International Nuclear Information System (INIS)
Pan Feng
1991-01-01
VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique
Flipped SU(5) times U(1) in superconformal models
Energy Technology Data Exchange (ETDEWEB)
Bailin, D.; Katechou, E.K. (Sussex Univ., Brighton (United Kingdom). School of Mathematical and Physical Sciences); Love, A. (London Univ. (United Kingdom))
1992-01-10
This paper reports that flipped SU(5) {times} U(1) models are constructed in the framework of tensoring of N = 2 superconformal minimal models quotiented by discrete symmetries. Spontaneous breaking of flipped SU(5) {times} U(1) and extra U(1) factors in the gauge group along F-flat directions of the effective potential is studied.
Some comments on flipped SU(5) times U(1) and flipped unification in general
Energy Technology Data Exchange (ETDEWEB)
Barr, S.M. (Bartol Research Institute, University of Delaware, Newark, Delaware 19716 (US))
1989-10-01
A general group-theoretical discussion of flipped embeddings is given. In addition to the well-known flipped SU(5) and flipped SO(10), the existence of flipped E{sub 6} and E{sub 7} is shown, as well as several families and special cases of flipped embeddings. A possible physical reason, essentially based on the group theory of flipped embeddings, why nature prefers the low-energy group SU(3){times}SU(2){times}U(1) to alternatives such as SU(4){times}U(1) and SU(5) is pointed out.
International Nuclear Information System (INIS)
Baig, M.; Colet, J.
1986-01-01
Using Monte Carlo simulations the SU(2)xU(1) lattice gauge theory has been analyzed, which is equivalent for the Wilson action to a U(2) theory, at space-time dimensionalities from d=3 to 5. It has been shown that there exist first-order phase transitions for both d=4 and d=5. A monopole-condensation mechanism seems to be responsible for these phase transitions. At d=3 no phase transitions have been detected. (orig.)
SU(3)_C× SU(2)_L× U(1)_Y( × U(1)_X ) as a symmetry of division algebraic ladder operators
Furey, C.
2018-05-01
We demonstrate a model which captures certain attractive features of SU(5) theory, while providing a possible escape from proton decay. In this paper we show how ladder operators arise from the division algebras R, C, H, and O. From the SU( n) symmetry of these ladder operators, we then demonstrate a model which has much structural similarity to Georgi and Glashow's SU(5) grand unified theory. However, in this case, the transitions leading to proton decay are expected to be blocked, given that they coincide with presumably forbidden transformations which would incorrectly mix distinct algebraic actions. As a result, we find that we are left with G_{sm} = SU(3)_C× SU(2)_L× U(1)_Y / Z_6. Finally, we point out that if U( n) ladder symmetries are used in place of SU( n), it may then be possible to find this same G_{sm}=SU(3)_C× SU(2)_L× U(1)_Y / Z_6, together with an extra U(1)_X symmetry, related to B-L.
New approach to high energy SU/sub 2L/ /times/ U1 radiative corrections
International Nuclear Information System (INIS)
Ward, B.F.L.
1988-07-01
We present a new approach to SU/sub 2L/ /times/ U 1 radiative corrections at high energies. Our approach is based on the infrared summation methods of Yennie, Frautschi and Suura, taken together with the Weinberg-'t Hooft renormalization group equation. Specific processes which have been realized via explicit Monte Carlo algorithms are e + e/sup /minus// → f/bar f/' + n(γ), f = μ, /tau/, d, s, u, c, b or t and e + e/sup /minus// → e + e/sup /minus// + n(γ), where n(γ), denotes multiple photo emission on an event-by-event basis. Exemplary Monte Carlo data are presented. 16 refs., 4 figs
Experimentally verifiable Yang-Mills spin 2 gauge theory of gravity with group U(1) x SU(2)
International Nuclear Information System (INIS)
Peng, H.
1988-01-01
In this work, a Yang-Mills spin 2 gauge theory of gravity is proposed. Based on both the verification of the helicity 2 property of the SU(2) gauge bosons of the theory and the agreement of the theory with most observational and experimental evidence, the authors argues that the theory is truly a gravitational theory. An internal symmetry group, the eigenvalues of its generators are identical with quantum numbers, characterizes the interactions of a given class. The author demonstrates that the 4-momentum P μ of a fermion field generates the U(1) x SU(2) internal symmetry group for gravity, but not the transformation group T 4 . That particles are classified by mass and spin implies that the U(1) x SU(2), instead of the Poincare group, is a symmetry group of gravity. It is shown that the U(1) x SU(2) group represents the time displacement and rotation in ordinary space. Thereby internal space associated with gravity is identical with Minkowski spacetime, so a gauge potential of gravity carries two space-time indices. Then he verifies that the SU(2) gravitational boson has helicity 2. It is this fact, spin from internal spin, that explains alternatively why the gravitational field is the only field which is characterized by spin 2. The Physical meaning of gauge potentials of gravity is determined by comparing theory with the results of experiments, such as the Collella-Overhauser-Werner (COW) experiment and the Newtonian limit, etc. The gauge potentials this must identify with ordinary gravitational potentials
International Nuclear Information System (INIS)
Rajpoot, S.
1981-07-01
The SU(2)sub(L) x SU(2)sub(R) x U(1)sub(L+R) model of electroweak interactions is described with the most general gauge couplings gsub(L), gsub(R) and gsub(L+R). The case in which neutrino neutral current interactions are identical to the standard SU(2)sub(L) x U(1)sub(L+R) model is discussed in detail. It is shown that with the weak angle lying in the experimental range sin 2 thetaSUB(w)=0.23+-0.015 and 1 2 /gsub(R) 2 <3 it is possible to explain the amount of parity violation observed at SLAC and at the same time predict values of the ''weak charge'' in bismuth to lie in the range admitted by the controversal data from different experiments. (author)
New hierarchy in GUTs based on SU(n,1)/SU(n)U(1) SUGRA
International Nuclear Information System (INIS)
Hayashi, M.J.; Murayama, Akihiro
1985-01-01
Grand unified theories (GUTs) in the framework of SU(n, 1)/SU(n) x U(1) supergravity are discussed which naturally generate a new hierarchy, Msub(P) (Planck mass): Msub(X) (GUT scale):msub(3/2) (gravitino mass):m (explicit supersymmetry breaking scale)=1:epsilon:epsilon 3 :epsilon 5 α(Msub(X)) with Msub(P) as the only input mass scale. The SUSY breaking scale m is expected to be fixed radiatively as mproportionalMsub(W), i.e., epsilonproportional10 -3 . Our method would be applicable to any GUT based on SU(n, 1)/SU(n) x U(1) supergravity. (orig.)
