity indices of >6 and 13 were calculated for the essential oils of Ocimum basilicum and Origanum vulgare, respectively.Conclusion: The essential oil of Ocimum basilicum was active against promastigotes of Leishmania and innocuous to J774 macrophages at concentrations up to 1600 µg/mL and should be further investigated for leishmanicidal activity in others in vitro and in vivo experimental models.
African Journals Online (AJOL)
PUBLICATIONS1
the African and South-East Asian regions. (WHO, 2014). © 2016 Kwame ... nins and glycosides, volatile oils, proteins and amino acids and terpernoids. In view of the effi- .... Preparation and extraction of crude extracts. The leaves of Ocimum ...
Directory of Open Access Journals (Sweden)
Flavio Massone
1990-12-01
caracterizar-se por valores maiores de freqüência respiratória que os demais grupos. As três técnicas anestésicas mostraram-se satisfatórias, pela estabilidade de parâmetros fisiológicos e indução e recuperação suaves, sendo que a associação da levomepromazina com o flunitrazepan ou midazolam proporcionou prostração mais eficaz, bem como maior miorrelaxamento, sedação e hipoalgesia.
Dinámica de una ecuación de reacción-difusión con discontinuidades
Arrieta Algarra, José María; Rodríguez Bernal, Aníbal; Valero Cuadra, José
2007-01-01
Estudiamos la dinámica de una ecuación de reacción difusión que presenta una discontinuidad. En primer lugar probamos la semicontinuidad superior del atractor con respecto a aproximaciones suaves del término no lineal. Después damos una descripción precisa del conjunto de puntos fijos y su estabilidad. Finalmente, analizamos las posibles conexiones heteroclínicas entre los puntos fijos, obteniendo así información sobre la estructura del atractor.
Directory of Open Access Journals (Sweden)
Kweka Eliningaya J
2012-09-01
Full Text Available Abstract Background The reduction of malaria parasite transmission by preventing human-vector contact is critical in lowering disease transmission and its outcomes. This underscores the need for effective and long lasting arthropod/insect repellents. Despite the reduction in malaria transmission and outcomes in Tanzania, personal protection against mosquito bites is still not well investigated. This study sought to determine the efficacy of menthol propylene glycol carbonate (MR08, Ocimum suave as compared to the gold standard repellent N, N-diethyl-methylbenzamide (DEET, either as a single dose or in combination (blend, both in the laboratory and in the field against Anopheles gambiae s.l and Culex quinquefasciatus. Methods In the laboratory evaluations, repellents were applied on one arm while the other arm of the same individual was treated with a base cream. Each arm was separately exposed in cages with unfed female mosquitoes. Repellents were evaluated either as a single dose or as a blend. Efficacy of each repellent was determined by the number of mosquitoes that landed and fed on treated arms as compared to the control or among them. In the field, evaluations were performed by human landing catches at hourly intervals from 18:00 hr to 01:00 hr. Results A total of 2,442 mosquitoes were collected during field evaluations, of which 2,376 (97.30% were An. gambiae s.l while 66 (2.70% were Cx. quinquefaciatus. MR08 and DEET had comparatively similar protective efficacy ranging from 92% to 100 for both single compound and blends. These findings indicate that MR08 has a similar protective efficacy as DEET for personal protection outside bed nets when used singly and in blends. Because of the personal protection provided by MR08, DEET and blends as topical applicants in laboratory and field situations, these findings suggest that, these repellents could be used efficiently in the community to complement existing tools. Overall, Cx
Chemical composition, antioxidant effects and antimicrobial ...
African Journals Online (AJOL)
Thymus vulgaris, Cinnamomum zeylanicum and Ocimum gratissimum are spices widely used as aroma enhancers and food preservatives. This work assessed the chemical composition, antioxidant and antimicrobial effect of their essential oils on some food pathogenic bacteria, namely, Staphylococcus aureus, Citrobacter ...
Sokovic, M.; Griensven, van L.J.L.D.
2006-01-01
Essential oils of Matricaria chamommilla, Mentha piperita, M. spicata, Lavandula angusti folia, Ocimum basilicum, Thymus vulgaris, Origanum vulgare, Salvia officinalis, Citrus limon and C. aurantium and their components; linalyl acetate, linalool, limonene, ¿-pinene, ß-pinene, 1,8-cineole, camphor,
African Journals Online (AJOL)
Conclusion: This study showed initial evidence of the use of plant materials by ..... Ocimum gratissimum L. Esrou,Deveti. 1197FDS/UL /3892. FDS/UL. 0,04. WP ..... properties of plant extracts have been widely shown in several studies(Kim et ...
Directory of Open Access Journals (Sweden)
Bagora Bayala
Full Text Available This research highlights the chemical composition, antioxidant, anti-inflammatory and anti-proliferative activities of essential oils from leaves of Ocimum basilicum, Ocimum americanum, Hyptis spicigera, Lippia multiflora, Ageratum conyzoides, Eucalyptus camaldulensis and Zingiber officinale. Essential oils were analyzed by gas chromatography-mass spectrometry and gas chromatography-flame ionization detector. Major constituents were α-terpineol (59.78% and β-caryophyllene (10.54% for Ocimum basilicum; 1, 8-cineol (31.22%, camphor (12.730%, α-pinene (6.87% and trans α-bergamotene (5.32% for Ocimum americanum; β-caryophyllene (21%, α-pinene (20.11%, sabinene (10.26%, β-pinene (9.22% and α-phellandrene (7.03% for Hyptis spicigera; p-cymene (25.27%, β-caryophyllene (12.70%, thymol (11.88, γ-terpinene (9.17% and thymyle acetate (7.64% for Lippia multiflora; precocene (82.10%for Ageratum conyzoides; eucalyptol (59.55%, α-pinene (9.17% and limonene (8.76% for Eucalyptus camaldulensis; arcurcumene (16.67%, camphene (12.70%, zingiberene (8.40%, β-bisabolene (7.83% and β-sesquiphellandrène (5.34% for Zingiber officinale. Antioxidant activities were examined using 1,1-diphenyl-2-picryl-hydrazyl (DPPH and 2,2'-azinobis-(3-ethylbenzothiazoline-6-sulfonic acid (ABTS methods. O. basilicum and L. multiflora exhibited the highest antioxidant activity in DPPH and ABTS tests, respectively. Anti-inflammatory properties were evaluated by measuring the inhibition of lipoxygenase activity and essential oil of Z. officinale was the most active. Anti-proliferative effect was assayed by the measurement of MTT on LNCaP and PC-3 prostate cancer cell lines, and SF-763 and SF-767 glioblastoma cell lines. Essential oils from A. conyzoides and L. multiflora were the most active on LNCaP and PC-3 cell lines, respectively. The SF-767 glioblastoma cell line was the most sensitive to O. basilicum and L. multiflora EOs while essential oil of A. conyzoides showed the
Research Paper ISSN 0189-6016©2008
African Journals Online (AJOL)
AJTCAM
inflammatory, antitumor and antioxidant properties (Sharada et al., 1996; Bhattacharya et al., ... Withaferin-A (WA) was extracted and isolated from commercially available Withania somnifera root ..... Chemomodulatory efficacy of Basil leaf (Ocimum ... In vitro human phase I metabolism of xenobiotics I: pesticides and related.
Inhibition of conidial germination and mycelial growth of ...
African Journals Online (AJOL)
Twenty-one plants were screened for fungicidal effects on conidial germination and mycelial growth of Corynespora cassiicola. Out of this, 5 plants (Ageratum conyzoides, Centrosema pubescene, Emilia coccinea, Ocimum basilicum and Solanum torvum) were selected for evaluation of concentration effects. Treatment in O.
Effect of Processing on the Elemental Composition of Selected Leafy ...
African Journals Online (AJOL)
The elemental composition of leaves of Vernonia amygdalina, Gnetum africana, Gongronema latifolium and Ocimum gratissimum subjected to different processing methods were investigated. Processing methods employed include oven drying, sun drying, fresh milling, steaming and a combination of these while the mineral ...
Antifungal Activities of Some Leaf Extracts on Seed-borne Fungi of ...
African Journals Online (AJOL)
The efficacy of leaf extracts of basil (Ocimum basilicum), bitter leaf (Vernonia amygdalina), lemon grass (Cymbopogen citratus), neem (Azadirachta indica) and paw-paw (Carica papaya) on major seed-borne fungi: Aspergillus niger, Aspergillus flavus, Botryodiplodia theobromae and Fusarium moniliforme of African yam ...
DEFF Research Database (Denmark)
Tetens, Inge
for hydroxyanthracene derivatives, of Althaea officinalis L., of Rosa centifolia L., of Ocimum basilicum L., of Coriandrum sativum L., dried juice of Cynara scolymus L. standardised for cynarine, Saccharomyces cerevisiae subsp. cerevisiae UVAFERM SC, Bifidobacterium longum R0175 and Lactobacillus helveticus R0052...
Diseño numérico de tablestacas en la costa pacífica de Costa Rica
Murillo B., L.
2015-01-01
Tablestacas, pilotes sumergidos o parcialmente sumergidos, con carga vertical u horizontal son elementos de común uso en las estructuras construidas en lagos, ríos, marinas, puertos y demás facilidades costeras. Comúnmente se construyen de cemento, madera y otros materiales de mayor fortaleza como el acero. Por su precio, durabilidad y economía, muchas veces se prefiere madera tratada a presión con creosota o sulfato de cobre. La toma de muestras geotécnicas en suelos suaves sumergidos se rea...
Directory of Open Access Journals (Sweden)
Larissa Corrêa do Bomfim Costa
2008-11-01
Full Text Available A prática da adubação orgânica, além de fornecer nutrientes para as plantas, proporciona a melhoria da estrutura física do solo, aumenta a retenção de água, diminui as perdas por erosão e favorece o controle biológico. O elixir paregórico (Ocimum selloi Benth. é uma espécie medicinal nativa das regiões Sul e Sudeste do Brasil onde é utilizada popularmente como antidiarréico, antiespasmódico e antiinflamatório. Este trabalho teve como objetivo verificar o efeito de diferentes doses de dois adubos orgânicos no crescimento, no rendimento e na composição do óleo essencial de elixir paregórico. Os experimentos foram conduzidos em Lavras, MG, em estufa plástica com os seguintes tratamentos de adubação: ensaio A - esterco bovino: 1 sem adubação (controle; 2 solo + 3kg m-2 de esterco; 3 solo+ 6kg m-2 de esterco; 4 solo+ 9kg m-2 de esterco; 5 solo + 12kg m-2 de esterco; ensaio B - Esterco avícola: 1 sem adubação (controle; 2 solo + 1,5kg m-2 de esterco; 3 solo + 3kg m-2 de esterco; 4 solo + 4,5kg m-2 de esterco e 5 solo + 6kg m-2 de esterco. Foi verificada a influência das doses de adubação com esterco bovino e galinha sobre o crescimento da planta em altura e diâmetro do caule, acúmulo de biomassa seca, AF, AFE, RPF, teor de clorofilas, espessura do limbo foliar, rendimento e composição química do óleo essencial.The organic fertilization provides nutrients for the plants, improves the soil physical structure, increases the water retention, reduces the erosion losses and favors the biological control. Ocimum selloi is a native medicinal plant of south and southeast of Brazil where is used popularly as antidiarrhetic, antispasmodic and anti-inflammatory. This research aimed to verify the effect of different doses of two organic fertilizers souces in O. selloi growth, essential oil yield and chemical composition. The experiments were carried out in Lavras, MG, with pots in polyethylene greenhouse with two manuring
Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran
International Nuclear Information System (INIS)
Alasvand Zarasvand, M.; Maleki, A.
2009-01-01
The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)
Antimicrobial and Antioxidant Activities of the Essential Oils of Some ...
African Journals Online (AJOL)
Purpose: To determine the antimicrobial and antioxidant activities of Pulicaria inuloides and Ocimum forskolei essential oils. Methods: Steam distillation of the aerial parts of P. inuloides and O. forskolei was performed using a Clevenger apparatus. Essential oils were analyzed by gas chromatography–mass spectrometry.
Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran
Energy Technology Data Exchange (ETDEWEB)
Alasvand Zarasvand, M; Maleki, A
2009-07-01
The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)
Vascular permeability-increasing effect of the leaf essential oil of ...
African Journals Online (AJOL)
African Journal of Traditional, Complementary and Alternative Medicines ... Analysis of the differences in vascular permeability between treatment groups showed that, Ocimum oil, in intensity and duration, was significantly (p < 0.05) more effective in increasing cutaneous capillary permeability over a 24h period after ...
Bioactivity of essential oils from medicinal plants of Cameroon and ...
African Journals Online (AJOL)
The EOs of Eucalyptus globulus, Cymbopogon citratus, Xylopia aethiopica, Thymus vulgaris, Ocimum canum, Cananga odorata, Citrus medica, Citrus paradisi and Citrus reticulata were screened against the most incriminated bacterial species using the spot-on-agar test and microdilution methods. Some of the EOs with ...
The molluscicidal effects of extracts of Capsicum annuum (Sweet ...
African Journals Online (AJOL)
Extracts of sweet pepper (Capsicum annum), black pepper (Piper nigrum) and scent leaves (Ocimum basilicum) were introduced to fresh water snail samples, the intermediate hosts of schistosomiasis, to test their molluscicidal effects. The materials were extracted using soxhlet extraction. Black pepper (Piper nigrum) was ...
Elevation of serum pancreatic amylase and distortion of pancreatic ...
African Journals Online (AJOL)
Background: Diabetes mellitus has been shown to cause severe impairment in exocrine pancreatic function and cyto-architecture. Ocimum grattissimum has been reported to lower blood glucose levels in experimental diabetic animals. This study, therefore, aims to investigate if treatment with O. grattissimum can alleviate ...
Directory of Open Access Journals (Sweden)
Renato Ramos-Palacios
2012-09-01
Full Text Available Hardwood and softwood cuttings of Buddleja cordata HBK, Dodonaea viscosa Jacq and Senecio praecox D.C. were tested to know their ability to form adventitious roots. Cuttings were prepared in 2 different seasons (wet and dry and treated with different microclimatic conditions and auxin concentrations (IBA and NAA. Hardwood and softwood cuttings of B. cordata rooted during the dry and wet season, whilst hardwood and softwood cuttings of D. viscosa rooted only in the wet season, cuttings of S. praecox rooted only in wet season with a higher rooting for hardwood than softwood cuttings. Low hormone concentrations (10 - 100 ppm favored the rooting percentage more than high concentrations (1000 - 10 000 ppm. However, high hormone concentrations favored number, length of roots and number of developed shoots. Natural regeneration of these species is limited and the species are difficult to propagate from seeds. Vegetative propagation of these species could be an alternative to get clonal planting stock for reforestation programs in some Mexico City areas.Se probó la habilidad de estacas lignificadas y suaves de Buddleja cordata HBK, Dodonaea viscosa Jacq y Senecio praecox D.C. para formar raíces adventicias. Las estacas se prepararon en las estaciones húmeda y seca; se trataron con diferentes concentraciones de auxinas (IBA y NAA y en diferentes condiciones microclimáticas. Las estacas de madera lignificadas y madera suave de B. cordata enraizaron durante la estación seca y húmeda, mientras que las de D. viscosa lo hicieron sólo en la época húmeda, las estacas de S. praecox sólo en la estación seca teniendo las estacas lignificadas un mayor enraizamiento que las de madera suave. Las concentraciones bajas de hormonas (10 - 100 ppm favorecieron más el porcentaje de enraizamiento que las altas concentraciones (1000 - 10 000 ppm. . Sin embargo, las concentraciones altas de hormonas favorecieron el número y la longitud de las raíces, además del
Directory of Open Access Journals (Sweden)
E. Levin
2016-06-01
Full Text Available Significant efforts are invested by rescue agencies worldwide to save human lives during natural and man-made emergency situations including those that happen in wilderness locations. These emergency situations include but not limited to: accidents with alpinists, mountainous skiers, people hiking and lost in remote areas. Sometimes in a rescue operation hundreds of first responders are involved to save a single human life. There are two critical issues where geospatial imaging can be a very useful asset in rescue operations support: 1 human detection and 2 confirming a fact that detected a human being is alive. International group of researchers from the Unites States and Poland collaborated on a pilot research project devoted to identify a feasibility of use for the human detection and alive-human state confirmation small unmanned aerial vehicles (SUAVs and inexpensive forward looking infrared (FLIR sensors. Equipment price for both research teams was below $8,000 including 3DR quadrotor UAV and Lepton longwave infrared (LWIR imager which costs around $250 (for the US team; DJI Inspire 1 UAS with commercial Tamarisc-320 thermal camera (for the Polish team. Specifically both collaborating groups performed independent experiments in the USA and Poland and shared imaging data of on the ground and airborne electro-optical and FLIR sensor imaging collected. In these experiments dead bodies were emulated by use of medical training dummies. Real humans were placed nearby as live human subjects. Electro-optical imagery was used for the research in optimal human detection algorithms. Furthermore, given the fact that a dead human body after several hours has a temperature of the surrounding environment our experiments were challenged by the SUAS data optimization, i.e., distance from SUAV to object so that the FLIR sensor is still capable to distinguish temperature differences between a dummy and a real human. Our experiments indicated feasibility of
Directory of Open Access Journals (Sweden)
L.B.S. OLIVEIRA
Full Text Available RESUMO A espécie Ocimum gratissimum (Linn., popularmente conhecida como alfavaca-cravo, é muito utilizada na medicina popular. A planta apresenta inúmeros compostos, sendo o eugenol o constituinte majoritário do seu óleo essencial e o provável responsável pela sua atividade antimicrobiana. O objetivo deste estudo foi determinar o potencial antifúngico e o possível mecanismo de ação do óleo essencial extraído das folhas de O. gratissimum L. (OEOg sobre cepas-padrão de Candida. Para avaliação da atividade antimicrobiana foi determinada a Concentração Inibitória Mínima (CIM, o efeito do tempo de exposição, o efeito modulador na atividade de antifúngicos (ATF de uso clínico e a ação do OEOg nas fases de crescimento exponencial e estacionário de leveduras do gênero Candida. O mecanismo de ação do OEOg foi verificado por captação do cristal violeta e avaliação da morfologia microbiana pela técnica de microcultivo. Também foi avaliada a toxicidade do OEOg sobre hemácias humanas. O OEOg apresentou boa atividade antifúngica sobre cepas de Candida, sendo capaz de reduzir a taxa de crescimento das cepas de Candida a partir de quatro horas de exposição, além de ter modulado positivamente a atividade do cetoconazol para C. tropicalis ATCC 13803 e reduzir o número de células viáveis em todas as fases de crescimento microbiano. O OEOg foi capaz de promover o aumento discreto da captação do cristal violeta e provocou alterações na micromorfologia das células de Candida spp., sugerindo que seu alvo de ação seja o envoltório celular. Observou-se baixa toxicidade do OEOg sobre hemácias humanas. Os resultados encontrados mostraram que o OEOg possui boa atividade sobre o gênero Candida, com mecanismo de ação mediado possivelmente pela ocorrência de danos no envoltório celular, além de ter sido observada baixa toxicidade, indicando do OEOg é promissor no desenvolvimento e elaboração de um novo fármaco com
Directory of Open Access Journals (Sweden)
M. Jahan
2016-02-01
Full Text Available Introduction: Basil (Ocimum basilicum L. is an annual herbaceous plant that belongs to lamiaceae family. This plant is native of India country and other countries in south of Asia. Nowadays, the use of water superabsorbent polymers is increased in agriculture and their role in reducing the drought stress and increasing the crops production has been demonstrated in many researches. Superabsorbent polymers can absorb lots of water and keep it in their structure and give it to plant under drought stress conditions (9. Humic substances are a group of heterogeneous molecules that are bonded together by weak forces, therefore they have high chemical stability. Humic acid comprise 65 to 80 percent of total soil organic matter (6. According to medicinal importance of Basil and its roles in the food and pharmaceutical industries, beside the limited water resources and need to increase water use efficiency through using ecological inputs, this study designed and conducted aimed to evaluate agroecological characteristics of Basil as affected by application of water-saving superabsorbent and humic acid under irrigation intervals. Materials and Methods: In order to evaluate the effects of different amounts of water-saving superabsorbent and foliar application of humic acid and irrigation intervals on some quantitative characteristics of basil (Ocimum basilicum L., a split strip plot experiment was conducted based on RCBD design with three replications at The Research Farm of Ferdowsi University of Mashhad, Iran during growing season of 2012-13. Experimental factors included three levels of water-saving superabsorbent (0, 40 and 80 kg ha-1 as the main plot factor, two levels of humic acid (0 and 3 kg ha-1 as the sub plot factor and two levels of irrigation interval (5 and 10 days as the strip plot factor. Studied traits were seed number and weight per plant, plant height, number of lateral branches per plant, seed yield, biological yield and harvest index
African Journals Online (AJOL)
Wonang, DL. Vol 2, No 3 (2006) - Articles Studies on the antibacterial activities of Ocimum basilicum and Psidium guajava. Abstract · Vol 2, No 3 (2006) - Articles Phytochemical, toxicological and histo-pathological studies of some medicinal plants in Nigeria Abstract. ISSN: 0794-4713. AJOL African Journals Online.