Semidirect product gauge group [SU(3)cxSU(2)L]xU(1)Y and quantization of hypercharge
International Nuclear Information System (INIS)
Hattori, Chuichiro; Matsunaga, Mamoru; Matsuoka, Takeo
2011-01-01
In the standard model the hypercharges of quarks and leptons are not determined by the gauge group SU(3) c xSU(2) L xU(1) Y alone. We show that, if we choose the semidirect product group [SU(3) c xSU(2) L ]xU(1) Y as its gauge group, the hyperchages are settled to be n/6 mod Z(n=0,1,3,4). In addition, the conditions for gauge-anomaly cancellation give strong constraints. As a result, the ratios of the hypercharges are uniquely determined and the gravitational anomaly is automatically canceled. The standard charge assignment to quarks and leptons can be properly reproduced. For exotic matter fields their hypercharges are also discussed.
SU(2) x U(1) x U'(1) models which are slightly different from the Weinberg-Salam model
International Nuclear Information System (INIS)
Gao, C.; Wu, D.
1981-01-01
We discuss SU(2) x U(1) x U'(1) models by a uniform formula which is convenient for their comparison with the standard Weinberg-Salam model. As examples, we give three interesting models which are based on different grand unification models. In one model, U'(1) does not contribute to the electromagnetic interaction; in the other two, both U(1) and U'(1) do contribute to the electromagnetic interaction. Also, the first two models can approach the standard Weinberg-Salam model as close as one wants; but the third model has limitations on it
SU(2) X SU(2) X U(1) basis for symmetric SO(6) representations: matrix elements of the generators
International Nuclear Information System (INIS)
Piepenbring, R.; Silvestre-Brac, B.; Szymanski, Z.
1987-01-01
Matrix elements of the group generators for the symmetric irreducible representations of SO(6) are explicitly calculated in a closed form employing thedecomposition chain SO(6) is contained in SU(2) X SU(2) X U(1) (which is different from the well known Wigner supermultiplet scheme). The relation to the Gel'fand Tsetlin method using SO(6) contained in SO(5) up to ... SO(2) is indicated. An example of a physical application is given
International Nuclear Information System (INIS)
Watamura, S.
1983-01-01
Solutions of ten-dimensional Maxwell-Einstein theory and a bosonic part of N = 2, D = 10 supergravity theory are examined. It is shown that there is a solution for which six-dimensional internal space is compactified into CP 2 x S 2 . The gauge symmetry of the effective four-dimensional theory is SU(3) x SU(2) x U(1). The introduction of fermions is also considered. The requirement of consistency in introducing a spinsup(C) structure on CP 2 results in a U(1) charge quantization condition. (orig.)
SU(2) x U(1) unified theory for charge, orbit and spin currents
International Nuclear Information System (INIS)
Jin Peiqing; Li Youquan; Zhang Fuchun
2006-01-01
Spin and charge currents in systems with Rashba or Dresselhaus spin-orbit couplings are formulated in a unified version of four-dimensional SU(2) x U(1) gauge theory, with U(1) being the Maxwell field and SU(2) being the Yang-Mills field. While the bare spin current is non-conserved, it is compensated by a contribution from the SU(2) gauge field, which gives rise to a spin torque in the spin transport, consistent with the semi-classical theory of Culcer et al. Orbit current is shown to be non-conserved in the presence of electromagnetic fields. Similar to the Maxwell field inducing forces on charge and charge current, we derive forces acting on spin and spin current induced by the Yang-Mills fields such as the Rashba and Dresselhaus fields and the sheer strain field. The spin density and spin current may be considered as a source generating Yang-Mills field in certain condensed matter systems
Global analysis of general SU(2)xSU(2)xU(1) models with precision data
International Nuclear Information System (INIS)
Hsieh, Ken; Yu, Jiang-Hao; Yuan, C.-P.; Schmitz, Kai
2010-01-01
We present the results of a global analysis of a class of models with an extended electroweak gauge group of the form SU(2)xSU(2)xU(1), often denoted as G(221) models, which include as examples the left-right, the leptophobic, the hadrophobic, the fermiophobic, the un-unified, and the nonuniversal models. Using an effective Lagrangian approach, we compute the shifts to the coefficients in the electroweak Lagrangian due to the new heavy gauge bosons, and obtain the lower bounds on the masses of the Z ' and W ' bosons. The analysis of the electroweak parameter bounds reveals a consistent pattern of several key observables that are especially sensitive to the effects of new physics and thus dominate the overall shape of the respective parameter contours.
Global analysis of general SU(2) x SU(2) x U(1) models with precision data
International Nuclear Information System (INIS)
Hsieh, Ken; Yu, Jiang-Hao; Yuan, C.P.; Schmitz, Kai; Michigan State Univ., East Lansing, MI
2010-05-01
We present the results of a global analysis of a class of models with an extended electroweak gauge group of the form SU(2) x SU(2) x U(1), often denoted as G(221) models, which include as examples the left-right, the lepto-phobic, the hadro-phobic, the fermio-phobic, the un-unified, and the non-universal models. Using an effective Lagrangian approach, we compute the shifts to the coeffcients in the electroweak Lagrangian due to the new heavy gauge bosons, and obtain the lower bounds on the masses of the Z' and W' bosons. The analysis of the electroweak parameter bounds reveals a consistent pattern of several key observables that are especially sensitive to the effects of new physics and thus dominate the overall shape of the respective parameter contours. (orig.)
Baryon number generation in a flipped SU(5) x U(1) model
International Nuclear Information System (INIS)
Campbell, B.; Hagelin, J.; Nanopoulos, D.V.; Olive, K.A.
1988-01-01
We consider the possibilities for generating a baryon asymmetry in the early universe in a flipped SU(5) x U(1) model inspired by the superstring. Depending on the temperature of the radiation background after inflation we can distinguish between two scenarios for baryogenesis: (1) After reheating the original SU(5) x U(1) symmetry is restored, or there was no inflation at all; (2) reheating after inflation is rather weak and SU(5) x U(1) is broken. In either case the asymmetry is generated by the out-of-equilibrium decays of a massive SU(3) x SU(2) x U(1) singlet field φ m . In the flipped SU(5) x U(1) model, gauge symmetry breaking is triggered by strong coupling phenomena, and is in general accompanied by the production of entropy. We examine constraints on the reheating temperature and the strong coupling scale in each of the scenarios. (orig.)
Weak mixing angle and the SU(3)CxSU(3) model on M4xS1/(Z2xZ'2)
International Nuclear Information System (INIS)
Li Tianjun; Wei Liao
2002-05-01
We show that the desirable weak mixing angle sin 2 θ W =0.2312 at m Z scale can be generated naturally in the SU(3) C xSU(3) model on M 4 xS 1 /(Z 2 x Z 2 ') where the gauge symmetry SU(3) is broken down to SU(2) L xU(1) Y by orbifold projection. For a supersymmetric model with a TeV scale extra dimension, the SU(3) unification scale is about hundreds of TeVs at which the gauge couplings for SU(3) C and SU(3) can also be equal in the mean time. For the non-supersymmetric model, SU(2) L xU(1) Y are unified at order of 10 TeV. These models may serve as good candidates for physics beyond the SM or MSSM. (author)
Global analysis of general SU(2) x SU(2) x U(1) models with precision data
Energy Technology Data Exchange (ETDEWEB)
Hsieh, Ken; Yu, Jiang-Hao; Yuan, C.P. [Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy; Schmitz, Kai [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany); Michigan State Univ., East Lansing, MI (United States). Dept. of Physics and Astronomy
2010-05-15
We present the results of a global analysis of a class of models with an extended electroweak gauge group of the form SU(2) x SU(2) x U(1), often denoted as G(221) models, which include as examples the left-right, the lepto-phobic, the hadro-phobic, the fermio-phobic, the un-unified, and the non-universal models. Using an effective Lagrangian approach, we compute the shifts to the coeffcients in the electroweak Lagrangian due to the new heavy gauge bosons, and obtain the lower bounds on the masses of the Z' and W' bosons. The analysis of the electroweak parameter bounds reveals a consistent pattern of several key observables that are especially sensitive to the effects of new physics and thus dominate the overall shape of the respective parameter contours. (orig.)
ɛ '/ ɛ anomaly and neutron EDM in SU(2) L × SU(2) R × U(1) B- L model with charge symmetry
Haba, Naoyuki; Umeeda, Hiroyuki; Yamada, Toshifumi
2018-05-01
The Standard Model prediction for ɛ '/ ɛ based on recent lattice QCD results exhibits a tension with the experimental data. We solve this tension through W R + gauge boson exchange in the SU(2) L × SU(2) R × U(1) B- L model with `charge symmetry', whose theoretical motivation is to attribute the chiral structure of the Standard Model to the spontaneous breaking of SU(2) R × U(1) B- L gauge group and charge symmetry. We show that {M_W}{_R}study a correlation between ɛ ' /ɛ and the neutron EDM. We confirm that the model can solve the ɛ ' /ɛ anomaly without conflicting the current bound on the neutron EDM, and further reveal that almost all parameter regions in which the ɛ ' /ɛ anomaly is explained will be covered by future neutron EDM searches, which leads us to anticipate the discovery of the neutron EDM.
SU(5) x U(1) phenomenology: Theorems on neutral-current analysis
International Nuclear Information System (INIS)
Zee, A.; Kim, J.E.
1980-01-01
We embed the SU(5) unified theory of Georgi and Glashow in a U(5) theory. This may result from the breaking of an SU(N), N>5, theory or of a GL(5,c) theory. At low energy this leads to an SU(2) x U(1) x U(1) electroweak theory. We show that, with a suitable choice of Higgs representations, the predictions of this theory for neutral-current experiments are characterized by three parameters. For appropriate values of these parameters, the predictions are practically indistinguishable from the standard SU(2) x U(1) theory. Certain theorems on the analysis of neutral-current interactions are proved. (Section V is independent for readers who are interested only in the theorems.) More accurate neutral-current measurement might answer the question of whether SU(5) x U(1) is relevant. Possible verification of the present electroweak theory can result from (roughly) an order suppression relative to the standard prediction on the asymmetries in e + e - → μ + μ - and discovery of two Z bosons around 90 --100 GeV. GL(n,c) gauge theories are formulated in the Appendix
Radiative corrections in SU2 x U1 LEP/SLC
International Nuclear Information System (INIS)
Lynn, B.W.; Peskin, M.E.; Stuart, R.G.
1985-06-01
We show the sensitivity of various experimental measurements to one-loop radiative corrections in SU 2 x U 1 . Models considered are the standard GSW model as well as extensions of it which include extra quarks and leptons, SUSY and certain technicolor models. The observation of longitudinal polarization is a great help in seeing these effects in asymmetries in e + e - → μ + μ - , tau + tau - on Z 0 resonance. 25 refs., 22 figs., 10 tabs
Phenomenology of an SU(2)×SU(2)×U(1) model with lepton-flavour non-universality
Energy Technology Data Exchange (ETDEWEB)
Boucenna, Sofiane M. [Laboratori Nazionali di Frascati, INFN,Via Enrico Fermi 40, 100044 Frascati (Italy); Celis, Alejandro [Arnold Sommerfeld Center for Theoretical Physics, Fakultät für Physik,Ludwig-Maximilians-Universität München,Theresienstrasse 37, 80333 München (Germany); Fuentes-Martín, Javier; Vicente, Avelino [Instituto de Física Corpuscular, Universitat de València - CSIC,E-46071 València (Spain); Virto, Javier [Albert Einstein Center for Fundamental Physics,Institute for Theoretical Physics, University of Bern,CH-3012 Bern (Switzerland)
2016-12-14
We investigate a gauge extension of the Standard Model in light of the observed hints of lepton universality violation in b→cℓν and b→sℓ{sup +}ℓ{sup −} decays at BaBar, Belle and LHCb. The model consists of an extended gauge group SU(2){sub 1}×SU(2){sub 2}×U(1){sub Y} which breaks spontaneously around the TeV scale to the electroweak gauge group. Fermion mixing effects with vector-like fermions give rise to potentially large new physics contributions in flavour transitions mediated by W{sup ′} and Z{sup ′} bosons. This model can ease tensions in B-physics data while satisfying stringent bounds from flavour physics, and electroweak precision data. Possible ways to test the proposed new physics scenario with upcoming experimental measurements are discussed. Among other predictions, the ratios R{sub M}=Γ(B→Mμ{sup +}μ{sup −})/Γ(B→Me{sup +}e{sup −}), with M=K{sup ∗},ϕ, are found to be reduced with respect to the Standard Model expectation R{sub M}≃1.