Application for the post of Lecturer in Zoology for FDP Vacancy
African Journals Online (AJOL)
om
2013-11-13
Nov 13, 2013 ... Preliminary screening of plant essential oils against larvae of Culex ... parts of India especially in Kerala, Mysore, Tamil Nadu, ... phytochemicals which are widely used as alternatives to synthetic ... oils against mosquitoes as growth inhibitors and/or ... toxicity and mosquito repellency of Ocimum selloi oil.
African Journals Online (AJOL)
Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) protect against sodium arsenite-induced hepatotoxicity in Wistar rats. Abstract PDF · Vol 29, No 1 (2014) - Articles Hepatoprotective and anticlastogenic effects of ethanol extract of Irvingia gabonensis (IG) leaves in sodium arsenite-induced toxicity in ...
African Journals Online (AJOL)
Femi Olorunniji
2013-08-20
Aug 20, 2013 ... Poloniae Pharmaceutica 68: 541−547. Ejele AE, Duru IA, Oze RN, Iwu IC and Ogukwe CE (2012). Comparison of antimicrobial potential of Piper umbellatum,. Piper guineense, Ocimum gratissimum andNewbouldia laevis extracts. International Research Journal of. Biochemistry and Bioinformatics 2: 36−40.
Oxygen amendment on growth and nitrogen-use efficiency of flooded Italian Basil
Flooding is a frequent and often unavoidable cause of stress, in vegetable production in Florida. Flooding results in hypoxia i.e., oxygen deficiency. This study was conducted with traditional Italian basil (Ocimum basilicum L.), cv. Genovese OG, treated with either a fast- or slow-release solid oxy...
Toxicity of essential oil compounds against Exorista sorbillans ...
African Journals Online (AJOL)
Essential oils of Ageratum conyzoides and Ocimum species are potential candidates for management of Exorista sorbillans (Wiedemann) (Diptera: Culicidae), a serious pest of silkworm. Considering that the pure compounds in essential oil may exhibit efficacy against the parasitoid, contact and topical toxicity of 22 essential ...
Adaptación de dos piezas distintas a una pieza bi-materia
Gómez Acevedo, Rocío
2014-01-01
El presente proyecto se ha realizado en la empresa Faurecia Automotive Exteriors [Anexo-A], para la pieza llamada Spoiler del proyecto parachoques delantero A05GPPOLO del grupo Volkswagen (VW). Dicho proyecto se enfoca en la adaptación de dos piezas compuestas por polímeros diferentes en una única pieza bi-materia, utilizando la técnica de inyección multi-componente. Se ha partido de un estudio teórico previo sobre la posible compatibilidad entre la unión rígido-suave de los mater...
A Estação do Neolítico Antigo do Carrascal (Oeiras, Lisboa, Portugal)
Cardoso, João Luís
2015-01-01
Apresentam‑‑se os resultados preliminares da intervenção arqueológica realizada no Carrascal entre 2003 e 2005 em local implantado em encosta de declive suave do vale da ribeira de Barcarena (concelho de Oeiras, distrito de Lisboa) e a cerca de 3 km de distância da margem norte do estuário do Tejo, nas proximidades de enseada, formada no sopé da encosta, a qual proporcionava importante actividade recolectora, destacando‑‑se a ostra (Ostrea edulis). A indústria de pedra lascada evidencia fabri...
Coppoletta, Susana
2011-01-01
Su trabajo contemporáneo se caracteriza por la armonía del color y de la forma, como también por la conjunción de distintas texturas que le dan fuerza a la obra. Desde los suaves matices hasta los extremos contrastes hacen gala de fuerte carácter de la muestra. Sus arcos y curvas cortan el espacio en ángulos mientras surgen volúmenes texturados y coloridos campos. Su geometría es amplia y plena de gestos en su separación de planos, estableciendo una pro...
Magnetares y su posible relación con las estrellas de quarks
Orsaria, M.
2011-01-01
En el Universo existen estrellas estables que poseen campos magnéticos intensos, mayores que 10(13) Gauss en su superficie, que se denominan Magnetares. Estos objetos podrían explicar las observaciones astrofísicas de emisiones peculiares de cierta clase de pulsares, como los Pulsares Anómalos de Rayos X o los Repetidores de Rayos Gamma Suaves. En este artículo, se presentan las dos principales hipótesis para explicar la intensidad del campo magnético en las Magnetares y se discute la posibil...
Estructura y propiedades de los suavizantes textiles de organosiloxano(silicona).
Carrión Fité, Francisco Javier; Serra Gasol, Miguel
1997-01-01
En este trabajo se describe la evolución de las estructuras químicas de los compuestos de organopolisiloxanos utilizados para proporcionar suavidad a los artículos textiles así como su influencia en el aumento de sus propiedades. Se recalca que en la actualidad se dispone de unos agentes suavizantesr principalmente del tipo de aminosiliconas,que proporcionan un tacto muy suave a los artículos de algodón y sus mezclas, así como de otros beneficios en sus propiedades mecánicas. También se menci...
Molecular genetic studies on some irradiated medicinal plants
Energy Technology Data Exchange (ETDEWEB)
Alam el-din, H.F.M
2007-07-01
This thesis aimed to study the molecular characterization , the phylogenetic relationships among the four mentha and the three ocimum species and to get some species-specific markers. twenty-one RAPD and 10 ISSR primers were used which showed high polymorphism among the species and detected 150 molecular markers for these genotypes (100 using RAPD and 50 by ISSR-analyses). detection of the phylogenetic relationships based on the three studied systems (RAPD,ISSR and their combined analyses ) indicated that these techniques succeeded in separating the seven species into two main clusters of the two mentha and ocimum genera. SDS-protein patterns characterized the seven genotypes based on presence/ absence and staining intensities of 14 polypeptide bands into two main groups.the effect of four doses of gamma irradiation on eight active components of volatile oils and SDS-protein pattern of stems of mentha viridis indicated that low levels of gamma irradiation could improve the value of some active components of medicinal plants such as menthol in mentha viridis.
Premilinary Studies on Phytochemical Screening of Ulam and Fruit from Malaysia
Directory of Open Access Journals (Sweden)
Liliwirianis N.
2011-01-01
Full Text Available Alkaloids, saponins, steroid, terpenoid, flavonoids, phenolic distribution in 14 Malaysian favourite ulam and fruit belonging to different families were assessed and compared. The plants investigated were parkia speciosa (petai, solanum torvum (terung pipit, pithecellobium bubalinum (kerdas, moringa oleifera (kacang kelor, dryobalanops oblongifolia (keladan, cosmos caudatus (ulam raja, mentha arvensis (pudina, ocimum sp. (selasih, cymbopogon nardus (serai wangi, eugenia polyantha (serai kayu, Barringtonia scortechinii, (Putat, musa sp. (pisang, talinum paniculatum (akar som and phyllanthus acidus (cermai. Moringa oleifera leaf and dryobalanops oblongifolia fruit were found contain positive reactions of alkaloids. All the samples studied also show high content of saponin except in bark and seed of parkia speciosa and stem of phyllanthus acidus. Meanwhile, results of the phytochemical screening on saponins, steroids, terpenoids, phenolic and flavonoids showed that cosmos caudatus, ocimum sp., mentha arvensis, barringtonia scortechinii and moringa oleifera were the active compounds present in the leaves of the plant.
African Journals Online (AJOL)
Herb yield and chemical composition of basil (Ocimum basilicum L) essential oil in relation to the different harvest period and cultivation conditions. Abstract PDF · Vol 13, No 2 (2016) - Articles Relationship between total phenolic, total flavonoid and oleuropein in different aged olive (Olea europaea l.) Cultivar leaves
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
Protection of swimming-induced oxidative stress in some vital organs by the treatment of composite extract of Withania somnifera, Ocimum sanctum and Zingiber officinalis in male rat · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Misra, B Maiti, D Ghosh.
Characterization of Peronospora belbahrii on basil under light and scanning electron microscopy
Basil (Ocimum spp.) downy mildew caused by Peronsoora belbahrii is a major yield-limiting disease of sweet basil (O. basilicum) production worldwide. In this study, sweet basil was grown in a soilless potting mix in plant growth chambers and inoculated with sporangia of P. belbahrii harvested from p...
Effect of Some Plant Extracts on the Microbial Spoilage of Cajanus ...
African Journals Online (AJOL)
The effect of ethanolic extracts of seven plant sources on the microbial spoilage of Cajanus cajan extract was investigated. The results showed that the extracts obtained from Aloe vera, bitter leaf, Gultiferae (garcinia or bitter kola), Ocimum gratissimum (scent leaf) and Zingiber officialae (ginger) were effective against ...
Biological activities of four essential oils against Anopheles gambiae ...
African Journals Online (AJOL)
The control of malaria is still a challenge partly due to mosquito's resistance to current available insecticides. The aim of this work was to evaluate the ovicidal, larvicidal and repellent activities of Lantana camara, Hyptis suaveolens, Hyptis spicigera and Ocimum canum essential oils against Anopheles gambiae s.l. ...
African Journals Online (AJOL)
Seri-Kouassi, B. Vol 18, No 3 (2006) - Articles Utilisation de poudres et d\\'extraits totaux issus de plantes locales des genres Ocimum sp. et Mentha sp. comme biopesticides dans la lutte contre Callosobruchus maculatus FAB Abstract PDF. ISSN: 1015-2288. AJOL African Journals Online. HOW TO USE AJOL.
Antifungal Effects Of Botanical Leaf Extracts On Tuber Rots Of Yam ...
African Journals Online (AJOL)
The fungicidal effects of dry and fresh leaf extracts of Axardirachta indica (L) and Ocimum grattissimum on the rot of yam tubers were investigated. Fusaruim oxysporium, Rhjzopus stolonifer, Botryodiplodia theobromae and Aspergillus Niger (root pathogens) were isolated from the rotted yam. Both dry and fresh leaf extracts ...
African Journals Online (AJOL)
Okwori, AEJ. Vol 5, No 22 (2006) - Articles The antimicrobial properties of Ocimum gratissimumextracts on some selected bacterial gastrointestinal isolates. Abstract PDF · Vol 6, No 8 (2007) - Articles The prevalence of pathogenic Yersinia enterocolitica among diarrhea patients in Jos, Nigeria Abstract PDF · Vol 6, No 20 ...
African Journals Online (AJOL)
SECRETARIAT
Furthermore, the application of mancozeb, or the essential oil of Ocimum gratissimum on tomato plants inoculated reduced the ... the dry foliar biomass by more than 40 % for the Tropimech cultivar, the most sensitive tomato variety to Forl. Key words : Antifungal ..... Melaleuca alternifolia (tea tree) oil. J. Appl. Microbiol.
Suave fracasso: a política macroeconômica brasileira entre 1999 e 2005
Directory of Open Access Journals (Sweden)
Marcos Antonio Macedo Cintra
2005-11-01
Full Text Available O artigo procura demonstrar que o modelo macroeconômico brasileiro tem sido capaz de produzir ciclos econômicos que acompanham os movimentos de expansão e retração da liquidez e do comércio mundiais, mas não tem conseguido recolocar o país no caminho do desenvolvimento econômico e social. Sustenta-se que as políticas cambial, monetária e fiscal são contraditórias e concorrem para bloquear o crescimento sustentado, a resolu��ão dos pontos de estrangulamento na infra-estrutura e a expansão do gasto social.This article supports the thesis that the Brazilian macroeconomic model has proven to be capable of creating economic cycles, which follow expansion and retraction movements of liquidity and world trade. However, it has not been able to bring back the country to the economic and social development pathway. The exchange, monetary and fiscal policies are contradictory and contribute to obstruct a sustained growth, the tackling of infrastructure constraints, and the expansion of social expenditure.
Directory of Open Access Journals (Sweden)
Amner Muñoz-Acevedo
2009-12-01
Full Text Available Se determinó por cromatografía de gases acoplada a espectrometría de masas (GC-MS la composición química de aceites esenciales (AE, aislados por hidrodestilación asistida por la radiación de microondas (MWHD, de las especies vegetales aromáticas Artemisia dracunculus, Foeniculum vulgare, Illicium verum, Lippia micromera, Lippia origanoides, Ocimum spp., Plectranthus amboinicus, Tagetes filifolia, Tagetes lucida y Thymus vulgaris. Los valores de capacidades antioxidantes in vitro de estos aceites esenciales, se obtuvieron usando los ensayos de decoloración del catión-radical ABTS+• (metodologías convencional y con dilución en microplacas y la oxidación del ácido linoleico, inducida por O2 y Fe+2. El potencial inhibitorio de ABTS+• fue más alto para los aceites esenciales que contienen fenoles (carvacrol y timol, que para los aceites esenciales ricos en éteres (trans-anetol y estragol. La actividad antioxidante mediante el ensayo ABTS+• modificado en orden decreciente fue: AE Plectranthus amboinicus ≥ AE Lippia origanoides >> AE Thymus vulgaris > AE Lippia micromera >>> AE Tagetes lucida (flores > AE Ocimum sp. > AE Tagetes lucida (hojas > AE Illicium verum > AE Tagetes filifolia (Cenivam > AE Foeniculum vulgare. Salud UIS 2009; 41: 287-294Gas chromatography coupled to mass spectrometry (GC-MS was used to determine the chemical composition of essential oils (EO isolated by microwave-radiation-assisted hydrodistillation (MWHD of Artemisia dracunculus, Foeniculum vulgare, Illicium verum, Lippia micromera, Lippia origanoides, Ocimum sp., Plectranthus amboinicus, Tagetes filifolia, Tagetes lucida and Thymus vulgaris. in vitro antioxidant capacity values using ABTS+• discoloration assays (traditional and microplate methods and the linoleic acid oxidation (with O2 and Fe+2 of these essential oils were obtained. Essential oils with phenols (carvacrol and thymol high content showed higher total antioxidant capacity values than
Leaf storage conditions and genomic DNA isolation efficiency in ...
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... Storage of plant tissues for DNA is important to avoid degradation of DNA. Preliminary studies were conducted on Ocimum gratissimum L. in order to establish the storage conditions for the collected samples before DNA extraction. Secondly, the aim was to determine the best protocol for the extraction.
Evaluating the ethyl-acetate fraction of crude methanol leaf extract of ...
African Journals Online (AJOL)
Ointment formulations of the ethyl acetate fraction of the crude methanol leaf extract of Ocimum gratissimum was in this study evaluated for wound healing activities in rat using the excision wound model. The air-dried and pulversied leaves were extracted with methanol in a Soxhlet extraction apparatus to obtain the ...
African Journals Online (AJOL)
DR. AMINU
2013-12-02
Dec 2, 2013 ... Ocimum gratisssimum leaves were tested against some pathogenic bacteria known to cause diaorrhoea ... gratisssimum, it is therefore conceivable that it should be used to treat cases of diarrhea caused by the test organisms. Keywords: ... The use of medicinal plants in the treatment of diseases has been ...
Rice weevil response to basil oil fumigation
Basil oil, Ocimum basilicum L., is a volatile plant essential oil that is known to have insecticidal activity against stored product pests such as rice weevil, Sitophilus oryzae (L.). Basil oil was diluted in acetone and applied to a sponge held inside a tea strainer for fumigations in containers wi...
African Journals Online (AJOL)
Items 4051 - 4100 of 11090 ... Vol 6, No 18 (2007), Effects of aqueous leaves extract of Ocimum gratissimum on blood glucose levels of streptozocininduced diabetic wistar rats, Abstract ... Vol 11, No 15 (2012), Effects of bran, shorts and feed flour by ultra-fine grinding on rheological characteristics of dough and bread qualities ...
Role of mycorrhizal fungi and salicylic acid in salinity tolerance of ...
African Journals Online (AJOL)
Most researchers showed that inoculation of plants with mycorrhizal fungi and using salicylic acid increase tolerance of plants due to salinity. In this study, the effect of mycorrhizal fungi, including Glomus mosseae, Glomus intraradices, and salicylic acid (0.2 mM) on tolerance of green basil (Ocimum basilicum L.) to salinity ...
Yaldiz et al., Afr J Tradit Complement Altern Med. (2015) 12(6):71-76
African Journals Online (AJOL)
Proff.Adewunmi
Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia. In this ...
Leaf storage conditions and genomic DNA isolation efficiency in ...
African Journals Online (AJOL)
Storage of plant tissues for DNA is important to avoid degradation of DNA. Preliminary studies were conducted on Ocimum gratissimum L. in order to establish the storage conditions for the collected samples before DNA extraction. Secondly, the aim was to determine the best protocol for the extraction of high quality DNA, ...