More flipped SU(5) x U(1) baryosynthesis
Energy Technology Data Exchange (ETDEWEB)
Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V.; Olive, K.A.
1988-06-30
We supplement a previous discussion of baryosynthesis in flipped SU(5)xU(1) GUTs by including (1) the large incoherent field energy density which is likely when SU(5) is broken, and (2) the possibility of additional Higgs triplet fields suggested by four-dimensional string model-building. We consider strong (weak) reheating scenarios in which the Universe is (is not) SU(5) symmetric after inflation. We find an adequate baryon asymmetry subsequent to strong reheating, whatever the number of Higgs triplets (although beware of possible difficulties with quasi-stable relic particles), whereas weak reheating requires at least two Higgs triplets.
Vacuum expectation values of Higgs scalars in a SU(2)/sub L/ x SU(2)/sub R/ x U(1) gauge model
International Nuclear Information System (INIS)
Kitazoe, T.; Mainland, G.B.; Tanaka, K.
1979-01-01
We determine the vacuum expectation values of the Higgs scalars within the framework of a six-quark SU(2)/sub L/ x SU(2)/sub R/ x U(1) gauge model after the imposition of discrete symmetries that are necessary in order to express the Cabibbo angle in terms of quark mass ratios and phases of the vacuum expectation values. We find both real and complex solutions for the vacuum expectation values depending on the relative values of the parameters in the Higgs potential
Vacuum expectation values of Higgs scalars in a SU(2)/sub L/ X SU(2)/sub R/ X U(1) gauge model
International Nuclear Information System (INIS)
Kitazoe, T.; Mainland, G.B.; Tanaka, K.
1978-01-01
The vacuum expectation values of the Higgs scalars are determined within the framework of a six quark SU(2)/sub L/ x SU(2)/sub R/ x U(1) gauge model after the imposition of discrete symmetrics that are necessary in order to express the Cabibbo angle in terms of quark mass ratios and phases of the vacuum expectation values. Both real and complex solutions are found for the vacuum expectation values depending on the relative values of the parameters in the Higgs potential
SU(4) x U(1) gauge theory. II. CP nonconservation
International Nuclear Information System (INIS)
Deshpande, N.G.; Hwa, R.C.; Mannheim, P.D.
1979-01-01
We exploit the higher symmetry inherent in an SU(4) x U(1) gauge theory to construct a spontaneously broken theory of CP nonconservation. Higgs multiplets in the adjoint representation of SU(4) contain both even and odd CP fields; thus, requiring the simultaneous nonvanishing of the vacuum expectation values of these fields leads to CP noninvariance of the vacuum. We find that all the CP-nonconserving effects are mediated in our theory by the superheavy gauge bosons of the broken SU(4) x U(1) symmetry. In fact, the very existence of CP violation sets an upper limit on the masses of these bosons. In our model the dominant CP effect lies in the neutral kaon system and is found to arise through a direct (ΔS = 2) K 1 -K 2 transition. The model has all the features of a superweak theory, with a neutron electric dipole moment substantially smaller than 10 -24 e cm
Renormalization of a tensorial field theory on the homogeneous space SU(2)/U(1)
Lahoche, Vincent; Oriti, Daniele
2017-01-01
We study the renormalization of a general field theory on the homogeneous space (SU(2)/ ≤ft. U(1)\\right){{}× d} with tensorial interaction and gauge invariance under the diagonal action of SU(2). We derive the power counting for arbitrary d. For the case d = 4, we prove perturbative renormalizability to all orders via multi-scale analysis, study both the renormalized and effective perturbation series, and establish the asymptotic freedom of the model. We also outline a general power counting for the homogeneous space {{≤ft(SO(D)/SO(D-1)\\right)}× d} , of direct interest for quantum gravity models in arbitrary dimension, and point out the obstructions to the direct generalization of our results to these cases.
Some comments on flipped SU(5)xU(1) and flipped unification in general
International Nuclear Information System (INIS)
Barr, S.M.
1989-01-01
A general group-theoretical discussion of flipped embeddings is given. In addition to the well-known flipped SU(5) and flipped SO(10), the existence of flipped E 6 and E 7 is shown, as well as several families and special cases of flipped embeddings. A possible physical reason, essentially based on the group theory of flipped embeddings, why nature prefers the low-energy group SU(3)xSU(2)xU(1) to alternatives such as SU(4)xU(1) and SU(5) is pointed out
Flipped SU(5)xU(1){sub X} models from F-theory
Energy Technology Data Exchange (ETDEWEB)
Jiang Jing [Department of Physics, University of Wisconsin, Madison, WI 53706 (United States); Li Tianjun, E-mail: tjli@physics.rutgers.ed [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Key Laboratory of Frontiers in Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece); Xie Dan [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)
2010-05-01
We systematically construct flipped SU(5)xU(1){sub X} models without and with bulk vector-like particles from F-theory. To realize the decoupling scenario, we introduce sets of vector-like particles in complete SU(5)xU(1) multiplets at the TeV scale, or at the intermediate scale, or at the TeV scale and high scale. To avoid the Landau pole problem for the gauge couplings, we can only introduce five sets of vector-like particles around the TeV scale. These vector-like particles can couple to the Standard Model singlet fields, and obtain suitable masses by Higgs mechanism. We study gauge coupling unification in detail. We show that the U(1){sub X} flux contributions to the gauge couplings preserve the SU(5)xU(1){sub X} gauge coupling unification. We calculate the SU(3){sub C}xSU(2){sub L} unification scales, and the SU(5)xU(1){sub X} unification scales and unified couplings. In most of our models, the high-scale or bulk vector-like particles can be considered as string-scale threshold corrections since their masses are close to the string scale. Furthermore, we discuss the phenomenological consequences of our models. In particular, in the models with TeV-scale vector-like particles, the vector-like particles can be observed at the Large Hadron Collider, the proton decay is within the reach of the future Hyper-Kamiokande experiment, the lightest CP-even Higgs boson mass can be increased, the hybrid inflation can be naturally realized, and the correct cosmic primordial density fluctuations can be generated.