Review on herbal remedies used by the 1860 South African Indian ...
African Journals Online (AJOL)
The use of these plants needs to be noted. In line with the 150 year commemoration of the 1820 settlers, this paper reviews some of the ayurvedic plants being currently utilized and which were brought to South Africa along with the settlers. Key words: Ayurveda, Ocimum tenuiflorum, Tulsi, Moringa oleifera, Melia azederach, ...
The biological activity of basil (Ocimum basilicum L.) oil was tested against the stored product pest rice weevil, Sitophilus oryzae(L.). Adult weevils were exposed to seven different concentrations of basil oil ranging from 0.12 µl/ml-0.60 µl/ml in Petri dishes and mortality was assessed at 3,4 and...
A study was conducted to evaluate the effects of salinity on growth and nutrient uptake in basil (Ocimum basilicum L.). Plants were fertilized with a complete nutrient solution and exposed to no, low, or moderate levels of salinity from NaCl or CaCl2. Plants in the control and moderate salinity tre...
Quality of four basil types after storage at 3 to 10 C
Sweet basil (Ocimum basilicum) has global culinary use as a fresh herb. Basil can also be dried and extracted for its essential oils and grows extremely well in the warm climate of Oklahoma. Several cultivars of sweet basil are known to be chill sensitive when stored below 7 C. In this study, fou...
Four cultivars of basil (Ocimum basilicum ‘Cinnamon’, ‘Siam Queen’, ‘Sweet Dani’, and ‘Red Rubin’) were inoculated or not with the arbuscular mycorrhizal fungus (AMF), Rhizophagus intraradices, and grown with a fertilizer containing either 64 mg/l P (low-P) or 128 mg/l P (high-P) to assess whether (...
African Journals Online (AJOL)
GREGORY
2010-12-21
Dec 21, 2010 ... The effect of fertilizer treatment on the antimicrobial activity of the leaves of Ocimum gratissimum (L.) and Gongronema latifolium (Benth) was investigated. Cultivated O. gratissimum (L) and G. latifolium were applied with NPK (15:15:15) fertilizer at 100, 200, 300, 400 and 500 kg/ha treatment levels in.
The Efficacy Of Botanical Protectants In The Storage Of Cocoyam ...
African Journals Online (AJOL)
Aqueous extracts made from Ocimum basilium L., Vernonia amygdalina Del., Azadirachta indica L. and Carica papaya L. at different concentrations (150g/l and 300g/l) were used to study their effects on corm fresh weight loss, rotting and sprouting of two cocoyam varieties (Colocasia esculenta var. “Ede Ofe” and var.
Protocolo de atención odontológica en niños con Epidermólisis Ampollar
Gabriela Scagnet
2013-01-01
La atención odontológica de los niños con Epidermólisis ampollar (EA) o bullosa (EB) son un inmenso desafío para la práctica odontológica ya que se trata de un grupo de trastornos hereditarios que manifiestan aparición de ampollas en piel y mucosas al roce o suave trauma. Presentan múltiples manifestaciones orofaciales que requieren de un protocolo de atención interdisciplinaria específico que comprenda un alto componente preventivo. Se describirán los principales ítems del mismo y las posibi...
Regresión semiparamétrica para el cálculo de tarifas en el seguro de vehículos.
Pérez Caicer, Wehrli Enrique
2012-01-01
111 hojas : ilustraciones, 29 x 21 cm + CD-ROM 4264 El principal objetivo de esta investigación, es modelar la tasa técnica a aplicar en las tarifas de seguros de vehículos, mediante una regresión semiparamétrica entre variables del vehículo y de su propietario. Debido a que la regresión semiparamétrica es una generalización de los modelos de regresión lineal, se utilizará esta técnica para mejorar el ajuste. Estos modelos utilizan polinomios locales, lo cual facilita la explicación y suav...
Lima, L. S.
2018-06-01
We study the effect of Dzyaloshisnkii-Moriya interaction on spin transport in the two and three-dimensional Heisenberg antiferromagnetic models in the square lattice and cubic lattice respectively. For the three-dimensional model, we obtain a large peak for the spin conductivity and therefore a finite AC conductivity. For the two-dimensional model, we have gotten the AC spin conductivity tending to the infinity at ω → 0 limit and a suave decreasing in the spin conductivity with increase of ω. We obtain a small influence of the Dzyaloshinskii-Moriya interaction on the spin conductivity in all cases analyzed.
Estudo mecanístico da síntese de alquilfenilselenetos, pela reação tipo Zn-Barbier em meio aquoso
ANJOS, Jóse Ayron Lira dos
2002-01-01
Alquilfenilselenetos são intermediários sintéticos versáteis especialmente para a formação de duplas ligações carbono-carbono em condições suaves. Um método alternativo aos métodos tradicionais foi desenvolvido por Lothar Bieber e colaboradores, a partir da reação do PhSeSePh com haletos orgânicos na presença de zinco em pó em meio aquoso, abrangendo uma ampla classe de substratos. A falta de precedentes em termos do entendimento desta nova reação algumas vezes acarre...
Quiste epidérmico de inclusión de párpado. Presentación de 2 casos
Eréndira Güemez Sandoval; Fátima Cedillo Azuela; Rosalba García Ramírez
2017-01-01
El quiste epidérmico de inclusión o quiste epidermoide es una lesión intraepitelial, redonda u ovalada, de color amarillo, de crecimiento progresivo y consistencia suave; de diversa etiología, se origina por la proliferación de las células epidérmicas superficiales dentro de la dermis y su contenido es queratina. Se presenta frecuentemente en los párpados. El diagnóstico se realiza por la clínica y por el estudio histopatológico; el tratamiento es con escisión quirúrgica completa.
Degradación térmica del γ‐orizanol en pastas sin gluten
Soto Jover, Sonia; Boluda Aguilar, María; López Gómez, Antonio
2014-01-01
La harina de arroz es el cereal más adecuado para elaborar productos sin gluten, debido a sus propiedades nutricionales y antioxidantes, y a su alto contenido en γ–orizanol. Además también posee propiedades hipoalergénicas y un color y aroma suave. Dado el gran interés del γ–orizanol desde el punto de vista nutraceútico, y a que existen pocos estudios sobre el efecto de la cocción de alimentos sin gluten (elaborados con harina de arroz) sobre el contenido de γ‐orizanol, en este trabajo se est...
An overview of herbs, spices and plant extracts used as seasonings ...
African Journals Online (AJOL)
Seasonings include Spices such as pepper, herbs such as the leaves of cloves and bay, vegetable bulbs such as garlic and onions, sweeteners such as sugar and monosodium glutamate, and plant extracts such as that of Ocimum grattisimum or 'scent leaf'. Spices are the bark, roots, seeds, buds or berries of plants, most ...
Effect of Herbal Immunodulator on Body weight gain in immunosuppressed broiler birds
Directory of Open Access Journals (Sweden)
S.G. Mode
Full Text Available The herbal immunomodulator was evaluated in immunosupressed broiler birds in terms of body weight gain. The treatment with Ocimum sanctum and Emblica officinalis @ 3 gm /kg feed for 2 weeks were found to be effective immunomodulator in increasing body weight gain in broiler birds. [Vet World 2009; 2(7.000: 269-270
Nigerian Food Journal - Vol 28, No 2 (2010)
African Journals Online (AJOL)
Nigerian Food Journal. ... The effect of inorganic fertilizer treatment on the mineral and vitamin content of the leaves of Ocimum gratissimum (l) · EMAIL FULL TEXT ... Functional foods, nutriceuticals and health · EMAIL FULL TEXT EMAIL FULL TEXT ... A Banso, P.O Ayodele, A.G Jiya ... V.C Ezeocha, G.I Onwuka, 210-216.
Best herbs for managing diabetes: a review of clinical studies
Directory of Open Access Journals (Sweden)
Ahmad Ghorbani
2013-09-01
Full Text Available Diabetes mellitus is a public health problem which leads to serious complications over time. Experimentally, many herbs have been recommended for treating diabetes. In most cases, however, the recommendations are based on animal studies and limited pieces of evidence exist about their clinical usefulness. This review focused on the herbs, the hypoglycemic actions of which have been supported by three or more clinical studies. The search was done in Google Scholar, Medline and Science Direct databases using the key terms diabetes, plants, herbs, glucose and patients. According to the clinical studies, Aegle marmelos, Allium cepa, Gymnema sylvestre, Momordica charantia, Ocimum sanctum, Nigella sativa, Ocimum sanctum, Panax quinquefolius, Salacia reticulate, Silybum marianum and Trigonella foenum-graecum have shown hypoglycemic and, in some cases, hypolipidemic activities in diabetic patients. Among them, Gymnema sylvestre, Momordica charantia, Silybum marianum and Trigonella foenum-graecum have acquired enough reputation for managing diabetes. Thus, it seems that physicians can rely on these herbs and advise for the patients to improve management of diabetes.
Directory of Open Access Journals (Sweden)
Priyanka Verma
2012-01-01
Full Text Available Twenty-three pharmaceutically important plants, namely, Elaeocarpus spharicus, Rheum emodi, Indigofera tinctoria, Picrorrhiza kurroa, Bergenia ciliata, Lavandula officinalis, Valeriana wallichii, Coleus forskohlii, Gentiana kurroo, Saussurea lappa, Stevia rebaudiana, Acorus calamus, Pyrethrum cinerariaefolium, Aloe vera, Bacopa monnieri, Salvia sclarea, Glycyrrhiza glabra, Swertia cordata, Psoralea corylifolia, Jurinea mollis, Ocimum sanctum, Paris polyphylla, and Papaver somniferum, which are at the verge of being endangered due to their overexploitation and collection from the wild, were successfully established in vitro. Collections were made from the different biodiversity zones of India including Western Himalaya, Northeast Himalaya, Gangetic plain, Western Ghats, Semiarid Zone, and Central Highlands. Aseptic cultures were raised at the morphogenic level of callus, suspension, axillary shoot, multiple shoot, and rooted plants. Synseeds were also produced from highly proliferating shoot cultures of Bacopa monnieri, Glycyrrhiza glabra, Stevia rebaudiana, Valeriana wallichii, Gentiana kurroo, Lavandula officinalis, and Papaver somniferum. In vitro flowering was observed in Papaver somniferum, Psoralea corylifolia, and Ocimum sanctum shoots cultures. Out of 23 plants, 18 plants were successfully hardened under glasshouse conditions.
Directory of Open Access Journals (Sweden)
Ismail Teodoro Souza Júnior
2009-09-01
Full Text Available This study aimed to evaluate the effect of different concentrations of essential oils on the fungus Colletotrichum gloeosporioides. The essential oils were obtained from shoots of the plants Lippia sidoides, Ocimum gratissimum, Lippia citriodora, Cymbopogon citratus and Psidium guayava var. pomifera. After the incorporation of oil in water-agar and PDA medium, in concentrations of 1μL/mL, 3μL/mL 5μL/mL and 10μL/mL and witness at 0μL/mL (oil/the culture medium, the inhibitions of conidia germination and mycelial growth, respectively, were evaluates. The results showed that from the concentration of 1μL/mL, essential oils of all plant species had an effect on conidia germination, with an inhibition of 100%. The species Lippia sidoides, Ocimum gratissimum, Lippia citriodora and Cymbopogon citratus inhibited the growth of the fungus mycelium by 100%. The oil of Psidium guayava var. pomifera had progressive control over the mycelium of C. gloeosporioides, in accordance with the increase in concentrations of essential oil.
QCM-Arrays for Sensing Terpenes in Fresh and Dried Herbs via Bio-Mimetic MIP Layers
Directory of Open Access Journals (Sweden)
Naseer Iqbal
2010-06-01
Full Text Available A piezoelectric 10 MHz multichannel quartz crystal microbalance (MQCM, coated with six molecularly imprinted polystyrene artificial recognition membranes have been developed for selective quantification of terpenes emanated from fresh and dried Lamiaceae family species, i.e., rosemary (Rosmarinus Officinalis L., basil (Ocimum Basilicum and sage (Salvia Officinalis. Optimal e-nose parameters, such as layer heights (1–6 KHz, sensitivity
African Journals Online (AJOL)
Vol 9, No 3 (2013), Composition chimique de l'huile essentielle de Satureja calamintha (L.) Scheele du Maroc, Abstract PDF. A Ech-Chahad, H Farah, L Bouyazza. Vol 10, No 4 (2014), Composition chimique et propriétés antibactériennes des huiles essentielles d'Ocimum basilicum et d'Hyptis suaveolens (L.) Poit récoltés ...
Noverges Pedro, Bárbara
2015-01-01
La síntesis y funcionalización de compuestos carbonílicos ha atraído la atención de los químicos a lo largo del tiempo ya que el grupo carbonilo es una función muy versátil en química orgánica y está presente en numerosos compuestos con actividad biológica. Por su parte, las reacciones de acoplamiento cruzado de dos y tres componentes son metodologías que actualmente se aplican a nivel tanto académico como industrial debido a que requieren condiciones suaves de reacción, la extracción de los ...
Marquês, Luís André Rodrigues
2016-01-01
A bicicleta é uma das opções mais sustentáveis para deslocações de curta distância, também um meio de transporte económico, saudável e amigo do ambiente. Desta forma, a bicicleta, pode ter um papel muito importante em potenciar o turismo e o lazer. A adoção de modos suaves, como a bicicleta, pode também ajudar a melhorar a qualidade de vida da população, melhorar a acessibilidade e promover o desenvolvimento económico de uma determinada região, tal como reduzir a dependência energética dos co...
Editorial: profesor Julio Manrique
Directory of Open Access Journals (Sweden)
Marco A. Iriarte
1942-07-01
Full Text Available El 6 de julio del presente, cuando la Sociedad de Cirugía de Bogotá, reunida en sesión especial para acordar los preparativos de la conmemoración de los 40 años de existencia de tan benemérita Sociedad, el Profesor Julio Manrique entró en el seno misericordioso de la muerte, sin una queja, sin un gesto de angustia o de dolor, doblando suavemente su poderosa cabeza sobre la mesa redonda y en medio de sus colegas, con una muerte tranquila y blanda tal como había sido su carácter, dulce y suave.
Martín Fernández, Miguel Ángel
2012-01-01
Este trabajo se plantea de un modo inédito de registrado elástico de imágenes médicas llamado “registrado articulado”. Está basado en un modelo anatómico formado por puntos de control anatómicos conectados entre sí en el que cada hueso es registrado de forma afín y los tejidos blandos son registrados de forma elástica, manteniendo las estructuras óseas largas rectas mientras que la transformación a lo largo de toda la imagen es continua y suave. Se aplica el método articulado en el registrado...
Protocolo de atención odontológica en niños con Epidermólisis Ampollar
Directory of Open Access Journals (Sweden)
Gabriela Scagnet
2013-01-01
Full Text Available La atención odontológica de los niños con Epidermólisis ampollar (EA o bullosa (EB son un inmenso desafío para la práctica odontológica ya que se trata de un grupo de trastornos hereditarios que manifiestan aparición de ampollas en piel y mucosas al roce o suave trauma. Presentan múltiples manifestaciones orofaciales que requieren de un protocolo de atención interdisciplinaria específico que comprenda un alto componente preventivo. Se describirán los principales ítems del mismo y las posibilidades de rehabilitación bucal integral personalizada.
Roldán, Lina P; Díaz, Gonzalo J; Duringer, Jennifer M
2010-01-01
The qualitative composition and antibacterial activity of six essential oils obtained from plants cultivated in the Colombian Andes (Mentha spicata, Mentha piperita, Ocimum basilicum, Salvia officinalis, Rosmarinus officinalis and Thymus vulgaris) and a commercial essential oil of Origanum vulgare subsp. hirtum were investigated. The essential oil composition was determined by gas chromatography-mass spectrometry (GC-MS), while the antibacterial activity of the essential oils against Escheric...
Phyto-metals screening of selected anti-diabetic herbs and infused concoctions
Olanrewaju O. Olujimi; Olusegun N. Onifade; Adeleke T. Towolawi; Temilade F. Akinhanmi; Adeniyi A. Afolabi; Kabir A. Olanite
2017-01-01
Objective: To determine the levels of some selected heavy metals in both the selected anti-diabetic herbal plants and infused concoctions for diabetes treatment. Methods: Ten anti-diabetic plant samples: pawpaw leaves (Carica papaya), bitter melon leaves (Momordica charantia), holy basil leaves (Ocimum sanctum), bitter leaf (Vernonia amygdalina), ginger rhizome (Zingiber officinale), garlic (Allium sativum), African red pepper fruits (Capsicum frutescens), negro pepper grain (Xylopia aethi...
Chemical composition and antibacterial activity of essential oils against human pathogenic bacteria
Sokovic, M.; Marin, P.D.; Brkic, D.; Griensven, van, L.J.L.D.
2008-01-01
The chemical composition and antibacterial activity of essential oils from 10 aromatic plants Matricaria chamommilla, Mentha piperita, M. spicata, Lavandula angustifolia, Ocimum basilicum, Thymus vulgaris, Origanum vulgare, Salvia officinalis, Citrus limon and C. aurantium have been determined. Antibacterial activity of these oils and their components; i.e. linalyl acetate, linalool, limonene, pinene, ß-pinene, 1,8-cineole, camphor, carvacrol, thymol and menthol were assayed against a variety...
Chemical Diversity in Basil (Ocimum sp.) Germplasm
da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; de Carvalho Filho, José Luiz Sandes; de Santana, Aléa Dayane Dantas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald
2015-01-01
The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral. PMID:25629084
Chemical Diversity in Basil (Ocimum sp. Germplasm
Directory of Open Access Journals (Sweden)
Andréa Santos da Costa
2015-01-01
Full Text Available The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral.
Efecto del tramadol en la motilidad del ciego en dos equinos sanos (estudio preliminar
Directory of Open Access Journals (Sweden)
Anastasia Cruz-Carrillo
2012-07-01
Full Text Available El tramadol (analgésico opioide atípico es utilizado ampliamente en humanos y, en menor proporción, en animales, por falta de productos comerciales de uso veterinario. Es un analgésico eficaz que produce efectos adversos suaves, en comparación con los opioides típicos. Se propone su uso como alternativa en el manejo del dolor en equinos, a partir de la hipótesis de que al estimular los receptores opioides de manera suave, los efectos adversos en los equinos deben ser menores. Así, el objetivo del presente trabajo fue determinar el efecto del tramadol en la motilidad de la musculatura lisa de la base del ciego en equinos sanos. Se utilizaron tres equinos, a los cuales, mediante intervención quirúrgica, se les colocaron dos electrodos en la base del ciego, y se exteriorizaron sus extensiones por la pared abdominal, para conectarlas a un equipo de registro electromiográfico que permitió la valoración de la actividad intestinal 15 días después de colocados los electrodos y después de aplicar 1,2 mg de tramadol/kg de peso. Se comprobó que después de aplicar el tramadol hubo un descenso leve de la intensidad de las contracciones musculares, los sonidos intestinales estuvieron presentes, no hubo atonía, cólico ni estreñimiento. Adicionalmente, se comprobó su gran eficacia analgésica y la ausencia de cualquier efecto adverso. Se concluye que bajo las condiciones aquí planteadas, el tramadol no deprimió la motilidad del ciego en equinos sanos, aunque disminuyó la intensidad de las contracciones musculares en el ciego.
Los dias que ahora son sueños: un recuerdo del maestro Guillermo Valencia
Directory of Open Access Journals (Sweden)
Eduardo Carranza
1965-01-01
Full Text Available En el más hermoso sitio de la campiña payanesa se alza la mansión señorial de Valencia. El río Cauca arrastra, cerca, su crespo y raudo caudal. Los robles ponen una nota solemne y viril contra el verde tierno, eglógico, casi femenino de la pradera. A lo lejos levanta Popayán su dulce y grave fisonomía de piedra bajo el vuelo de las campanas y las palomas. Allí el lánguido hechizo del clima invade las venas del cuerpo y del alma con un suave poderío. En la distancia, arroyos tranquilos humedecen de cielo la breve llanura maravillosa.
Directory of Open Access Journals (Sweden)
Jorge Machado Damázio
2014-08-01
Full Text Available
Directory of Open Access Journals (Sweden)
Sánchez Ildefonso
1994-06-01
Full Text Available
"Cuando honestamente nos preguntamos que personas en nuestra vida significan más para nosotros, a menudo encontramos que son aquellas que, en lugar de darnos muchos consejos, soluciones o remedios, han elegido más bien el compartir nuestro dolor y acariciar nuestras heridas con mano tierna y suave. El amigo que puede estar junto a nosotros silencioso en momentos de confusión o de esperanza, que es capaz de permanecer con nosotros a la hora del duelo y dolor, que puede tolerar el no saber, el no curar, el no sanar y encarar con nosotros la realidad de nuestra impotencia. Es el amigo que cuida". Nowen
Assessing the People's Diplomacy and its impacts on the US-Japan
Tao Peng
2009-01-01
Durante años, en lo que respecta a la guerra fría de Asia oriental y la política exterior china, los estudiosos se han centrado más en la confrontación entre China y los EE.UU. o en las difíciles relaciones chino-soviéticas, pero ignoraron la política de China hacia Japón. En realidad, de forma distinta a línea dura hacia los Estados Unidos, la política China hacia Japón durante la guerra fría fue en gran parte flexible y suave, que se muestra normalmente en su Diplomacia Popular basado en co...
1601-IJBCS-Article-Mohamed Soumanou
African Journals Online (AJOL)
Dr GATSING
L'influence du mode de cuisson sur la valeur nutritionnelle de Solanum macrocarpum, Amaranthus hybridus et Ocimum gratissimum a été investiguée. Les teneurs en matière sèche, cendres, protéines, lipides, fibres et minéraux des légumes-feuilles traités ont été analysées conformément aux méthodes standards. Les.
Koffi Koba; P.W. Poutouli; Christine Raynaud; Jean-Pierre Chaumont; Komla Sanda
2009-01-01
The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and meth...
CHEMICAL COMPOSITION AND ANTIMICROBIAL PROPERTIES OF DIFFERENT BASIL OILS
H.C. Srivastava, Pankaj Shukla, Ajay Singh Maurya and Sonia Tripathi*
2013-01-01
ABSTRACT: The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; tanethole type. The in vitro microbiological experiments revealed that only the methyleugenol...
Plant compounds insecticide activity against Coleoptera pests of stored products
MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.
2008-01-01
The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...
Directory of Open Access Journals (Sweden)
Larissa CB Costa
2007-06-01
Full Text Available Avaliou-se a produção de biomassa e óleo essencial de plantas de elixir-paregórico (Ocimum selloi, em função do corte das inflorescências e épocas de colheita. O experimento foi realizado em campo, em blocos ao acaso, com os tratamentos dispostos em fatorial 2 x 8, sendo dois sistemas de manejo (com e sem corte de inflorescências e oito épocas de colheita (45; 60; 75; 90; 105; 120; 135 e 150 dias após o transplante das mudas, com quatro repetições. Avaliaram-se as características altura de planta, massa seca de caule (MSC, folhas (MSF e inflorescências (MSI e teor e rendimento de óleo essencial destilado de folhas. O corte das inflorescências não afetou a altura das plantas. Plantas intactas apresentaram uma média de altura de 51,8 cm, enquanto aquelas que tiveram suas inflorescências cortadas atingiram em média 53,2 cm de altura. O crescimento das plantas apresentou resposta quadrática em relação às épocas de colheita, com a altura máxima estimada de 65,9 cm, 139 dias após o transplante (DAT. As plantas cujas inflorescências foram cortadas produziram maior MSC (51,8 g planta-1 e MSF (27,9 g planta-1, em relação às plantas sem corte (MSC = 42,4; MSF = 21,3 g planta-1 e, assim como MSI, apresentaram ajuste quadrático para os dois sistemas de manejo, ao longo das épocas de colheita. O teor de óleo essencial das folhas não foi afetado pelo sistema de manejo, mas apresentou resposta quadrática às épocas de colheita. Entretanto, o rendimento médio de óleo essencial das folhas das plantas cuja inflorescência foi cortada foi significativamente maior (1,60 g planta-1 do que nas plantas que não sofreram o corte (1,18 g planta-1. Para as plantas que tiveram as suas inflorescências cortadas, o rendimento de óleo máximo estimado foi de 2,36 g planta-1, obtido 135 DAT, enquanto nas plantas que não foram cortadas o rendimento de óleo máximo estimado foi de 1,65 g planta-1, obtido 114 DAP.Biomass and essential
Bartkiene, Elena; Bartkevics, Vadims; Krungleviciute, Vita; Pugajeva, Iveta; Zadeike, Daiva; Juodeikiene, Grazina; Cizeikiene, Dalia
2018-06-01
The aim of this study was to investigate the influence of additives such as plants belonging to Lamiaceae family (Thymus vulgaris, Carum carvi, Origanum vulgare, Ocimum basilicum, and Coriandrum sativum), scalded flour (SF) or scalded flour fermented with Lactobacillus plantarum LUHS135 (SFFLp) on the quality and acrylamide formation in wheat bread. The formation of acrylamide and bread quality significantly depended on the king of plants used and the amount of SF and SFFLp used. The additives of T. vulgaris and SF increased the content of acrylamide by 3.4-fold in comparison with bread prepared without SF, whereas the addition of SFFLp significantly reduced the content of acrylamide in bread, especially using 5% of SFFLp supplemented with O. vulgare and 15% of SFFLp supplemented with C. sativum (respectively by 40% and 29.4%) therefore could be recommended for safer bread production. The addition of 5% (from total wheat flour content) of scalded wheat flour fermented with Lactobacillus plantarum LUHS135 strain (SFFLp) with Origanum vulgare addition, and 5% or 10% of SFFLp prepared with Ocimum basilicum, and 15% of SFFLp prepared with Coriandrum sativum significantly reduce the content of acrylamide in wheat bread, therefore could be recommended for safer bread production. © 2018 Institute of Food Technologists®.
Rodrigues,F.; Carvalho,H.H.C.; Wiest,J.M.
2011-01-01
A partir da atividade antibacteriana in vitro, predeterminada em doze plantas com indicativo etnográfico condimentar, testou-se este atributo in loco no modelo caldo com frango cozido. Primeiramente, procedeu-se ao treinamento de 10 avaliadores, segundo a legislação vigente quanto ao Consentimento Livre e Esclarecido, oportunizando conhecimentos prévios sobre as plantas salsa (Petroselinum sativum), manjerona branca (Origanum X aplii), manjerona preta (Origanum majorana), manjericão (Ocimum b...
Comparaison de l'efficacite Antifongique de l'huile Essentielle d ...
African Journals Online (AJOL)
Une étude a été menée à la fois in vitro et in vivo afin d'évaluer l'activité antifongique du mancozèbe et de l'huile essentielle d'Ocimum gratissimum L. sur Fusarium oxysporum f. sp. radicis-lycopersici (Forl). Une corrélation positive a été établie entre l'inhibition de la croissance radiale mycélienne du mycopathogène et la ...
Amirdivani, Shabboo
2011-01-01
The present study investigated the effects of peppermint (Mentha piperita), dill (Anethum graveolens) and basil (Ocimum basilicum) on yogurt formation, proteolysis and inhibition of angiotensin-1 converting enzyme (ACE). Herbal-yogurts had faster rates of pH reduction than plain-yogurt. All herbal-yogurts had higher (p < 0.05) antioxidant activities than plain-yogurt, both at the end of fermentation and throughout the storage period. The o-phthalaldehyde (OPA) peptides in herbal-yogurts in...
De la biología al injerto de tejido adiposo: cómo mejorar el lipoinjerto
Directory of Open Access Journals (Sweden)
A.C. Girard
2013-12-01
Full Text Available A pesar de que el uso del injerto de grasa ha ganado popularidad, no hay consenso sobre la mejor manera de manejar el tejido adiposo. Los protocolos difieren y los resultados son a menudo variables. Diversos factores influyen en la calidad de la grasa inyectada, entre los que encontramos las moléculas tóxicas provenientes de la infiltración, procedimiento previo a la liposucción. En este trabajo, hemos confirmado el efecto nocivo de los anestésicos sobre las células madre derivadas del tejido adiposo, determinando el efecto del lavado y la centrifugación en el tejido graso con el fin de proponer un protocolo simple y optimizado para mejorar la supervivencia del injerto. Evaluamos la citotoxicidad de la lidocaína sobre las células madre derivadas de tejido adiposo (ADSC mediante ensayo de LDH. Sometimos el tejido adiposo conjunto a varios tipos de centrifugación (de 1 segundo a 10 minutos y desde 0 g a 1800 g, y el volumen de líquido y el aceite liberado se midió inmediatamente después de la centrifugación. Tras la determinación de las condiciones óptimas para la manipulación de tejidos (400 g/1 minuto, inyectamos el tejido adiposo de liposucción sin o con lidocaína en ratones inmunodeficientes. Un mes después de la inyección, evaluamos la calidad de los injertos mediante histología, y en comparación con los injertos obtenidos a partir de un protocolo convencional: una simple sedimentación. La lidocaína ejerce un efecto citotóxico sobre las ADSC, y este efecto depende del tiempo de incubación y de las concentraciones. En cuanto al tejido adiposo, una centrifugación intensa (900 g, 1800 g es perjudicial en comparación con una centrifugación suave (100 g, 400 g. Además, las secciones histológicas de los injertos de tejido adiposo no centrifugados mostraron la presencia de grandes vacuolas de aceite mientras que los injertos resultantes de lavado con protocolo de centrifugación suave (400g/1minuto no lo hacen. En
Directory of Open Access Journals (Sweden)
C. C. MENEZES
2011-04-01
Full Text Available
The objective of this work was to understand the opinions, attitudes and the perceptions of wine consumers using the focus group technique. 24 wine consumers were selected through a recruitment questionnaire to participate in the focus group. Three focus group sessions were carried out, with eight consumers in each. It was veriï¬ ed that the factors most observed by the consumers at the time of wine purchase were brand (71%, origin (75% and price (75%. In relation to the type of wine, 50% of the participants prefer suave red wine. The factors that infl uence the purchase process and consumer preference are different in relation to the evaluation of consumers and specialists.
The antimicrobial properties of Ocimum gratissimum extracts on ...
African Journals Online (AJOL)
user
2006-11-16
Nov 16, 2006 ... The plant is extensively cultivated in and around town and villages in Nigeria, tropical regions of Asia, Africa, central and South America (Bailey, 1924). ..... ritual aspects of traditional therapy using drugs dried from human body. Chinese Science. Exploration of an Ancient Tradition, Shigeru. Makayoma and ...
The antimicrobial properties of Ocimum gratissimum extracts on ...
African Journals Online (AJOL)
, flavonoids saponin, anthraquinone, cardiac glycoside, steroidal ring, steroidal terpens and carbohydrates at different concentrations. The findings from this study seem to provide the in vitro evidence that might justify O. gratissimum as a good ...
Experimental investigation of a novel indirect solar dryer implementing PCM as energy storage medium
Energy Technology Data Exchange (ETDEWEB)
Shalaby, S.M., E-mail: saleh_shalaby@yahoo.com; Bek, M. A.
2014-07-01
Highlights: • The performance of a novel indirect solar dryer is investigated experimentally. • PCM, paraffin wax, is used as energy storage medium. • The novel ISD is suitable for drying medical plants. • Ocimum and Thevetia are dried at their prescribed drying temperatures. • The novel design maintains the desired temperature for 7 consecutive h/day. - Abstract: A novel indirect solar dryer (ISD) design using phase change material (PCM) as energy storage medium was experimentally investigated. The system consists of two identical solar air heaters, drying compartment, PCM storage units and a blower. The ISD was tested under no load with and without PCM at a wide range of mass flow rates (0.0664–0.2182 kg/s). It is found that after using the PCM, the temperature of the drying air is higher than ambient temperature by 2.5–7.5 °C after sunset for five hours at least. In addition, the mass flow rates of 0.1204 and 0.0894 kg/s give the peak values of the drying temperature when the ISD is operated with and without PCM, respectively. The novel design successfully maintains the desired temperature for seven consecutive hours every day. This helps reaching the final moisture content of Ocimum Basilicum and Thevetia Neriifolia after 12 and 18 h, respectively.
Directory of Open Access Journals (Sweden)
Cíntia Alvarenga Santos Fraga de Miranda
2015-07-01
Full Text Available In recent years, essential oils have gained commercial interest in the agricultural area, mainly for their allelopathic, insecticidal, antifungal, antimicrobial and antioxidant properties, and, also for their natural compounds, which have generally displayed low toxicity, relatively low cost and rapid degradation in the environment. Medicinal plants have emerged as potential suppliers of essential oils because of their ethnopharmacological utility. The aim of this study was to evaluate the allelopathic potential of essential oils extracted from fresh leaves of lemon grass (Cymbopogon citratus, wild basil (Ocimum gratissimum L. and sweet basil (Ocimum basilicum L. with regard to their major constituents (citral, eugenol and cineol, respectively in different application forms (direct contact and the effect of volatile constituents on the germination and vigor of lettuce seeds (cultivar Regina SF 3500. The effects of the oils and their major components were evaluated with regard to the variables: first germination count, total germination, GVI (germination velocity index, seedling dry weight and average lengths of shoots and lettuce roots. The essential oils from lemon grass and basil displayed allelopathic potentials on seed germination and vigor of lettuce achenes that can be assigned to their respective major constituents citral and eugenol. On the other hand, the allelopathic effect of the essential oil from basil was a consequence of the combined effect of all the components, regardless the application method.
Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak
2017-01-01
The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal ( Alpinia galanga Linn.), ginger ( Zingiber officinale ), plai ( Zingiber cassumunar Roxb.), lime ( Citrus aurantifolia ), kaffir lime ( Citrus hystrix DC.), sweet basil ( Ocimum basilicum Linn.), tree basil ( Ocimum gratissimum ), lemongrass ( Cymbopogon citratus DC.), clove ( Syzygium aromaticum ), and cinnamon ( Cinnamomum verum ) against four standard strains of Staphylococcus aureus , Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii , and 30 clinical isolates of multidrug-resistant A. baumannii (MDR- A. baumannii ). Agar diffusion, minimum inhibitory concentration, and minimum bactericidal concentration (MBC) were employed for the determination of bactericidal activity of water distilled medicinal plants. Tea tree oil ( Melaleuca alternifolia ) was used as positive control in this study. The results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus , E. coli , P. aeruginosa , and A. baumannii . Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa . In addition, volatile oil extracted from cinnamon, clove, and tree basil possessed potent bactericidal activity against MDR- A. baumannii with MBC 90 of 0.5, 1, and 2 mg/mL, respectively. The volatile oil extracts would be useful as alternative natural product for the treatment of the most common human pathogens and MDR- A. baumannii infections.
Host Suitability of 32 Common Weeds to Meloidogyne hapla in Organic Soils of Southwestern Quebec
Bélair, G.; Benoit, D. L.
1996-01-01
Thirty-two weeds commonly found in the organic soils of southwestern Quebec were evaluated for host suitability to a local isolate of the northern root-knot nematode Meloidogyne hapla under greenhouse conditions. Galls were observed on the roots of 21 species. Sixteen of the 21 had a reproduction factor (Pf/Pi = final number of M. hapla eggs and juveniles per initial number of M. hapla juveniles per pot) higher than carrot (Pf/Pi = 0.37), the major host crop in this agricultural area. Tomato cv. Rutgers was also included as a susceptible host and had the highest Pf/Pi value of 13.7. Bidens cernua, B. frondosa, B. vulgata, Erysimum cheiranthoides, Eupatorium maculatum, Matricaria matricarioides, Polygonum scabrum, Thalictrum pubescens, Veronica agrestis, and Sium suave are new host records for M. hapla. Bidens cernua, B. frondosa, B. wulgata, D. carota, M. matricarioides, Pasticana sativa, P. scabrum, S. suave, and Thlaspi arvense sustained moderate to high galling by M. hapla and supported high M. hapla production (12.4 ≤ Pf/Pi ≥ 2.9). Capsella bursa-pastoris, Chrysanthemum leucanthemum, Gnaphalium uliginosum, Stellaria media, and Veronica agrestis sustained moderate galling and supported moderate M. hapla reproduction (2.8 ≤ Pf/Pi ≥ 0.5). Chenopodium album, C. glaucum, E. cheiranthoides, P. convolvulus, Portulaca oleracea, and Rorippa islandica supported low reproduction (0.25 ≤ Pf/Pi ≥ 0.02) and sustained low galling. Galling was observed on Senecio vulgaris but no eggs or juveniles; thus, S. vulgaris may be useful as a trap plant. Eupatorium maculatum, and T. pubescens harbored no distinct galling but supported low to moderate M. hapla reproduction, respectively. Amaranthus retroflexus, Ambrosia artemisiifolia, Echinochloa crusgalli, Erigeron canadensis, Oenothera parviflora, Panicum capillare, Setaria glauca, S. viridis, and Solidago canadensis were nonhosts. Our results demonstrate the importance of adequate weed control in an integrated program
Directory of Open Access Journals (Sweden)
2009-06-01
Full Text Available The degree of bitterness and pungency of a virgin olive oil largely defines its style, and therefore how it is most appropriately used by consumers. In order to assess how Australian olive oil producers interpret the style of their oils, 920 Australian virgin olive oils were classified by their producers as either being mild, medium or robust in style. Although in general, the classifications by producers were associated with the oils’ total phenol concentration, significant variability in phenol concentration within each style category was observed. The perceived styles of a subset of these oils were further assessed by panels of expert tasters. The expert panels were more discriminating when assigning oils to style categories based on total phenol levels. The producers and the expert panels were in moderate agreement with respect to oil style, with the interpretation of what constitutes a mild oil being the most contentious.