Large (g-2)$_{\\mu}$ in SU(5) x U(1) supergravity models
López, J L; Wang, X
1994-01-01
We compute the supersymmetric contribution to the anomalous magnetic moment of the muon within the context of $SU(5)\\times U(1)$ supergravity models. The largest possible contributions to $a^{susy}_\\mu$ occur for the largest allowed values of $\\tan\\beta$ and can easily exceed the present experimentally allowed range, even after the LEP lower bounds on the sparticle masses are imposed. Such $\\tan\\beta$ enhancement implies that $a^{susy}_\\mu$ can greatly exceed both the electroweak contribution ($\\approx1.95\\times10^{-9}$) and the present hadronic uncertainty ($\\approx\\pm1.75\\times10^{-9}$). Therefore, the new E821 Brookhaven experiment (with an expected accuracy of $0.4\\times10^{-9}$) should explore a large fraction (if not all) of the parameter space of these models, corresponding to slepton, chargino, and squarks masses as high as 200, 300, and 1000 GeV respectively. Moreover, contrary to popular belief, the $a^{susy}_\\mu$ contribution can have either sign, depending on the sign of the Higgs mixing parameter...
Quantum SU(2|1) supersymmetric Calogero-Moser spinning systems
Fedoruk, Sergey; Ivanov, Evgeny; Lechtenfeld, Olaf; Sidorov, Stepan
2018-04-01
SU(2|1) supersymmetric multi-particle quantum mechanics with additional semi-dynamical spin degrees of freedom is considered. In particular, we provide an N=4 supersymmetrization of the quantum U(2) spin Calogero-Moser model, with an intrinsic mass parameter coming from the centrally-extended superalgebra \\widehat{su}(2\\Big|1) . The full system admits an SU(2|1) covariant separation into the center-of-mass sector and the quotient. We derive explicit expressions for the classical and quantum SU(2|1) generators in both sectors as well as for the total system, and we determine the relevant energy spectra, degeneracies, and the sets of physical states.
Strongly coupled SU(2v boson and LEP1 versus LEP2
Directory of Open Access Journals (Sweden)
M. Bilenky
1993-10-01
Full Text Available If new strong interactions exist in the electroweak bosonic sector (e.g., strong Higgs sector, dynamical electroweak breaking, etc., it is natural to expect new resonances, with potentially strong couplings. We consider an additional vector-boson triplet, V+-, V0, associated with an SU(2v local symmetry under the specific (but rather natural assumption that ordinary fermions are SU(2v singlets. Mixing of the V triplet with the W+-, Z0 bosons effectively leads to an SU(2L×U(1Y violating vector-boson-fermion interaction which is strongly bounded by LEP1 data. In contrast, the potentially large deviation of the Z0W+W- coupling from its SU(2L×U(1Y value is hardly constrained by LEP1 data. Results from experiments with direct access to the trilinear Z0W+W− coupling (LEP200, NLC are urgently needed.
The flipped SU(5)xU(1) string model revamped
Energy Technology Data Exchange (ETDEWEB)
Antoniadis, I.; Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V. (European Organization for Nuclear Research, Geneva (Switzerland))
1989-11-02
We present a refined version of our three-generation flipped SU(5)xU(1) string model with the following properties. The complete massless spectrum is derived and shown to be free of all gauge and mixed anomalies apart from a single anomalous U(1). The imaginary part of the dilaton supermultiplet is eaten by the anomalous U(1) gauge boson, and the corresponding D-term is cancelled by large VEVs for singlet fields that break surplus U(1) gauge factors, leaving a supersymmetric vacuum with an SU(5)xU(1) visible gauge group and an SO(10)xSO(6) hidden gauge group. There are sufficient Higgs multiplets to break the visible gauge symmetry down to the standard model in an essentially unique way. All trilinear superpotential couplings have been calculated and there are in particular some giving m{sub t}, m{sub b}, m{sub tau}ne0. A renormalization group analysis shows that m{sub t}<190 GeV and m{sub b}{approx equal}3m{sub tau}. Light Higgs doublets are split automatically from heavy Higgs triplets, leaving no residual dimension-five operators for baryon decay, and the baryon lifetime tau{sub B} {approx equal} 2x10{sup 34{plus minus}2} yr. There are no tree-level flavour-changing neutral currents, but muyieldsegamma may occur at a detectable level: B(muyieldsegamma){proportional to} 10{sup -11}-10{sup -14}. (orig.).
Ma, Ernest
2018-05-01
An extra SU(2)D gauge factor is added to the well-known left-right extension of the standard model (SM) of quarks and leptons. Under SU(2)L × SU(2)R × SU(2)D, two fermion bidoublets (2 , 1 , 2) and (1 , 2 , 2) are assumed. The resulting model has an automatic dark U (1) symmetry, in the same way that the SM has automatic baryon and lepton U (1) symmetries. Phenomenological implications are discussed, as well as the possible theoretical origins of this proposal.
Electromagnetic mass differences in the SU(3) x U(1) gauge model
International Nuclear Information System (INIS)
Maharana, K.; Sastry, C.V.
1975-01-01
In this note we point out that the electromagnetic mass differences of the pion and kaon in the SU(3) times U(1) model are the same as in Weinberg's model except for the differences in the masses of the gauge bosons
Minimal Supersymmetric $SU(4) \\to SU(2)_L \\to SU(2)_R$
King, S F
1998-01-01
We present a minimal string-inspired supersymmetric $SU(4) \\times SU(2)_L potential in this model, based on a generalisation of that recently proposed by Dvali, Lazarides and Shafi. The model contains a global U(1) R-symmetry and reduces to the MSSM at low energies. However it improves on the MSSM since it explains the magnitude of its $\\mu$ term and gives a prediction for $\\tan \\beta both `cold' and `hot' dark matter candidates. A period of hybrid inflation above the symmetry breaking scale is also possible in this model. Finally it suggests the existence of `heavy' charge $\\pm e/6$ (colored) and $\\pm e/2$ (color singlet) states.
Hue, L. T.; Arbuzov, A. B.; Ngan, N. T. K.; Long, H. N.
2017-05-01
The neutrino and Higgs sectors in the { SU(2) }_1 × { SU(2) }_2 × { U(1) }_Y model with lepton-flavor non-universality are discussed. We show that active neutrinos can get Majorana masses from radiative corrections, after adding only new singly charged Higgs bosons. The mechanism for the generation of neutrino masses is the same as in the Zee models. This also gives a hint to solving the dark matter problem based on similar ways discussed recently in many radiative neutrino mass models with dark matter. Except the active neutrinos, the appearance of singly charged Higgs bosons and dark matter does not affect significantly the physical spectrum of all particles in the original model. We indicate this point by investigating the Higgs sector in both cases before and after singly charged scalars are added into it. Many interesting properties of physical Higgs bosons, which were not shown previously, are explored. In particular, the mass matrices of charged and CP-odd Higgs fields are proportional to the coefficient of triple Higgs coupling μ . The mass eigenstates and eigenvalues in the CP-even Higgs sector are also presented. All couplings of the SM-like Higgs boson to normal fermions and gauge bosons are different from the SM predictions by a factor c_h, which must satisfy the recent global fit of experimental data, namely 0.995<|c_h|<1. We have analyzed a more general diagonalization of gauge boson mass matrices, then we show that the ratio of the tangents of the W-W' and Z-Z' mixing angles is exactly the cosine of the Weinberg angle, implying that number of parameters is reduced by 1. Signals of new physics from decays of new heavy fermions and Higgs bosons at LHC and constraints of their masses are also discussed.
Yamamoto, Takuya; Nishigaki, Shinsuke M.
2018-02-01
We compute individual distributions of low-lying eigenvalues of a chiral random matrix ensemble interpolating symplectic and unitary symmetry classes by the Nyström-type method of evaluating the Fredholm Pfaffian and resolvents of the quaternion kernel. The one-parameter family of these distributions is shown to fit excellently the Dirac spectra of SU(2) lattice gauge theory with a constant U(1) background or dynamically fluctuating U(1) gauge field, which weakly breaks the pseudoreality of the unperturbed SU(2) Dirac operator. The observed linear dependence of the crossover parameter with the strength of the U(1) perturbations leads to precise determination of the pseudo-scalar decay constant, as well as the chiral condensate in the effective chiral Lagrangian of the AI class.
Non linear realizations of SU(2) x U(1) in the MSSM model independent analysis and g - 2 of W bosons
Ferrara, Sergio; Porrati, Massimo; Ferrara, Sergio; Masiero, Antonio; Porrati, Massimo
1993-01-01
We perform a model-independent analysis of the spontaneously broken phase of an $SU(2)\\times U(1)$ supersymmetric gauge theory, by using a non-linear parametrization of the Goldstone sector of the theory. The non-linear variables correspond to an $SL(2,C)$ superfield matrix in terms of which a non-linear Lagrangian can be constructed, and the pattern of supersymmetry breaking investigated. The supersymmetric order parameter is the V.E.V. of the neutral pseudo-Goldstone boson. Some applications of this technique are considered, in relation to the minimal supersymmetric standard model, and to determine the $g-2$ of the $W$-bosons in the limit of large top mass.
Charge commutation relation approach to composite vector bosons in SU(2)sub(L)xU(1)sub(Y)
International Nuclear Information System (INIS)
Yasue, Masaki; Oneda, Sadao.
1984-09-01
Under the assumption that the local SU(2)sub(L)xU(1)sub(Y) symmetry is a good symmetry for new resonances, we predict that msub(W)msub(W*)=costhetamsub(Z)msub(Z*) where theta represents the mixing angle between neutral gauge bosons and msub(W), msub(Z), msub(W*) and msub(Z*) are the masses of W, Z, W* and Z*, respectively. W* and Z* are the lowest lying spin one resonances, whose pure states belong to a triplet of SU(2)sub(L). Possible SU(2)sub(L)-singlet state is assumed to be much heavier than W* and Z*. Low energy phenomenology of weak interactions indicates msub(W)--costhetamsub(Z), suggesting msub(W*)--msub(Z*). (author)
Closing the SU(3)LxU(1)X symmetry at the electroweak scale
International Nuclear Information System (INIS)
Dias, Alex G.; Montero, J. C.; Pleitez, V.
2006-01-01
We show that some models with SU(3) C xSU(3) L xU(1) X gauge symmetry can be realized at the electroweak scale and that this is a consequence of an approximate global SU(2) L+R symmetry. This symmetry implies a condition among the vacuum expectation value of one of the neutral Higgs scalars, the U(1) X 's coupling constant, g X , the sine of the weak mixing angle sinθ W , and the mass of the W boson, M W . In the limit in which this symmetry is valid it avoids the tree level mixing of the Z boson of the standard model with the extra Z ' boson. We have verified that the oblique T parameter is within the allowed range indicating that the radiative corrections that induce such a mixing at the 1-loop level are small. We also show that a SU(3) L+R custodial symmetry implies that in some of the models we have to include sterile (singlets of the 3-3-1 symmetry) right-handed neutrinos with Majorana masses, since the seesaw mechanism is mandatory to obtain light active neutrinos. Moreover, the approximate SU(2) L+R subset of SU(3) L+R symmetry implies that the extra nonstandard particles of these 3-3-1 models can be considerably lighter than it had been thought before so that new physics can be really just around the corner
Some new contributions to neutrinoless double β-decay in an SU(2)xU(1) model
International Nuclear Information System (INIS)
Escobar, C.O.
1982-11-01
An SU(2) x U(1) model having both Dirac and Majorana mass terms for the neutrinos, with an extended Higgs sector without natural flavor conservation is considered. Under these conditions, it is shown that for a certain range of the mass parameters of the model, some new contributions become important for the neutrinoless double β-decay (ββ)oν. (Author) [pt
Naturally light neutrinos in the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Antoniadis, I.; Rizos, J. (Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France)); Tamvakis, K. (Physics Dept., Univ. Ioannina (Greece))
1992-04-16
We analyze the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSU(4) superstring model, taking into account non-renormalizable superpotential interactions up to sixth order, and find that all neutrinos stay naturally light within the experimental mass bounds. (orig.).
Generalized permutation symmetry and the flavour problem in SU(2)sub(L)xU(1)
International Nuclear Information System (INIS)
Ecker, G.
1984-01-01
A generalized permutation group is introduced as a possible horizontal symmetry for SU(2)sub(L)xU(1) gauge theories. It leads to the unique two generation quark mass matrices with a correct prediction for the Cabibbo angle. For three generations the model exhibits spontaneous CP violation, correlates the Kobayashi-Maskawa mixing parameters s 1 and s 3 and predicts an upper bound for the running top quark mass of approximately 45 GeV. The hierarchy of generations is due to a hierarchy of vacuum expectation values rather than of Yukawa coupling constants. (orig.)