El grado de amargor y picante de un aceite de oliva define en gran manera su tipo, y, por tanto, también su uso más apropiado por el consumidor. Para evaluar cómo los productores australianos de aceite de oliva interpretan el tipo de sus aceites, 920 aceites de oliva virgen australianos fueron clasificados por sus productores en tipo suave, medio o fuerte. Aunque, en general, la clasificación de los productores estuvo asociada a la concentración de fenoles totales de los aceites, se observó una variabilidad significativa en la concentración de fenoles en cada tipo de aceite. Los tipos percibidos en un subgrupo de estos aceites fueron además evaluados por paneles de catadores expertos. Los paneles de expertos fueron más discriminantes cuando asignaron los aceites a los diversos tipos basándose en el nivel de fenoles totales. Los productores y los paneles de expertos estuvieron en relativamente de acuerdo con respecto al tipo de aceite, si bien la interpretación de qué es un aceite suave fue la m
Assessing the People's Diplomacy and its impacts on the US-Japan
Directory of Open Access Journals (Sweden)
Tao Peng
2009-11-01
Full Text Available Durante años, en lo que respecta a la guerra fría de Asia oriental y la política exterior china, los estudiosos se han centrado más en la confrontación entre China y los EE.UU. o en las difíciles relaciones chino-soviéticas, pero ignoraron la política de China hacia Japón. En realidad, de forma distinta a línea dura hacia los Estados Unidos, la política China hacia Japón durante la guerra fría fue en gran parte flexible y suave, que se muestra normalmente en su Diplomacia Popular basado en contactos no-gubernamentales. Este trabajo no sólo analiza los orígenes y desarrollo de este nuevo enfoque diplomático, pero también explora su impacto en Japón y en la alianza de seguridad Estados Unidos-Japón. Según fuentes chinas, americanas, japonesas y de los documentos disponibles recientemente, se argumenta que la Diplomacia Popular, de tono suave y una gran flexibilidad, de hecho, minaba la alianza de Estados Unidos y Japón durante la guerra fría.__________ABSTRACT:For years, in regard to the East Asia cold war and the Chinese foreign policy, scholars have focused more on the Sino-American confrontation or tough Sino-Soviet relations but ignored China's policy toward Japan. Actually, different from its tough policy toward the United States, the Chinese Japan policy during the cold war was largely flexible and soft, which was typically shown in its People's Diplomacy with emphasis on non-governmental contacts. This paper not only discusses the origins and development of this new diplomatic approach but also explores its impacts on Japan and the US-Japan security alliance. Based on Chinese, American, and Japanese sources recently available, it argues that the People's Diplomacy, with its soft tone and great flexibility, effectively undermined the US-Japan cold war security alliance.
Directory of Open Access Journals (Sweden)
Josefa Clara Monteiro
2014-08-01
Full Text Available Neste trabalho objetivou-se estabelecer a influência da geologia, geomorfologia e uso e ocupação do solo no potencial hídrico de pequenas bacias hidrográficas situadas na Área de Proteção Ambiental Estadual da Cachoeira das Andorinhas (APA/CA. Foram selecionados três pares de bacias, cada par com condições geológicas e geomorfológicas semelhantes, mas com graus distintos de interferência antrópica. Utilizando-se dados de chuva e vazão, obtidos durante um ano hidrológico, estabeleceram-se os regimes pluviométricos e fluviométricos e determinaram-se alguns parâmetros hidrológicos, como o fluxo de base pela técnica smoothed mínima e o coeficiente de recessão (α pela técnica matching strip. A análise conjugada destes parâmetros, de índices morfométricos e de dados físico-químicos das águas indicam que as bacias em áreas de relevo mais suave tendem a apresentar menores coeficientes de recessão e maiores volumes de fluxo de base. Portanto, nestas áreas o potencial hídrico é maior, já que a vazão das drenagens se mantém por mais tempo na estação seca. O relevo mais suave, com solo mais espesso e maior tempo de trânsito das águas subterrâneas, também justificam as águas mais redutoras e com maiores condutividades elétricas. Os dados também sugerem que as bacias da área com maiores proporções de florestas tendem a apresentar menores fluxos de base por conta das maiores taxas de evapotranspiração. Os métodos aplicados se mostraram adequados para caracterizar o regime hídrico de pequenas bacias hidrográficas e podem ser importantes para a gestão de recursos hídricos.
Menezes, Claubert Wagner Guimarães de
2015-01-01
A espécie Ocimum selloi Benth. (Lamiaceae) possui constituintes químicos em seu óleo essencial com ação inseticida. Objetivou-se avaliar o efeito inseticida por ingestão e por fumigação do óleo essencial de O. selloie do estragol sobre Spodoptera frugiperda(Smith, 1797) (Lepidoptera: Noctuidae)eo efeito por fumigação do óleo essencial sobreZabrotes subfasciatus(Bohemann, 1833) (Coleoptera, Bruchidae). No primeiro experimento, larvas de 48 horas d...
Directory of Open Access Journals (Sweden)
zeinab shirzadi margavi
2017-10-01
Full Text Available Introduction Distribution of leaf area and dry matter are the effective factors that influence on absorption the radiation, evaporation and transpiration of canopy and eventually dry matter accumulation and grain yield in plants. Plant canopy is the spatial arrangement of shoots in a plant population. In plant canopy, leaves are responsible for radiation absorption and gas exchange with the outside. Stem and branches arrange photosynthetic organs somehow, which gas exchange and light distribution best done. The effect of canopy structure on gas exchange and absorption of radiation in plant communities caused detailed study of the canopy structure to be more important. Materials and methods In order to investigate the vertical distribution of leaf area and dry matter of borage and sweet basil in competition with weeds by cover crops treatments, a field experiment was carried out in a randomized complete block design with 8 treatments and 3 replications in Agricultural Sciences and Natural Resources University of Sari in 2013. Treatments were cover crops mung bean (Vigna radiata L. and Persian clover (Trifolium resupinatum L. in the rows between the sweet basil (Ocimum basilicum L. and borage (Borago officinalis L.. Moreover, in order to evaluate the effectiveness of cover crops to control weeds, pure stand of sweet basil and borage in terms of weeding and no weed controls per replicates were used. Each plot was included 5 rows of medicinal plants. Cover crop inter-seeded simultaneously in the main crop. Estimation of leaf area and dry matter of each plant in different canopy layers (0-20, 20-40, 40-60, 80.100, 100-120 and 120-140 cm were done after 75 planting days, with 1 m × 1 m quadrate per plot. For this purpose a vertical card board frame marked in 20-cm increments was used in the field as a guide to cut standing plants (crops, cover crops and weeds into 20-cm strata increments (Mosier & Oliver, 1995. All samples were transferred to the
Nuevas Algas Bénticas del Litoral Caribe de Colombia
Directory of Open Access Journals (Sweden)
Schnetter Reinhard
1975-09-01
Full Text Available Laurencia minuscula pertenece a la sección Forsterianae Yamada (1931, por sus células corticales no radialmente elongadas y por los engrosamientos de las paredes longitudinales de las células medulares, Se distingue de la mayoría de las especies del género y de la sección por su tamaño pequeño. Las plantas vivas eran parduscas y de consistencia suave, sus superficies lisas o a veces muy ligeramente mamilíferas en las partes máS jóvenes. Los talos no presentaron hápteros secundarios ni ramas realmentedecumbentes. Casi todos los ejemplares coleccionados eran fétiles, con tetrasporangios, cistocarpos o espermatangios, respectivamente. El material herborizado pega bien sohre el papel soporte.
Directory of Open Access Journals (Sweden)
David Normando
2010-12-01
Full Text Available OBJETIVO: avaliar as alterações cefalométricas em pacientes com perda bilateral do primeiro molar inferior permanente. MÉTODOS: foram analisadas 68 telerradiografias laterais de pacientes de consultórios particulares. A amostra foi dividida em dois grupos pareados quanto ao sexo e idade - 34 indivíduos sem perdas (grupo controle e 34 com perda bilateral do primeiro molar inferior permanente (grupo com perda. Foram excluídos da amostra pacientes que haviam perdido outros dentes que não o primeiro molar inferior, casos de agenesia e pacientes com menos de 16 anos de idade. Buscou-se avaliar somente indivíduos que tivessem relatado a perda há pelo menos 5 anos. RESULTADOS: demonstraram que a perda bilateral do primeiro molar inferior permanente leva ao suave fechamento do ângulo GnSN (P=0,05, um giro anti-horário do plano oclusal (P=0,0001, uma suave diminuição da altura facial anteroinferior (P=0,05, uma acentuada inclinação lingual (P=0,04 e retrusão dos incisivos inferiores (P=0,03. Por outro lado, a perda bilateral do primeiro molar inferior permanente não foi capaz de influenciar a relação maxilomandibular no sentido anteroposterior (P=0,21, a quantidade de mento (P=0,45, a inclinação dos incisivos superiores (P=0,12 e a posição anteroposterior dos incisivos superiores (P=0,46. CONCLUSÃO: a perda bilateral dos primeiros molares inferiores é capaz de produzir alterações marcantes no posicionamento dos incisivos inferiores e no plano oclusal, além de uma suave redução vertical da faceOBJECTIVE: To evaluate cephalometric changes in patients after bilateral loss of lower first permanent molar teeth. METHODS: Sixty-eight lateral radiographs of patients from private practices were analyzed. The sample was divided into two groups matched for age and gender: 34 individuals without loss (control group and 34 presenting with bilateral loss of lower first permanent molar teeth (loss group. Patients who had lost teeth other
Directory of Open Access Journals (Sweden)
F. Rodrigues
2011-01-01
Full Text Available A partir da atividade antibacteriana in vitro, predeterminada em doze plantas com indicativo etnográfico condimentar, testou-se este atributo in loco no modelo caldo com frango cozido. Primeiramente, procedeu-se ao treinamento de 10 avaliadores, segundo a legislação vigente quanto ao Consentimento Livre e Esclarecido, oportunizando conhecimentos prévios sobre as plantas salsa (Petroselinum sativum, manjerona branca (Origanum X aplii, manjerona preta (Origanum majorana, manjericão (Ocimum basilicum, sálvia (Salvia officinalis, tomilho (Thymus vulgaris, anis verde (Ocimum selloi, alfavaca (Ocimum gratissimum, alho nirá (Allium tuberosum, alho poró (Allium porrum, cúrcuma (Curcuma longa e pimenta dedo-de-moça (Capsicum baccatum. Realizou-se, através da adição individualizada desses condimentos ao caldo com frango cozido, um Teste de Aceitação tipo escala hedônica, selecionando, dentre os doze condimentos, quatro deles que se destacaram sensorialmente, a pimenta dedo-de-moça, o alho nirá, o alho poró e o tomilho. Foi feito, então, um Teste de Aceitação de concentrações denominadas pequena, média e grande destes quatro condimentos, para determinação da intensidade sensorialmente melhor aceita. As quantidades eleitas (0,5 g de pimenta dedo-de-moça, 15 g de alho nirá, 15 g de alho poró e 5 g de tomilho foram acrescidas ao caldo com frango cozido, sendo estes desafiados frente a Escherichia coli (ATCC 11229 em concentração final de 10 UFC mL-1, limite tolerado pela legislação, tendo como grupo-controle o caldo com frango cozido sem condimentos. O crescimento bacteriano foi aferido a cada duas horas após a inoculação, até completar 24 horas de confronto, utilizando-se meio seletivo para coliformes termo-resistentes e incubação constante a 25ºC em DBO, sendo atribuídos valores arbitrários às variações logarítmicas de crescimento. Comparados ao controle, todos os tratamentos condimentados apresentaram
Dicty_cDB: Contig-U15678-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available nating seedlings, TAMU Sola... 52 6e-10 3 ( DY336852 ) OB_SEa04P11.r OB_SEa Ocimum basil...efly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end simi...qyiyiffiyiffffpklyif*kiilhpstqkkkkkkkkniisqhtv fcisi*ssp*nyffykkkik*ivfvfvliivifffpllnk*kkksffffliiyivi...qmyqphfkciliqaqtlte*lveqvmiqitf*lilq *rvklsiveplkfsinslinvlilvstlqvnkmqiplvevlkmf*dpskvvhnnhhhkyq nhnhnnhhnh... ... 60 5e-14 4 ( GE464933 ) 294762759 Nasonia vitripennis Adult Female Nasoni... 70 5e-14 2 ( BU819448 ) UA43BPG03 Populus trem
Directory of Open Access Journals (Sweden)
Rogério Santos Pereira
2004-04-01
Full Text Available A análise da atividade antibacteriana de óleos essenciais de ervas medicinais (Ocimum gratissimum, L., Cybopogum citratus (DC Stapf. e Salvia officinalis, L. foi verificada frente a 100 cepas de bactérias isoladas de indivíduos da comunidade com diagnóstico de infecção urinária. Os microrganismos foram semeados em ágar Muller Hinton e os extratos aplicados com replicador de Steers e incubados a 37°C por 24 horas. Verificou-se que Salvia officinalis, L. apresentou ação inibitória superior às outras ervas, tendo eficácia de 100% quando testadas em espécies de Klebsiella e Enterobacter, 96% em Escherichia coli, 83% contra Proteus mirabilis e 75% contra Morganella morganii.The antibacterial activity of essential oils extracted from medicinal plants (Ocimum gratissimum, L., Cybopogum citratus (DC Stapf., and Salvia officinalis, L. was assessed on bacterial strains derived from 100 urine samples. Samples were taken from subjects diagnosed with urinary tract infection living in the community. Microorganisms were plated on Müller Hinton agar. Plant extracts were applied using a Steers replicator and petri dishes were incubated at 37°C for 24 hours. Salvia officinalis, L. showed enhanced inhibitory activity compared to the other two herbs, with 100% efficiency against Klebsiella and Enterobacter species, 96% against Escherichia coli, 83% against Proteus mirabilis, and 75% against Morganella morganii.
Directory of Open Access Journals (Sweden)
Amornrat Intorasoot
2017-06-01
Full Text Available Aim:\tTo investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn., ginger (Zingiber officinale, plai (Zingiber cassumunar Roxb., lime (Citrus aurantifolia, kaffir lime (Citrus hystrix DC., sweet basil (Ocimum basilicum Linn., tree basil (Ocimum gratissimum, lemongrass (Cymbopogon citratus DC., clove (Syzygium aromaticum and cinnamon (Cinnamomum verum against four standard strains of Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Acinetobacter baumannii and thirty clinical isolates of multidrug-resistant A. baumannii (MDR-A. baumannii. Methods:\tAgar diffusion, minimal inhibitory concentration (MIC and minimal bactericidal concentration (MBC were employed for determination of bactericidal activity of water distillated medicinal plants. Tea tree oil (Melaleuca alternifolia was used as positive control in this study. Results:\tThe results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus, E. coli, P. aeruginosa and A. baumannii. Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa. In addition, volatile oil extracted from cinnamon, clove and tree basil possessed potent bactericidal activity against MDR-A. baumannii with MBC90 of 0.5, 1 and 2 mg/mL, respectively. Conclusions: The volatile oil extracts would be useful as alternative natural product for treatment of the most common human pathogens and MDR-A. baumannii infections. [J Complement Med Res 2017; 6(2.000: 218-222
Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...
African Journals Online (AJOL)
Chigo Okwuosa
basilicum (sweet basil) protect against sodium ... arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium ... properties and effects (Aruna and Sivaramakrishnan. 1992 ..... Biotransformation of the pesticide.
The Effects of Ocimum Gratissimum Leaf Extract on Cardiovascular ...
African Journals Online (AJOL)
At the end of the period the blood pressure, heart rate, packed cell volume ... Also determined were the urine output, urine flow rate and urinary excretion of ... No significant histological changes were observed in renal cortical tissue of O.
Antifungal activities of basil ( Ocimum basilicum L.) extract on ...
African Journals Online (AJOL)
... and 29.27%, respectively) whereas other investigated Fusarium species exhibited much lower sensitivity. The basil extract completely inhibited the growth of investigated Fusarium spp. at the concentration of 1.50% (v/v). Higher concentrations (0.35 and 0.70% (v/v)) reduced growth of aerial mycelium in all tested species.
A comparative study of therestorative effects of Ocimum gratissimum ...
African Journals Online (AJOL)
This study was to assess the curative potential of the methanol extract of two different ... O. canum and O. gratissimum on alcohol induced hepatotoxicity in albino rats. ... Thus from the result obtained we conclude that MEOG and MEOC could ...
Phytochemical and nutrient compositions of the leaves of Ocimum ...
African Journals Online (AJOL)
Aluko Bukola
2012-08-07
Aug 7, 2012 ... carbohydrate content (639.6 g/kg), ash, crude fat and crude fiber, but very ... In addition, the plant was found to be a good source of iron, zinc and manganese. Furthermore, the concentrations of cadmium (0.01 g/kg) and lead (0.02 g/kg), which are ... phytochemical, proximate, mineral and vitamin C analysis.
INFLUENCE OF POLYPHENOLIC COMPOUNDS ON OCIMUM BASILICUM L. DEVELOPMENT
Directory of Open Access Journals (Sweden)
Adina Talmaciu
2015-07-01
Full Text Available The activities and role of phenolic compounds in the plant kingdom are well known. They are especially recognized for their function as plant growth regulators, but also for the important role in the biosynthesis process. Based on that, the aim of this work is to establish the influence of polyphenolic compounds, on the main physiological processes involved in basil cultivation under controlled conditions. Studies were carried out on sweet basil seeds (Ocimumbasilicum L. treated with different spruce bark polyphenolic extracts (aqueous extract and ultrasound assisted aqueous extract on several concentrations. The germination energy and germination capacity, plants vegetative organelles development and photoassimilatory pigments content were investigated. The results show that the Picea abies extracts, rich in phenolic compounds, have an influence on the global development of plantlets. An increased value for the growth parameters and pigments concentration was observed, compare with a control sample. Also it was shown that the effect of phenolic compounds on plants development significantly depends on their concentration.
Antioxidant Activity of the Aqueous Crude Extract of Ocimum ...
African Journals Online (AJOL)
. leaf on the basal and traumatized (cadmium-induced) serum levels of alkaline phosphatase (ALP), total acid phosphatase (ACPT) and prostatic acid phosphatase (ACPP) of the male guinea-pig (GP) were evaluated. Preliminary ...
International Nuclear Information System (INIS)
Skalka, J.
2008-01-01
The protection of both human and animal population against a radiation impairment proves to be an impulse for continuous intensive searching for plants with radioprotective properties, identification of their radioprotective components and examination of their effects both in vivo an in vitro. I am presenting the results as well as knowledge of a latest scientific research in this field with testing the following plants: Vigna radiata, Mentha piperita, Citrus aurantium var. amara, Syzygium cumini, Tinospora cordifolia, Aegle marmelos, Phyllanthus amarus, Aloe vera, Angelica sinensis, Rosemarinus officinalis, Panax ginseng, Hippophae rhamnoides, Ocimum sanctum, Crataegus microphylla. (authors)
Energy Technology Data Exchange (ETDEWEB)
Skalka, J [Ustav vyzivy, dietetiky a krmovinarstva, Univerzita veterinarskeho lekarstva, 04181 Kosice (Slovakia)
2008-06-15
The protection of both human and animal population against a radiation impairment proves to be an impulse for continuous intensive searching for plants with radioprotective properties, identification of their radioprotective components and examination of their effects both in vivo an in vitro. I am presenting the results as well as knowledge of a latest scientific research in this field with testing the following plants: Vigna radiata, Mentha piperita, Citrus aurantium var. amara, Syzygium cumini, Tinospora cordifolia, Aegle marmelos, Phyllanthus amarus, Aloe vera, Angelica sinensis, Rosemarinus officinalis, Panax ginseng, Hippophae rhamnoides, Ocimum sanctum, Crataegus microphylla. (authors)
Energy Technology Data Exchange (ETDEWEB)
Singh, V K [Co-operative College, Jamshedpur (India). Botany Dept.; Geeta, [Jamshedpur Women` s College, Jamshedpur (India). Botany Dept.
1995-01-01
Estimation of radioactivity (Bq/Kg dry Wt.) due to bioaccumulated {sup 238}U,{sup 226}Ra was carried out in six species of native plants growing in the non-occupational settings of Singhbhum Thrust Belt (STB). Due to medicinal and other economic values, these plants are used by the local people in their day to day life. Among the six species, Echinops echinatus excelled in the pick-up process of radionuclides. The rank decreased in the order: Echinops>Vitex>Cleistanthus>Ocimum>Holorrhoena>Lantana. (author). 14 refs., 2 tabs.
Directory of Open Access Journals (Sweden)
Brito, Adriana Maria de Oliveira
2016-01-01
Conclusões: A depleção suave de vitamina B12 na dieta, em nível não indutor de anemia, favoreceu o estado depressivo em ratos jovens, enquanto a sua suplementação na situação de depleção reverteu esse quadro. Em condições de nutrição adequada, entretanto, a suplementação dessa vitamina não exerceu efeito sobre o estado depressivo. Estes resultados estimulam a realização de mais estudos que aprofundem a avaliação das relações entre vitamina B12 e depressão em jovens. Além disso, este estudo também abre perspectivas para um novo modelo experimental de depressão, induzida por depleção de vitamina B12
Directory of Open Access Journals (Sweden)
Fernando Arbelaéz
1965-05-01
Full Text Available Es muy agradable tener en Atenas un amigo como Cayetano. Oigo mi propio idioma, y su música es una especie de anestesia muy suave para mis pensamientos. El mundo me parece grotesco, gesticulante y me produce miedo en algún lugar secreto de la mente. Escribo con una facilidad que me sorprende; pero ya se que esto no es más que el resultado de ese sutil mecanismo que reemplaza las pasiones para que podamos subsistir: el rojo de la lujuria va tomando los dorados colores del orgullo con el repique de la máquina. No creo que haya escrito con tanta fluidez y por tan largo tiempo. Es evidente, el ejercicio de teclear descansa los nervios y la concentración descansa el espíritu, así estemos meditando en nuestras propias miserias.
Directory of Open Access Journals (Sweden)
Jandiê Araújo da Silva
2009-04-01
environment. The present work had the objective to compare the effect of natural extracts on the control of Fusarium oxysporum f. sp tracheiphlum, originated from seeds of cowpea (Vigna unguiculata L, compared to chemical fungicide effect. Extracts of Allium sativum, Anadenanthera colubrine, and Ocimum basilicum were used alone or in combination with Mancozeb. A 50 µL aliquot of each treatment was added in a hole (6 mm of diameter made in the center of Petri dishes with BDA and a fungus mycelia disk was inoculated on it. Evaluations were done during seven days, measuring the pathogen mycelial growth. Seeds of cowpea were disinfected with sodium hypochlorite, sowed in plastic bags with autoclaved soil. Eight days after germination, wounds were made on the basal part of the plantlets, and fungus spore suspension (1.4 x 10-5 con/mL was applied on it. Evaluations of the disease severity were accomplished daily during 30 days after inoculation, using a disease index. Combination of extracts of A. sativum + Ocimum basilicum and Anadenanthera colubrina + Ocimum basilicum did not reduce fungus mycelial growth, whereas Ocimum basilicum extract alone showed minor mycelial growth, indicating fungicide action of this treatment on F. oxysporum f. sp tracheipphlum under the conditions studied. Combination of Mancozeb + Anadenanthera colubrina was responsible for lower average of severity on the evaluated plants.
Directory of Open Access Journals (Sweden)
Julián Mauricio Ágredo Hoyos
2012-06-01
Full Text Available Pseudocercospora griseola, the etiologic agent of angular leaf spot of common bean (Phaseolus vulgaris, is an important disease in all bean-producing regions worldwide and may cause extremely high yield losses. The control of this disease is made more difficult by the pathogen's genetic variability and the inefficiency of fungicides. In this study, of 26 essential oils tested at different concentrations, 25 demonstrated efficiency in affecting the germination of strains 63-31 and 63-63 of the pathogen, reaching inhibition levels of between 80% and 100%. Cymbopogon citratus and Cymbopogon martinii inhibited conidia germination at all concentrations; Eugenia caryophyllata, Cinnamomum sp., Thymus vulgaris, Matricaria recutita, Cordia verbenacea, Origanum vulgare, Cymbopogon nardus, at 0.1 and 0.5%; and Zingiber officinale, Mentha arvensis, Chamaecyparis pisifera, Lavandula officinalis, Ocimum basilicum, Pimpinella anisum, Ocimum selloi, Baccharis dracunculifolia, Laurus nobilis, Citrus sinensis, Melaleuca alternifolia and Eucalyptus globulus, at 0.5%. The main constituents identified were cinnamaldehyde in Cinnamomum sp.; eugenol in E. caryophyllata; trans-β-farnesene in M. recutita; pulegone in C. verbenacea; thymol in T. vulgaris; geranial and neral in C. citratus, and geraniol in C. martini. Through transmission electron microscopy (TEM, it was verified that C. citratus, C. martini and E. caryophyllata presented direct fungitoxic action on P. griseola, causing severe damage to the cellular ultrastructure of the conidia, invalidating germination. These results indicated that essential oils are a promising alternative strategy for the control of angular leaf spot in bean, representing less risk to human health and the environment.Pseudocercospora griseola, agente etiológico da mancha angular do feijoeiro comum (Phaseolus vulgaris, é uma doença importante nas regiões produtoras de feijão em todo o mundo e pode causar perdas de produtividade
La simulación condicional en geoestadística
Directory of Open Access Journals (Sweden)
Elmidio Estévez-Cruz
2000-03-01
Full Text Available La estimación propuesta por la geoestadística a través del procedimiento de krigeage es sin lugar a dudas la mejor posible, pues aporta el mejor estimador lineal insesgado; una muestra de ello es el número creciente de aplicaciones en ciencias de la Tierra donde es utilizada actualmente: la industria minera, la industria del petróleo, los estudios ambientales, etc. Este estimador de acuerdo con las condiciones con que es obtenido, muestra una imagen suave de la realidad que se estudia; una alternativa para esta situación es la simulación, que tiene como objetivo presentar una de las posibles realizaciones de una función aleatoria con las mismas características de variabilidad espacial que esta realidad. En este artículo se presentan los elementos fundamentales de la teoría de la simulación condicional.
Bioinspired polarization navigation sensor for autonomous munitions systems
Giakos, G. C.; Quang, T.; Farrahi, T.; Deshpande, A.; Narayan, C.; Shrestha, S.; Li, Y.; Agarwal, M.
2013-05-01
Small unmanned aerial vehicles UAVs (SUAVs), micro air vehicles (MAVs), Automated Target Recognition (ATR), and munitions guidance, require extreme operational agility and robustness which can be partially offset by efficient bioinspired imaging sensor designs capable to provide enhanced guidance, navigation and control capabilities (GNC). Bioinspired-based imaging technology can be proved useful either for long-distance surveillance of targets in a cluttered environment, or at close distances limited by space surroundings and obstructions. The purpose of this study is to explore the phenomenology of image formation by different insect eye architectures, which would directly benefit the areas of defense and security, on the following four distinct areas: a) fabrication of the bioinspired sensor b) optical architecture, c) topology, and d) artificial intelligence. The outcome of this study indicates that bioinspired imaging can impact the areas of defense and security significantly by dedicated designs fitting into different combat scenarios and applications.
Dicty_cDB: Contig-U12922-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 2e-11 2 ( EA053492 ) Sequence 221 from patent US 7157621. 62 2e-11 4 ( DY329960 ) OB_MEa0004O04.r OB_MEa Ocimum basil...hql*mvfiknfkkkkkkkk Frame B: llaywxyyyyskyifvyt*niyk*fllvvnfv*lisivsnf*nnkekkngxk...CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 70 2e-10 (A4JHJ8) RecName...... 56 4e-06 CP000852_1193( CP000852 |pid:none) Caldivirga maquilingensis IC-16... 55 5e-06 ...cc*frfw**awklw*i fr*sk*rgys*icmhfnfignqks*f*tksiinwwwyc*fy*cgchfqryh*sn*rvs** yh*iksfhfr*krwsklsigfttyernws*ity
Directory of Open Access Journals (Sweden)
OANA-IRINA PATRICIU
2017-06-01
Full Text Available It is well known that growth and morphogenesis of plant tissue cultures can be improved by small amounts of some organic compounds. Heterocyclic compounds such as chromanones and thiazoles derivatives, valuable because of their potential biological activities, have also been reported as pesticides, herbicides and plant-growth regulators. In the present study, different concentrations of chromanones and thiazoles derivatives were employed to evaluate their effects on plantlets growth of Ocimum basilicum L. and Echinacea purpurea L. The studied compounds were proved to be growth inhibitors at high concentrations. A growth stimulation effect was registered at low concentration.
Antimicrobial activity of various extracts of Ocimum basilicum l. and ...
African Journals Online (AJOL)
While the chloroform and acetone extracts had no effect, the methanol extracts showed inhibition zones against strains of Pseudomonas aeruginosa, Shigella sp., Listeria monocytogenes, Staphylococcus aureus and two different strains of Escherichia coli. The cells of microorganisms, which were treated and untreated with ...
Antimicrobial activity of essential oils of Ocimum gratissimum l. from ...
African Journals Online (AJOL)
) of 13 populations of different silvicultural zones were evaluated for antimicrobial activity against Gram positive (Staphylococcus aereus, Bacillus spp.) and Gram negative (Escherichia coli, Pseudomonas aeruginosa, Samonella typhi, ...
In vitro regeneration of a common medicinal plant, Ocimum sanctum ...
African Journals Online (AJOL)
aristo_team
brings down circulatory strain, mitigates cardiovascular depressant, is antiulcer, fights .... DISCUSSION. Proficient regeneration systems are vital for hereditary. 0. 10. 20 .... Hao D, Xiao P (2015). Genomics and Evolution in Traditional Medicinal.
Evaluation of nootropic potential of Ocimum sanctum Linn. in mice.
Joshi, Hanumanthachar; Parle, Milind
2006-02-01
Dementia is one of the age related mental problems and a characteristic symptom of various neurodegenerative disorders including Alzheimer's disease. Certain drugs like diazepam, barbiturates and alcohol disrupt learning and memory in animals and man. However, a new class of drugs known as nootropic agents is now used in situations where there is organic disorder in learning abilities. The present work was undertaken to assess the potential of O. sanctum extract as a nootropic and anti-amnesic agent in mice. Aqueous extract of dried whole plant of O. sanctum ameliorated the amnesic effect of scopolamine (0.4 mg/kg), diazepam (1 mg/kg) and aging induced memory deficits in mice. Elevated plus maze and passive avoidance paradigm served as the exteroceptive behavioral models. O. sanctum extract decreased transfer latency and increased step down latency, when compared to control (piracetam treated), scopolamine and aged groups of mice significantly. O. sanctum preparations could of beneficial in the treatment of cognitive disorders such as dementia and Alzheimer's disease.
Effects of aqueous leaves extract of Ocimum gratissimum on blood ...
African Journals Online (AJOL)
SERVER
2007-09-19
Sep 19, 2007 ... African Journal of Biotechnology Vol. 6 (18), pp. ... Full Length Research Paper. Effects of ... blood glucose level (P<0.05) of the diabetic rats by 81.3% after 24 h of extract administration. ..... The endocrine pancreas and the.
Directory of Open Access Journals (Sweden)
Flávio Rabelo Versiani
2007-06-01
Full Text Available This article examines the question of the supposedly benign character of Brazilian slavery in contrast with North America slavery. In economic analyses of slavery, coercion toward slaves is viewed as a means to achieve maximum output, especially in large-scale agriculture. In small slave holdings, however, coercion was generally inefficient for that purpose, and positive incentives tended to be preferred. It is argued that, as recent evidence on Brazil has shown that small slave holdings prevailed in various regions and periods, this may lend empirical support to the notion of a relatively benign slavery, using more incentives than coercion.
Directory of Open Access Journals (Sweden)
H.T.R. Amaro
2012-01-01
Full Text Available O objetivo do trabalho foi avaliar a eficiência de tratamentos pré-germinativos na superação da dormência de sementes de manjericão, produzidas no Horto de Plantas Medicinais da Unimontes, em fevereiro de 2011. Foram realizadas as seguintes determinações para avaliação da qualidade fisiológica das sementes: teor de água, germinação, primeira contagem de germinação, emergência de plântulas e índice de velocidade de emergência. O delineamento experimental utilizado foi inteiramente casualizado com quatro repetições de 50 sementes por tratamento, sendo T1- testemunha; T2 - pré esfriamento das sementes em câmara tipo BOD sob temperatura de 10ºC por 4 dias; T3 - embebição das sementes em água destilada por 24 horas; T4 - embebição das sementes em solução contendo KNO3 a 0,2 % por 5 minutos e T5 - sementes submetidas em água destilada a temperatura de 70ºC por 5 minutos. Os dados foram submetidos à análise de variância e as médias comparadas pelo teste Scott - Knott a 5% de probabilidade. O tratamento pré esfriamento em câmara tipo BOD a 10ºC por 4 dias reduz a dormência e promove incrementos na qualidade fisiológica das sementes do manjericão.Aiming in order to assess the effectiveness of treatments to overcome dormancy in seeds of basil, an experiment was conducted at the Laboratory of Seed Analysis of Unimontes. Following determinations were performed to evaluate the physiological quality of seeds, water content, germination, first count germination, seedling emergence and emergence speed index. The experimental design was completely randomized design with four replications of 50 seeds per treatment, which consisted of: T1 - control, T2 - pre-cooling of the seed chamber BOD at a temperature of 10ºC for 4 days, T3 - soaking the seeds in water distilled for 24 hours, T4 - soaking the seeds in a solution containing 0,2% for 5 minutes and T5 - submitted seeds in distilled water at 70ºC for 5 minutes. Data were subjected to analysis of variance and the averages compared by Scott-Knott 5% probability. The pre-cooling treatment in BOD chamber at 10ºC for 4 days reduced dormancy and promotes increases in the physiological quality of seeds of basil.
Directory of Open Access Journals (Sweden)
Eva Patricia Vásquez Gómez
2016-06-01
Full Text Available El objetivo del presente trabajo es presentar la descripción y análisis de las interacciones entre estudiantes participantes en una actividad pedagógica llevada a cabo en un curso de pregrado de educación superior, en el segundo semestre de 2013, en una universidad regional de Colombia (Universidad de Cundinamarca, sede Fusagasugá, utilizando el Análisis de Redes Sociales (ARS [1]; y, de igual forma, determinar si el comportamiento de los individuos en la red de alguna manera influye en el rendimiento académico individual y grupal. La tutora (coautora de este trabajo estableció un entorno colaborativo como estrategia de aprendizaje utilizando Facebook, donde la comunidad del curso podía participar aportando y debatiendo sobre el tema de estudio relacionado con la aplicación de metodologías de sistemas suaves (MSS en la resolución de problemas no estructurados [2].
SÍNTESE DO 2-ALIL-4-CLORO-6-ISOPROPIL-3-METILFENOL A PARTIR DO TIMOL
Directory of Open Access Journals (Sweden)
Ana Flávia Nunes de Paula Azevedo
2017-01-01
Full Text Available A industria agroquímica busca apresentar compostos cada vez mais eficientes, seletivos e seguros sob a perspectiva ambiental. Nesse contexto, a síntese de novos compostos ativos partindo de materia-prima natural apresenta-se como forte alternativa. Os sistemas catalíticos, que utilizam condições suaves de temperatura e pressão e apresentam grande rendimento mostram-se extremamente eficientes e tem conquistado seu espaço nas pesquisas agroquimicas, bem como a sintese de clorofenois usando ions cloreto como fonte de cloro e um oxidante adequado. O presente trabalho propos sintetizar um composto inédito análogo ao herbicida dicamba, partindo do timol, um fenol de origem natural. Seguindo uma rota de sintese em tres etapas, que teve rendimento global de 84% pode-se desenvolver o composto 2-alil-4-cloro-6-isopropil-3-metilfenol, que foi caracterizado por espectrometria de massas e infravermelho.
Directory of Open Access Journals (Sweden)
William Oswaldo Chamorro Hernández
2018-03-01
Full Text Available Este documento presenta una comparación entre dos técnicas lineales de controladores conocidos como PI-LOR y MPC con restricciones suaves aplicada a un proceso de cuatro tanques acoplados, cuyas características principales son las no linealidades, múltiples entradas y salidas y una dinámica lenta. El modelo es linealizado alrededor de un punto de funcionamiento utilizando un método de optimización, denominado mínimos cuadrados. Además, se presenta una formulación matemática general para ambos controladores que puede ser fácilmente extendida a cualquier control de procesos. Todo el procedimiento es descrito en detalle, así como los resultados de la simulación para ambos controladores. Para lograr una comparación real del rendimiento, los datos experimentales son obtenidos en las mismas condiciones y se analizaron todos los parámetros de respuesta.
Directory of Open Access Journals (Sweden)
LUCAS PÉREZ-HERNÁNDEZ
2010-01-01
Full Text Available En este artículo se propone una alternativa eficiente para la simulación automática de fallas en sistemas de potencia a partir de una estrategia cooperativa entre Matlab â y el ATP. Esta estrategia de simulación permite reducir el tiempo para la obtención de una base de datos de fallas, tal como lo demuestran los resultados comparativos obtenidos en el caso de cuatro sistemas diferentes, donde se obtuvieron reducciones promedio del 96% en el tiempo de simulación, con respecto al tiempo de simulación obtenido con las metodologías clásicas. Las bases de datos obtenidas a partir de las simulaciones son normalmente utilizadas para ajustar herramientas de computación suave aplicadas a la resolución de problemas, tal como el aquí referenciado y asociado a la localización de fallas en sistemas de distribución de energía eléctrica.