U(1) x SU(2) Chern-Simons gauge theory of underdoped cuprate superconductors
International Nuclear Information System (INIS)
Marchetti, P.A.; Su Zhao-Bin; Yu Lu
1998-05-01
The Chern-Simons bosonization with U(1)xSU(2) gauge field is applied to the 2-D t-J model in the limit t>>J, to study the normal state properties of underdoped cuprate superconductors. We prove the existence of an upper bound on the partition function for holons in a spinon background, and we find the optimal spinon configuration saturating the upper bound on average - a coexisting flux phase and s+id-like RVB state. After neglecting the feedback of holon fluctuations on the U(1) field B and spinon fluctuations on the SU(2) field V, the holon field is a fermion and the spinon field is a hard-core boson. Within this approximation we show that the B field produces a π flux phase for the holons, converting them into Dirac-like fermions, while the V field, taking into account the feedback of holons produces a gap for the spinons vanishing in the zero doping limit. The nonlinear σ-model with a mass term describes the crossover from the short-ranged antiferromagnetic (AF) state in doped samples to long range AF order in reference compounds. Moreover, we derive a low-energy effective action in terms of spinons holons and a self-generated U(1) gauge field. Neglecting the gauge fluctuations, the holons are described by the Fermi liquid theory with a Fermi surface consisting of 4 ''half-pockets'' centered at (+-π/2,+-π/2) and one reproduces the results for the electron spectral function obtained in the mean field approximation, in agreement with the photoemission data on underdoped cuprates. The gauge fluctuations are not confining due to coupling to holons, but nevertheless yield an attractive interaction between spinons and holons leading to a bound state with electron quantum numbers. The renormalisation effects due to gauge fluctuations give rise to non-Fermi liquid behaviour for the composite electron, in certain temperature range showing the linear in T resistivity. This formalism provides a new interpretation of the spin gap in the underdoped superconductors
Testable flipped SU(5)xU(1){sub X} models
Energy Technology Data Exchange (ETDEWEB)
Jiang Jing [Institute of Theoretical Science, University of Oregon, Eugene, OR 97403 (United States); Li Tianjun [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States) and Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100080 (China) and Department of Physics and Astronomy, Rutgers University, Piscataway, NJ 08854 (United States)]. E-mail: tjli@physics.rutgers.edu; Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)
2007-06-11
The little hierarchy between the GUT scale and the string scale may give us some hints that can be tested at the LHC. To achieve string-scale gauge coupling unification, we introduce additional vector-like particles. We require that these vector-like particles be standard, form complete GUT multiplets, and have masses around the TeV scale or close to the string scale. Interestingly, only the flipped SU(5)xU(1){sub X} models can work elegantly. We consider all possible sets of vector-like particles with masses around the TeV scale. And we introduce vector-like particles with masses close to the string scale which can mimic the string-scale threshold corrections. We emphasize that all of these vector-like particles can be obtained in the interesting flipped SU(5)xU(1){sub X} string models from the four-dimensional free fermionic string construction. Assuming the low-energy supersymmetry, high-scale supersymmetry, and split supersymmetry, we show that the string-scale gauge coupling unification can indeed be achieved in the flipped SU(5)xU(1){sub X} models. These models can be tested at the LHC by observing simple sets of vector-like particles at the TeV scale. Moreover, we discuss a simple flipped SU(5)xU(1){sub X} model with string-scale gauge coupling unification and high-scale supersymmetry by introducing only one pair of the vector-like particles at the TeV scale, and we predict the corresponding Higgs boson masses. Also, we briefly comment on the string-scale gauge coupling unification in the model with low-energy supersymmetry by introducing only one pair of the vector-like particles at the intermediate scale. And we briefly comment on the mixings among the SM fermions and the corresponding extra vector-like particles.
Spontaneously broken SU(2) gauge invariance and the ΔI=1/2 rule
International Nuclear Information System (INIS)
Shito, Okiyasu
1977-01-01
A model of nonleptonic weak interactions is proposed which is based on spontaneously broken SU(2) gauge invariance. The SU(2) group is taken analogously to the U-spin. To this scheme, the source of nonleptonic decays consists of only neutral currents, and violation of strangeness stems from weak vector boson mixings. The model can provide a natural explanation of the ΔI=1/2 rule and of the bulk of the ΔI=1/2 nonleptonic amplitude. As a consequence, a picture is obtained that weak interactions originate in spontaneously broken gauge invariance under orthogonal SU(2) groups. Finally, a possibility of unifying weak and electromagnetic interactions is indicated. (auth.)
Supersymmetric U boson and the old U(1) problem
International Nuclear Information System (INIS)
Kim, B.R.
1983-01-01
In the supersymmetric SU(3)xSU(2)xU(1)xUsup(')(1) model the new gauge group Usup(')(1) enforces the introduction of mirror fermions. In this note we address the inverse question. If one starts with SU(3)xSU(2)xU(1) including mirror fermions, what physical arguments other than the supersymmetric require the introduction of a new gauge group Usup(')(1). It turns out that the old U(1) problem is closely related with this question. Further we give an estimate for the upper bound for the parameter of the supersymmetric U boson r and x. (orig.)
SU(n)c x SU(m)L x U(1)N generalizations of the standard model
International Nuclear Information System (INIS)
Pleitez, V.
1993-01-01
Generalizations of the Standard Model which are based on the gauge symmetry SU(n) c x SU(m) L x U(1) N are considered. Although the most interesting possibility occurs when n = 3, it will be considered also the cases n = 4,5, both with m = 3,4. It will also be given possible grand unification scenarios. (author). 18 refs
A SU(3) x U(1) model for electroweak interactions
International Nuclear Information System (INIS)
Pisano, F.; Pleitez, V.
1992-01-01
We consider a gauge model based on a SU(3) vector U(1) symmetry in which the lepton number is violated explicitly by charged scalar and gauge boson, including a vector field with double electric charge. (author)
The SU(3)xU(1) invariant breaking of gauged N=8 supergravity
International Nuclear Information System (INIS)
Nicolai, H.; Warner, N.P.
1985-01-01
The SU(3) x U(1) invariant stationary point of N=8 supergravity is described in some detail. This vacuum has N=2 supersymmetry, and it is shown how the fields of N=8 supergravity may be collected into multiplets of SU(3) x Osp(2, 4). A new kind of shortened massive multiplet is described, and the multiplet shortening conditions for this and other multiplets are used to determine, by the use of group theory alone, the masses of many of the fields in the vacuum. The remaining masses are determined by explicit calculation. The critical point realizes Gell-Mann's scheme for relating the spin-1/2 fermions of the theory to the observed quarks and leptons. (orig.)