Semiótica y cuerpo: Taichichuan
Directory of Open Access Journals (Sweden)
ÁNGELA MARÍA DÍAZ MARTÍNEZ
2010-01-01
Full Text Available El cuerpo humano, visto desde la premisa del universo educacional, tanto en su fisiología como en su expresión lingüística, son fuentes complementarias irreductibles de aprendizaje y sabiduría. En disciplinas como el Taichichuan, se percibe procesos de aprendizaje mediadores por una práctica epistemológica que devela las concepciones semióticas aplicadas al campo de la acción corporal. El ser humano y su lenguaje corporal trascienden en una cuestión multidimensional. Así, el cuerpo revela una enorme riqueza en actitudes, gestos, señales y comportamientos que precisan saberes y significaciones consolidadas. Este artículo quiere destacar el arte del Taichichuan como una disciplina física y mental que se fundamenta a través de sus características paralingüísticas-gestos lentos, regulares, delicados, suaves, fluidos y armoniosos- que hacen parte de su significación en la Semiótica.
Directory of Open Access Journals (Sweden)
Patrícia Shima Luize
2005-03-01
Full Text Available This study describes the screening of extracts obtained from 19 species of plants used in Brazilian traditional medicine for treatment of a variety of diseases. The extracts were tested against axenic amastigote and promastigote forms of Leishmania (L. amazonensis, and epimastigote forms of Trypanosoma cruzi in vitro at a concentration of 100 mg/ml. Baccharis trimera, Cymbopogon citratus, Matricaria chamomilla, Mikania glomerata, Ocimum gratissimum, Piper regnellii, Prunus domestica, Psidium guajava, Sambucus canadensis, Stryphnodendron adstringens, Tanacetum parthenium, and Tanacetum vulgare showed significant effects against one or both parasites, with a percentage of growth inhibition between 49.5 and 99%. The extracts showed no cytotoxic effect on sheep erythrocytes. These medicinal plants may be sources of new compounds that are clinically active against L. amazonensis and T. cruzi.Este estudo descreve a triagem de extratos obtidos de 19 espécies de plantas usadas na medicina tradicional brasileira para o tratamento de várias doenças. Os extratos foram testados contra formas amastigota axênica e promastigota de Leishmania (L. amazonensis, e formas epimastigota de Trypanosoma cruzi in vitro na concentração de 100 mg/ml. Baccharis trimera, Cymbopogon citratus, Matricaria chamomilla, Mikania glomerata, Ocimum gratissimum, Piper regnellii, Prunus domestica, Psidium guajava, Sambucus canadensis, Stryphnodendron adstringens, Tanacetum parthenium, e Tanacetum vulgare apresentaram efeito significante contra um ou ambos parasitas, com a porcentagem de inibição de crescimento entre 49,5 e 99%. Os extratos não mostraram efeito citotóxico em hemácias de carneiro. Essas plantas medicinais podem ser fontes alternativas de novos compostos clinicamente ativos contra L. amazonensis e T. cruzi.
Directory of Open Access Journals (Sweden)
G. G. SANTOS
2011-04-01
Full Text Available
O presente trabalho teve como objetivo avaliar a atividade antimicrobiana, in vitro, dos óleos essenciais extraÃdos de Lippia alba (Mill N. E. Brown e Ocimum basilicum frente a microrganismos isolados de carnes bovinas. Os óleos foram extraÃdos por hidrodestilação e caracterizados quanto à composição por cromatograï¬ a gasosa. A concentração inibitória mÃnima (CIM e concentração bactericida mÃnima dos óleos (CBM foram determinadas pelo método de microplacas utilizando concentrações de óleos entre 0,39 e 25μg/mL. Foram utilizadas suspensões de diferentes cepas de Escherichia coli, Staphylococcus aureus e Salmonella sp. na concentração de 0,5x104 UFC/mL. O óleo de Lippia alba N.E. Brown apresentou maior eï¬ ciência como agente bacteriostático e bactericida frente à s diferentes cepas de Staphylococcus aureus e Salmonella sp. isoladas de carnes bovinas do que o óleo essencial de Ocimum basilicum (cultivar “Maria Bonitaâ€, o qual foi mais efetivo frente à s cepas de Escherichia coli. Além disto, os óleos essenciais apresentaram atividade antimicrobiana em concentrações muito menores do que as obtidas por outros pesquisadores.
Screening of Antibacterial Activities of Essential Oils from Selected Medicinal Plants
International Nuclear Information System (INIS)
Le Le Phyo; Moe Moe Thwe; Mar Lar Than
2010-12-01
Essential oils were extracted from the five medicinal plants (Syzygium aromaticum Linn, Cinnamoum tamala. Nees, Piper betle. Linn, Ocimum sanctum, Clausena exacavata Burn) by steam distillation method and percolation method with petroleum ether. These plants do not contain cyanogenic glycosides according to phytochemical tests. Essential oils from these plants were also tested on antimicrobial activity by agar well diffusion method. It was observed that essential oils extracted from these five plants have various effects on Gram-positive and Gram-negative bacteria and fungus. Among them, essential oils of Syzygium aromaticum possess the highest antimicrobial activity aganist all test organisms. B. pumalis and Calbican are the most susceptible to the five plants.
CARACTERIZACIÓN FÍSICO-QUÍMICA DEL ACEITE ESENCIAL DE ALBAHACA. II
Directory of Open Access Journals (Sweden)
Elizabeth Murillo
2008-03-01
Full Text Available Se estudió la composición química del aceite esencial de Ocimum americanum L. (albahaca querendona morada obtenido por hidrodestilación de vegetales recolectados en Chapetón-Ibagué. El análisis realizado por cromatografía de gases de alta eficiencia/detector selectivo de masas (HRGC/MSD reveló que la esencia está constituida en un 85,4% por cinamato de metilo y un 5% de estragol. Adicionalmente, se caracterizó el aceite esencialmediante la determinación de la densidad, índice de refracción, pH, solubilidad y los espectros IR y UV.
Screening of Antibacterial Activities of Essential Oils from Selected Medicinal Plants
Energy Technology Data Exchange (ETDEWEB)
Phyo, Le Le; Thwe, Moe Moe; Than, Mar Lar
2010-12-15
Essential oils were extracted from the five medicinal plants (Syzygium aromaticum Linn, Cinnamoum tamala. Nees, Piper betle. Linn, Ocimum sanctum, Clausena exacavata Burn) by steam distillation method and percolation method with petroleum ether. These plants do not contain cyanogenic glycosides according to phytochemical tests. Essential oils from these plants were also tested on antimicrobial activity by agar well diffusion method. It was observed that essential oils extracted from these five plants have various effects on Gram-positive and Gram-negative bacteria and fungus. Among them, essential oils of Syzygium aromaticum possess the highest antimicrobial activity aganist all test organisms. B. pumalis and Calbican are the most susceptible to the five plants.
Phytotoxic Activities of Mediterranean Essential Oils
Directory of Open Access Journals (Sweden)
Luiz Fernando Rolim de Almeida
2010-06-01
Full Text Available Twelve essential oils from Mediterranean aromatic plants were tested for their phytotoxic activity, at different doses, against the germination and the initial radicle growth of seeds of Raphanus sativus, Lactuca sativa and Lepidium sativum. The essential oils were obtained from Hyssopus officinalis, Lavandula angustifolia, Majorana hortensis, Melissa officinalis, Ocimum basilicum, Origanum vulgare, Salvia officinalis and Thymus vulgaris (Lamiaceae, Verbena officinalis (Verbenaceae, Pimpinella anisum, Foeniculum vulgare and Carum carvi (Apiaceae. The germination and radicle growth of tested seeds were affected in different ways by the oils. Thyme, balm, vervain and caraway essential oils were more active against both germination and radicle elongation.
Sou, então, pintura: em torno de auto-retratos de Iberê Camargo
Directory of Open Access Journals (Sweden)
Lucia Teixeira
2005-06-01
Full Text Available O artigo analisa auto-retratos de Iberê Camargo, fixando-se especialmente nos auto-retratos de 1943 e de 1984, em que a questão do tempo se manifesta tanto na cronologia que diferencia as duas concepções de pintura quanto na gestualidade que marca o ritmo e o andamento como categorias enunciativas da pintura. Se no auto-retrato de 1943 o ritmo é suave, quase etéreo, criando efeitos de harmonia e integração, no quadro de 1984 a gestualidade brusca acelera e confunde o tempo da pintura, conferindo-lhe um andamento veloz e um efeito de inacabamento e imperfeição. É a inscrição do tempo na matéria pictórica que transforma a representação, alterando assim a relação intersubjetiva entre observador e pintor.Este artículo analiza autorretratos de Iberê Camargo, en particular los autorretratos de 1943 y de 1984. El tema del tiempo se manifiesta tanto en la cronología que diferencia dos concepciones de pintura como en la gestualidad que marca el ritmo y el desarrollo como categorías enunciativas de la pintura. Mientras que en el autorretrato de 1943 el ritmo es suave, casi etéreo, creando efectos de armonía e integración, en el cuadro de 1984 la gestualidad brusca acelera y confunde el tiempo de la pintura, resultando en un desarrollo veloz y en un efecto inacabado de imperfección. La inscripción del tiempo en la matéria prictórica transforma la representación y altera de esta forma la relación intersubjetiva entre observador y pintor.The paper analyses Iberê Camargo's self-portraits, in particular his 1943 and 1984 paintings, in which the issue of time manifests itself both in the chronology which distinguishes the two conceptions of painting and in action which marks the rhythm and pace as enunciative categories of painting. In the self-portrait of 1943 the rhythm is soft, almost ethereal; in the 1984 painting, the abrupt action accelerates and disarrays the time of the painting, resulting in a fast pace and an effect of
Market research completed in El Salvador.
1983-01-01
Intensive market research, completed in El Salvador for the contraceptive social marketing project of the Asociacion Demografica Salvadorena (ADS), was designed to obtain a better understanding of Salvadoran usage of and attitudes toward contraceptives in general and ADS products in particular. The research results are being used to develop a new marketing plan for the Contraceptive Social Marketing (CSM) program as it works to increase the program's effectiveness in reaching consumers. Points-of-purchase (retail outlets) were surveyed in November 1982 to study brand presence and vendor perceptions of consumer behavior in order to define the market in terms of products, prices, and distribution. Focus groups were conducted during November and December 1982 to probe consumer awareness and attitudes regarding methods, brands, and purchasing behavior. The results of the focus groups helped guide the development of a door-to-door consumer survey conducted from December 1982 through February 1983 to further define the market in terms of consumer size and characteristics. Personal interviews were conducted with the owner or manager of each of 247 pharmacies selected at random but in proportion to their distributional weight as to location. Aragon and Associates found that standard-dose orals and condoms were sold in 86% of the outlets surveyed and foaming tablets and low-dose pills in 37%. In terms of brand presence in outlets, the CSM products Perla (orals) and Condor (condom) both led their respective categories. In the foaming tablet category Suave had the lowest presence and Neo Sampoon the highest. The difference between reported and actual presence of contraceptives in the outlets was significant: 32% of the sellers of Perla, 18% of the sellers of Condor, and 26% of the sellers of Suave were out of stock at the time of the survey. The difference in average CSM product prices and the next lowest priced brands is very large. Dealers reported that their contraceptive
Directory of Open Access Journals (Sweden)
A.M. Borges
2012-01-01
Full Text Available O presente trabalho teve como objetivo a caracterização de plantas frescas e secas (comerciais de alfavaca, orégano e tomilho, a obtenção dos óleos essenciais através do método de arraste a vapor e a quantificação dos compostos químicos por CG/EM. As plantas frescas e as secas comerciais foram submetidas às análises de umidade, extrato etéreo, proteína, fibra bruta, cinzas, extrato não nitrogenado, valor calórico, teor de óleo essencial e identificação dos compostos majoritários através da cromatografia gasosa-espectrometria de massas. Dentre a caracterização obtida os resultados na base seca mostraram-se promissores, sendo o teor de proteína e de cinzas na alfavaca seca comercial com 17,34 g 100 g-1 e 8,12 g 100 g-1, respectivamente; a fibra bruta no orégano seco comercial com 15,65 g 100 g-1; o extrato etéreo, o extrato não nitrogenado e o valor calórico no tomilho seco comercial com 9,30 g 100 g-1, 52,72 g 100 g-1 e 356,74 Kcal 100 g-1, respectivamente. Obteve-se o maior rendimento de óleo essencial na alfavaca seca comercial com 1,02%, enquanto a alfavaca fresca apresentou o menor rendimento, com apenas 0,13%. Na alfavaca fresca encontrou-se 87,38% de eugenol e 6,27% de timol, enquanto na alfavaca seca comercial observou-se redução no eugenol (71,12% e aumento do timol (13,28%. No orégano fresco foram quantificados quatro picos o γ-terpineno (33,45%, 4-terpineol (25,59%, timol (14,21% e carvacrol (2,30%. Já no óleo essencial de orégano seco comercial houve redução no γ-terpineno (28,73% e aumento no 4-terpineol (27,58%, timol (19,71% e carvacrol (3,67%. No óleo essencial do tomilho fresco foram quantificados três picos o borneol (66,66%, timol (13,41% e linalol (3,24%. Por outro lado, no óleo essencial do tomilho seco comercial houve redução no borneol (37,90% e aumento no timol (20,61% e linalol (10,34%. Pode-se concluir que as folhas secas comerciais analisadas de alfavaca, orégano, e tomilho apresentam potencial para o enriquecimento dos alimentos ou para a obtenção dos óleos essenciais.This study aimed to characterize commercial fresh and dry medicinal plants (basil, oregano and thyme, to obtain essential oil by the steam distillation method and to quantify chemical compounds by means of GC/MS. The fresh and dry plants were subjected to the following analyses moisture, ether extract, protein, crude fiber, ash, non-nitrogenous extract, caloric value, essential oil content and identification of major compounds by gas chromatography-mass spectrometry. Considering the obtained characterization, the following results on dry basis proved promising: protein and ash content in commercial dry basil with 17.34 g 100 g-1 and 8.12 g 100 g-1, respectively; crude fiber in commercial dry oregano with 15.65 g 100 g-1; ether extract, non-nitrogenous extract and caloric value in commercial dry thyme with 9.30 g 100 g-1, 52.72 g 100 g-1 and 356.74 Kcal 100 g-1, respectively. The highest essential oil yield was obtained for commercial dry basil with 1.02% and the lowest yield was obtained for fresh basil with only 0.13%. Chromatography indicated 87.38% eugenol and 6.27% thymol in fresh basil. For commercial dry basil, the chromatogram showed a reduction in eugenol (71.12% and an increase in thymol (13.28%. Four peaks were quantified for fresh oregano the γ-terpinene (33.45%, 4-terpineol (25.59%, thymol (14.21% and carvacrol (2.30%. For the essential oil of commercial dry oregano, there was a decrease in γ-terpinene (28.73% and an increase in 4-terpineol (27.58%, thymol (19.71% and carvacrol (3.67%. In the chromatogram of the essential oil of fresh thyme, three peaks were quantified: borneol (66.66%, thymol (13.41% and linalool (3.24%. On the other hand, in the chromatogram of the essential oil of commercial dry thyme, there was a decrease in borneol (37.90% and an increase in thymol (20.61% and linalool (10.34%. It can be concluded that commercial dry leaves of basil, oregano and thyme are feasible to enrich foods or to obtain essential oils.
Directory of Open Access Journals (Sweden)
Adilson Sartoratto
2004-12-01
Full Text Available Essential oils from aerial parts of Mentha piperita, M. spicata, Thymus vulgaris, Origanum vulgare, O. applii, Aloysia triphylla, Ocimum gratissimum, O. basilicum were obtained by steam destillation using a Clevenger-type system. These oils were screened for antibacterial and anti-Candida albicans activity using bioautographic method. Subsequently, minimal inhibitory concentration from oils was determined by microdilution method. Most essential oil studied were effective against Enterococcus faecium and Salmonella cholerasuis. Aloysia triphylla and O. basilicum presented moderate inhibition against Staphylococcus aureus while only A. tryphila and M. piperita were able to control the yeast Candida albicans. The oils were analyzed by GC and GC-MS techniques in order to determine the majoritary compounds.Óleos essenciais foram obtidos a partir das partes aéreas de Mentha piperita, M. spicata, Thymus vulgaris, Origanum vulgare, O. applii, Aloysia triphylla, Ocimum gratissimum e O. basilicum através de arraste de vapor em sistema tipo Clevenger. Os óleos foram avaliados quanto à atividade antimicrobiana contra bactérias e contra a levedura Candida albicans pelo método de bioautografia. A concentração mínima inibitória dos óleos com atividade positiva foi em seguida determinada pelo método da microdiluição. De acordo com os resultados, a maioria dos óleos essenciais estudados foram efetivos contra Enterococcus faecium e Salmonella cholerasuis. A.triphylla e O. basilicum apresentaram inibição moderada contra Staphylococcus aureus enquanto apenas A. tryphila e M. piperita foram capazes de inibir a levedura Candida albicans. Os óleos foram analisados quimicamente por técnicas de CG e CG-EM de modo a determinar os compostos majoritários presentes.
pollen grain morphology of three species and a variety of ocimum
African Journals Online (AJOL)
MR PRINCE
Heptacol- pate and octacolpate pollen grains which are advanced types of pollen grains were encountered in O. canum only. .... shape. The two types of aperture, the colpi and the pores were present in the four taxa. Colpi ... pate (Plates 2 A, B, C), Hexazonocolpate (Plate ... shape (Plate 2 H & J), Ribbon-like shape (Plate.
Radioprotective effect of leaf extract of Indian medical plant Ocimum sanctum
Energy Technology Data Exchange (ETDEWEB)
Uma Devi, P; Ganasoundari, A [Kasturba Medical College, Manipal (India). Dept. of Radiology
1995-03-01
Water or aqueous ethanol extract of O.sanctum was given ip, either as a single dose or multiple doses, before a whole-body exposure to 11 Gy(LD{sub 100/30}) of {sup 60}Co gamma radiation in albino mice. The water extract was more effective and less toxic than the aqueous ethanol extract. An optimum ip dose of 50 mg/kg (<1/100 LD{sub 50}) of the water extract, at 10 mg/kg/day for 5 consecutive days, gave the maximum survival. Increasing the dose per treatment or the number of treatments did not increase protection. Intraperitoneal administration gave the best protection (70% survival). Other routes (im, iv and po) were less effective and produced 37-47% survival. The optimum dose (ip) gave a dose modifying factor of 1.28. Since the extract may contain a number of chemical compounds, it is not possible to attribute the observed protection to any particular compound at present. (author). 10 refs., 5 figs., 3 tabs.
Bioactivity of basil ( Ocimum basicilum L.) on control of the spider ...
African Journals Online (AJOL)
Essential plant oils contain biopesticides that could be used to control many crop pests. Tetranychus spp. are mites that cause damage to several crops and are primarily controlled by synthetic pesticides. Literature showed that mites can be controlled with essential oils of plants containing eugenol. In this work, we ...
Effect of silica Nanoparticles on Basil (Ocimum basilicum Under Salinity Stress
Directory of Open Access Journals (Sweden)
Manizheh Kalteh
2014-08-01
Full Text Available Application of nanofertilizers is one of the promising methods for increasing resources use efficiency and reducing environmental pollutions. Uncontrolled application of chemical fertilizer and pesticides has caused many problems to human health and domestic animals. Nanofertilizers application could be a suitable way to reduce these problems. Accordingly, in order to assess the silicon nanoparticles effect on some vegetative features of basil under salinity stress, a factorial experiment based on a completely randomized design with three replications was conducted in greenhouse condition. Treatments included different levels of silicon fertilizer (without silicon, normal silicon fertilizer and silicon nanoparticles and salinity stress (1, 3 and 6 ds/m. Physiological traits (chlorophyll and proline content of leaves and morphological traits (shoot fresh weight and dry weight were investigated in this study. Results showed a significant reduction in growth and development indices due to the salinity stress. Leaf dry and fresh weight reduced by increment in NaCl concentration while significantly (P≤0.01 increased with silicon nanoparticles application. The chlorophyll content reduced in salinity stress, but increased by silicon nanoparticles treatment. Proline content increased under salinity stress which was a response to stress. Moreover, proline increased by silicon nanoparticles which was due to tolerance induction in plant. Silicon nanoparticles application reduced the pollution effects originated from salinity in Basil.
Mass attenuation coefficients of X-rays in different medicinal plants
Energy Technology Data Exchange (ETDEWEB)
Morabad, R B [Department of Post-Graduate Studies and Research in Physics, Gulbarga University, Gulbarga 585106, Karnataka (India); Kerur, B.R. [Department of Post-Graduate Studies and Research in Physics, Gulbarga University, Gulbarga 585106, Karnataka (India)], E-mail: kerurbrk@yahoo.com
2010-02-15
The mass attenuation coefficients of specific parts of several plants, (fruits, leaves, stem and seeds) often used as medicines in the Indian herbal system, have been measured employing NaI (TI)) detector. The electronic setup used is a NaI (TI) detector, which is coupled to MCA for analysis of the spectrum. A source of {sup 241}Am is used to get X-rays in the energy range 8-32 keV from Cu, Rb, Mo, Ag and Ba targets. In the present study, the measured mass attenuation coefficient of Ocimum sanctum, Catharanthus roseus, Trigonella foenum-graecum, Azadirachta indica, Aegle marmelos, Zingiber officinalis, Emblica officinalis, Anacardium occidentale, Momordica charantia and Syzygium cumini show a linear relation with the energy.
Dicty_cDB: Contig-U15609-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available H641784 ) CHO_OF4972xp21r1.ab1 CHO_OF4 Nicotiana tabacum ge... 54 0.002 2 ( DY336731 ) OB_SEa04L12.r OB_SEa Ocimum basil...nt WO2007093776. 38 0.029 3 ( DQ508732 ) Perkinsus marinus delta9-elongating activity prot... 38 0.029 3 ( D...Y036171 ) CAIY2568.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.33 2 ( AW6512...9 2 ( EY042621 ) CAIY6316.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.39 2 ( EH069644 ) PMDAD81TO Perki...nsus marinus small insert cDNA lib... 38 0.41 2 ( EY042620 ) CAIY6316.rev CAIY Artemisia annua leaf Artemi
Mass attenuation coefficients of X-rays in different medicinal plants
International Nuclear Information System (INIS)
Morabad, R.B.; Kerur, B.R.
2010-01-01
The mass attenuation coefficients of specific parts of several plants, (fruits, leaves, stem and seeds) often used as medicines in the Indian herbal system, have been measured employing NaI (TI)) detector. The electronic setup used is a NaI (TI) detector, which is coupled to MCA for analysis of the spectrum. A source of 241 Am is used to get X-rays in the energy range 8-32 keV from Cu, Rb, Mo, Ag and Ba targets. In the present study, the measured mass attenuation coefficient of Ocimum sanctum, Catharanthus roseus, Trigonella foenum-graecum, Azadirachta indica, Aegle marmelos, Zingiber officinalis, Emblica officinalis, Anacardium occidentale, Momordica charantia and Syzygium cumini show a linear relation with the energy.
Soković, Marina; Glamočlija, Jasmina; Marin, Petar D; Brkić, Dejan; van Griensven, Leo J L D
2010-10-27
The chemical composition and antibacterial activity of essential oils from 10 commonly consumed herbs: Citrus aurantium, C. limon, Lavandula angustifolia, Matricaria chamomilla, Mentha piperita, M. spicata, Ocimum basilicum, Origanum vulgare, Thymus vulgaris and Salvia officinalis have been determined. The antibacterial activity of these oils and their main components; i.e. camphor, carvacrol, 1,8-cineole, linalool, linalyl acetate, limonene, menthol, a-pinene, b-pinene, and thymol were assayed against the human pathogenic bacteria Bacillus subtilis, Enterobacter cloacae, Escherichia coli O157:H7, Micrococcus flavus, Proteus mirabilis, Pseudomonas aeruginosa, Salmonella enteritidis, S. epidermidis, S. typhimurium, and Staphylococcus aureus. The highest and broadest activity was shown by O. vulgare oil. Carvacrol had the highest antibacterial activity among the tested components.
UN NUEVO ENFOQUE DEL CONTROL POR MODO DESLIZANTE PARA SISTEMAS MULTIVARIABLES
Directory of Open Access Journals (Sweden)
Rafael Angel Orellana Prato
2016-09-01
Full Text Available Este trabajo presenta el diseño de un sistema de control por modo deslizante (SMCr basado en alimentación adelantada (feedforward aplicado a un sistema multivariable, sintonizado para especificaciones de la respuesta transitoria, usando modelos de primer orden más tiempo muerto (POMTM. Como caso de estudio se presenta el modelo multivariable de dos entradas y dos salidas de una columna de destilación Wood and Berry, la cual presenta un alto índice de interacción. Las pruebas demostraron que la estrategia de control propuesta mejora el desempeño de un sistema de control multivariable ante cambios en los valores de referencia y rechazo a las perturbaciones, sin embargo, el tiempo de establecimiento de las variables controladas aumenta producto de dinámica considerada en el desacoplamiento. Se comprobó que en sistemas con alta interacción las señales de control tienen cambios más suaves lo que indica menor desgaste en los elementos finales de control.
Towards a complete characterisation of guaiacwood oil.
Tissandié, Loïc; Viciana, Stéphane; Brevard, Hugues; Meierhenrich, Uwe J; Filippi, Jean-Jacques
2018-05-01
Guaiacwood oil is a common perfume ingredient used in modern compositions for its suave woody-rosy scent. This essential oil is a byproduct of the timber industry obtained by hydrodistillation of the heartwood of Bulnesia sarmientoi, a tree native from Latin America. Despite being widely used in perfumery, guaiacwood oil has been poorly described in the past. This study aims at giving an in-depth characterisation of its chemical composition as well as disclosing the odorant compounds responsible for its characteristic fragrance. Our methodology was based on a combination of fractionation and analytical techniques, including comprehensive two-dimensional gas chromatography coupled to mass spectrometry and preparative capillary-gas chromatography. The entire analytical work led to the isolation of 20 constituents among which 14 have never been reported so far in natural extracts. Each isolated compound was fully characterised by spectroscopic methods. Finally, the accurate knowledge of the chemical composition permitted the identification of the odour-active constituents by gas chromatography-olfactometry. Copyright © 2018 Elsevier Ltd. All rights reserved.
Iglesia en Becerril de la Sierra, España
Directory of Open Access Journals (Sweden)
Coello de Portugal, Fray
1969-07-01
Full Text Available The main charm of this church depends on the right choice of the platform shape and of the extreme lightness of its thin shell roof, which is a hyperbolic paraboloid of slight curvature; its minimum thickness being 4 cm and its maximum thickness varies between 10 and 18 cm. Its general shape is reminiscent of a bird wing of smooth contours. The outstanding site and its beautiful colour harmony with the surrounding landscape increase the natural and spontaneous charm of this building.Toda la gracia de esta iglesia reside en la acertada elección formal de la planta y en la ingravidez de su cubierta laminar —que es un paraboloide hiperbólico de poca curvatura, con espesor mínimo de 4 cm y máximos de 10 y 18 cm— que la asemeja a un ave o a una hoja de suaves contornos. El emplazamiento privilegiado y el gran mimetismo conseguido con el paisaje circundante, aumentan el encanto natural y espontáneo del edificio.
Dispositivo Robótico Multifuncional para la Rehabilitación de las Extremidades Superiores
Directory of Open Access Journals (Sweden)
Aitziber Mancisidor
2018-03-01
Full Text Available En este trabajo se presenta un dispositivo de rehabilitación innovador por su flexibilidad y eficiencia denominado Universal Haptic Pantograph (UHP. Este robot, gracias a su estructura multi-configurable permite la rehabilitación del miembro superior con un único dispositivo. Además, se ha diseñado con la habilidad de realizar diferentes tareas asistivas y resistivas, pudiendo así adaptarse al estado de recuperación del paciente. Finalmente, el software Telereha genera un entorno de realidad virtual que facilita la ejecución del ejercicio y aumenta la motivación del paciente. El sistema de control del robot se ha implementado entiempo real con el fin de garantizar la correcta ejecución de las tareas de rehabilitación. Usando este sistema, se han realizado diferentes ensayos experimentales. Los resultados demuestran que el robot de rehabilitación UHP funciona correctamente con diferentes tareas de rehabilitación, realizando movimientos suaves y seguros que garantizan la seguridad del usuario.
Directory of Open Access Journals (Sweden)
García Ordoñez, Fernando
1968-05-01
Full Text Available This church design is based on the idea of enclosed and concentrated thought. Its light source is zenithal, from skylights at the top of the structure. It is shaped like a sailing boat, without comers or sharp edges, and seeks to enclose a smoothly contoured space, as most suitable to establish a mental encounter with the Almighty. The whole project is in concrete; the formwork being of exceptional quality. Both its formal concept emd its external and internal aspects make this a notable design, that is outstanding in modem religious architecture.Esta original iglesia ha surgido de una idea de interioridad, con total iluminación interior cenital, desde los lucernarios superiores. Su forma es la de una barca, sin esquinas, suave, como espacio más adecuado para un encuentro con Dios. Toda la obra es de hormigón vertido en encofrados maravillosamente realizados y, tanto su concepción formal como el tratamiento dado a sus interiores y exteriores, la destacan, notablemente, en el campo de la Arquitectura religiosa contemporánea.
Air cooling analysis and design of impacted flexible actuator’s servo controller based on PLECS
Directory of Open Access Journals (Sweden)
Zhu Mingjun
2017-01-01
Full Text Available At present, SUAV (small unmanned aerial vehicle is developing with small shape, high dynamic performance and distributed structure. Meanwhile the power by wire, which can replace traditional hydraulic system to lighten weight and improve reliability, is important developing direction of actuator technology in future. When a plane which applies power by wire is doing high-g routine, the power devices’ loss is giant because of the high power. Thus it is necessary to design cooling structure to carry out heat from controller inner. To avoid over design and analyze more exactly, this paper introduces a method based on MATLAB and PLECS union Simulink to calculate controller’s loss. By power devices’ thermal resistance and working temperature referred from products manual, it is possible to define cooler’s size. Then we can achieve wind pressure and flow characteristic curve, and select the cooling fan. Compared with theory calculation, this method can achieve exact controller loss in different working conditions and take effects which influenced by temperature in consideration, by what we can avoid cooling structure’s over design.
Directory of Open Access Journals (Sweden)
Pozuelo, M.
2004-04-01
Full Text Available Two ferrous laminated composites containing six layers have been processed by roll bonding. One of them consists of three layers of an ultrahigh carbon steel (1.3%C UHCS interlayered with other three layers of a microalloyed steel. The other composite consists of three layers of UHCS and three layers of a mild steel. Microstructure, Vickers hardness and impact properties have been studied. The absorbed energy values of the two laminated composites were higher than that of the UHCS.
Se procesaron mediante laminación en caliente dos materiales compuestos laminados de acero de ultraalto contenido de carbono (AUAC, 1,3%C de seis capas cada uno: El primero está compuesto por tres capas de AUAC alternadas con tres capas de un acero microaleado, y el segundo con tres del mismo AUAC alternadas con tres de un acero suave. Se ha realizado un estudio de sus microestructuras, dureza Vickers y propiedades de impacto. Se han mejorado los valores de energía absorbida de los dos materiales compuestos laminados respecto al del AUAC.
La economía política institucional del desarrollo local: dos cuentos de turismo en Brasil
Directory of Open Access Journals (Sweden)
A.H.J. (Bert Helmsing
2011-04-01
Full Text Available Hay un reconocimiento creciente en los estudios locales y regionales de la importancia de las instituciones. Predomina un 'institucionalismo suave', el cual se critica aquí por dejar por fuera el papel del Estado y por tener un sesgo hacia sinergias y externalidades positivas. Pretendemos contribuir a una política económica institucional del desarrollo local. En el marco analítico reunimos concepciones sociales y políticas de la 'economía institucional vieja' y explicitamos el papel del Estado. La construcción de nuevas instituciones es un proceso caracterizado por dependencia de camino, en el cual, las instituciones (reforman el camino de desarrollo de un área hacia una dirección determinada. Utilizando diversos recursos de poder, diferentes grupos sociales luchan por controlar este proceso. Empleamos este marco para analizar las historias divergentes de dos casos de desarrollo local en Brasil. Prainha do Canto Verde desarrolló un turismo comunitario mientras en Jericoacoara el desarrollo local culminó en turismo masivo.
Directory of Open Access Journals (Sweden)
Larissa Corrêa do Bomfim Costa
2007-08-01
Full Text Available A propagação vegetativa de espécies medicinais vem despertando interesse das pesquisas agronômicas, uma vez que se constitui no ponto de partida e em ferramenta básica para qualquer cultivo em escala comercial. Este trabalho objetivou determinar o comprimento de estaca e o tipo de substrato mais adequados para a propagação vegetativa de atroveran. Em condições de casa de vegetação sob nebulização intermitente, foram testados dois comprimentos de estacas (10 e 20cm e três substratos (areia lavada, casca de arroz carbonizada e substrato comercial Plantmax®, em delineamento experimental em blocos casualizados, com quatro repetições e cinco estacas por parcela. Aos trinta e cinco dias, foram avaliados a porcentagem de enraizamento, o comprimento da maior raiz (cm e a biomassa seca das folhas e das raízes (mg. Os resultados indicaram que a propagação vegetativa de atroveran por meio de estaquia é viável, uma vez que o seu enraizamento médio ficou acima de 70%. As mudas de atroveran obtidas de estacas com 20cm apresentaram maior biomassa seca das folhas e das raízes, apesar de o comprimento da estaca não ter afetado a porcentagem de enraizamento e o comprimento da raiz. Os tipos de substrato não proporcionaram efeito sobre o desenvolvimento das estacas de atroveran. Recomenda-se a produção de mudas de atroveran com estacas de 20cm de comprimento, utilizando-se qualquer um dos três substratos testados.The vegetative propagation of medicinal species is in increasing agronomic interest because it is the starting point and a basic tool for any cultivation in commercial scale. The objective of this work was to determine the best shoot cutting length and the best substrate for vegetative propagation of Ocimum selloi. Cuttings were placed in greenhouse conditions under intermittent mist. Two cutting sizes (10 and 20cm and three substrate types (washed sand, carbonized rice hulls and commercial substrate Plantmax® were tested
Directory of Open Access Journals (Sweden)
Sumoharjo Sumoharjo
2016-04-01
Full Text Available Tiga spesies tanaman sayur, kangkung darat (Ipomoea reptana, sawi (Brassica juncea, dan kemangi (Ocimum basilicum dibandingkan guna mengonversi ammonium dan nitrat nitrogen dari sistem akuakultur. Tanaman tersebut ditanam secara hidroponik menggunakan teknik rakit (rafting technique dengan tata letak rancangan acak kelompok lengkap (RAKL. Hasil percobaan menunjukkan bahwa tingkat konversi nitrogen oleh ketiga jenis tanaman berbeda secara nyata dengan tingkat retensi nitrogen tertinggi pada tanaman kangkung sebesar 0,73±0,28 g; diikuti oleh kemangi (0,30±0,17 g; dan terakhir oleh sawi (0,03±0,07 g. Secara keseluruhan ketiga tanaman mampu menyisihkan limbah nitrogen sebesar 6,70% dari total produksi TAN dari sisa metabolisme ikan yang dibudidayakan.
Dicty_cDB: Contig-U05246-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ; Sh... 54 2e-06 AY082612_1( AY082612 |pid:none) Ocimum basilicum p-coumaroyl shiki... 54 2e-06 AM465802_1( AM465802 |pid:none) Vit... 1e-05 T03275( T03275 ) probable cytochrome P450, hypersensitivity-relate... 51 1e-05 AY056284_1( AY056284 |pid:none) Arabidopsis...one) Bos taurus cytochrome P450, family... 55 1e-06 DQ667171_1( DQ667171 |pid:none) Artemisia annua P450 mon...) RecName: Full=Cytochrome P450 2B1; EC=1.14.14.... 52 9e-06 DQ453967_1( DQ453967 |pid:none) Artemisia annua...16 |pid:none) Danio rerio cytochrome P450, famil... 52 9e-06 DQ315671_1( DQ315671 |pid:none) Artemisi
Directory of Open Access Journals (Sweden)
B. T. Santos
2016-11-01
Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.
Directory of Open Access Journals (Sweden)
Dejan Brkić
2010-10-01
Full Text Available The chemical composition and antibacterial activity of essential oils from 10 commonly consumed herbs: Citrus aurantium, C. limon, Lavandula angustifolia, Matricaria chamomilla, Mentha piperita, M. spicata, Ocimum basilicum, Origanum vulgare, Thymus vulgaris and Salvia officinalis have been determined. The antibacterial activity of these oils and their main components; i.e. camphor, carvacrol, 1,8-cineole, linalool, linalyl acetate, limonene, menthol, a-pinene, b-pinene, and thymol were assayed against the human pathogenic bacteria Bacillus subtilis, Enterobacter cloacae, Escherichia coli O157:H7, Micrococcus flavus, Proteus mirabilis, Pseudomonas aeruginosa, Salmonella enteritidis, S. epidermidis, S. typhimurium, and Staphylococcus aureus. The highest and broadest activity was shown by O. vulgare oil. Carvacrol had the highest antibacterial activity among the tested components.