Pure classical SU(2) Yang-Mills theory with potentials invariant under a U(1) gauge subgroup
International Nuclear Information System (INIS)
Bacry, H.
1978-07-01
The present article is devoted to pure SU(2) classical Yang-Mills theories whose potentials are invariant under a U(1) gauge subgroup. Such potentials are shown to be associated with classical Maxwell-like fields with magnetic sources as 't Hooft's monopole is associated with the Dirac magnetic monopole. Conversely, the authors give Yang-Mills potentials corresponding to some Maxwell-like fields, in particular static magnetic fields with emphasis on those with cylindrical symmetry (including the dipole and other multipoles) and the ephemerons corresponding to an instantaneous magnetic multipole
Path integrals and coherent states of SU(2) and SU(1,1)
Inomata, Akira; Kuratsuji, Hiroshi
1992-01-01
The authors examine several topical subjects, commencing with a general introduction to path integrals in quantum mechanics and the group theoretical backgrounds for path integrals. Applications of harmonic analysis, polar coordinate formulation, various techniques and path integrals on SU(2) and SU(1, 1) are discussed. Soluble examples presented include particle-flux system, a pulsed oscillator, magnetic monopole, the Coulomb problem in curved space and others.The second part deals with the SU(2) coherent states and their applications. Construction and generalization of the SU(2) coherent sta
Energy Technology Data Exchange (ETDEWEB)
Hue, L.T. [Duy Tan University, Institute of Research and Development, Da Nang City (Viet Nam); Vietnam Academy of Science and Technology, Institute of Physics, Hanoi (Viet Nam); Arbuzov, A.B. [Joint Institute for Nuclear Researches, Bogoliubov Laboratory for Theoretical Physics, Dubna (Russian Federation); Ngan, N.T.K. [Cantho University, Department of Physics, Cantho (Viet Nam); Vietnam Academy of Science and Technology, Graduate University of Science and Technology, Hanoi (Viet Nam); Long, H.N. [Ton Duc Thang University, Theoretical Particle Physics and Cosmology Research Group, Ho Chi Minh City (Viet Nam); Ton Duc Thang University, Faculty of Applied Sciences, Ho Chi Minh City (Viet Nam)
2017-05-15
The neutrino and Higgs sectors in the SU(2){sub 1} x SU(2){sub 2} x U(1){sub Y} model with lepton-flavor non-universality are discussed. We show that active neutrinos can get Majorana masses from radiative corrections, after adding only new singly charged Higgs bosons. The mechanism for the generation of neutrino masses is the same as in the Zee models. This also gives a hint to solving the dark matter problem based on similar ways discussed recently in many radiative neutrino mass models with dark matter. Except the active neutrinos, the appearance of singly charged Higgs bosons and dark matter does not affect significantly the physical spectrum of all particles in the original model. We indicate this point by investigating the Higgs sector in both cases before and after singly charged scalars are added into it. Many interesting properties of physical Higgs bosons, which were not shown previously, are explored. In particular, the mass matrices of charged and CP-odd Higgs fields are proportional to the coefficient of triple Higgs coupling μ. The mass eigenstates and eigenvalues in the CP-even Higgs sector are also presented. All couplings of the SM-like Higgs boson to normal fermions and gauge bosons are different from the SM predictions by a factor c{sub h}, which must satisfy the recent global fit of experimental data, namely 0.995 < vertical stroke c{sub h} vertical stroke < 1. We have analyzed a more general diagonalization of gauge boson mass matrices, then we show that the ratio of the tangents of the W-W{sup '} and Z-Z{sup '} mixing angles is exactly the cosine of the Weinberg angle, implying that number of parameters is reduced by 1. Signals of new physics from decays of new heavy fermions and Higgs bosons at LHC and constraints of their masses are also discussed. (orig.)
Irges, Nikos; Zoupanos, George
2011-01-01
We present an extension of the Standard Model inspired by the E_8 x E_8 Heterotic String. In order that a reasonable effective Lagrangian is presented we neglect everything else other than the ten-dimensional N=1 supersymmetric Yang-Mills sector associated with one of the gauge factors and certain couplings necessary for anomaly cancellation. We consider a compactified space-time M_4 x B_0 / Z_3, where B_0 is the nearly-Kaehler manifold SU(3)/U(1) x U(1) and Z_3 is a freely acting discrete group on B_0. Then we reduce dimensionally the E_8 on this manifold and we employ the Wilson flux mechanism leading in four dimensions to an SU(3)^3 gauge theory with the spectrum of a N=1 supersymmetric theory. We compute the effective four-dimensional Lagrangian and demonstrate that an extension of the Standard Model is obtained with interesting features including a conserved baryon number and fixed tree level Yukawa couplings and scalar potential. The spectrum contains new states such as right handed neutrinos and heavy ...
Energy Technology Data Exchange (ETDEWEB)
Leontaris, G.K.; Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Theoretical Physics Div.)
1990-06-28
We calculate the trilinear superpotential of the hidden sector of the three generation flipped SU(5)xU(1)xU(1){sup 4}xSO(10)xSU(4) superstring model. We perform a renormalization group analysis of the model taking into account the hidden sector. We find that, in all relevant cases, fractionally charged tetraplets of the hidden SO(6) gauge group are confined at a high scale. Nevertheless, their contribution to the observable U(1) gauge coupling evolution results in a drastic reduction of the available freedom in the values of a{sub 3}(m{sub w}), sin{sup 2}{theta}{sub w} and M{sub x} that allow superunification. (orig.).
SU(2) and SU(1,1) squeezing of interacting radiation modes
International Nuclear Information System (INIS)
Abdalla Sebawe, M.; Faisal El-Orany, A.A.; Perina, J.
2000-01-01
In this communication we discuss SU(1,1) and SU(2) squeezing of an interacting system of radiation modes in a quadratic medium in the framework of Lie algebra. We show that regardless of which state being initially considered, squeezing can be periodically generated. (authors)
Implications of Anomalous U(1) Symmetry in Unified Models the Flipped SU(5) x U(1) Paradigm
Ellis, Jonathan Richard; Rizos, J; Ellis, John
2000-01-01
A generic feature of string-derived models is the appearance of an anomalousAbelian U(1)_A symmetry which, among other properties, constrains the Yukawacouplings and distinguishes the three families from each other. In this paper,we discuss in a model-independent way the general constraints imposed by such aU(1)_A symmetry on fermion masses, R-violating couplings and proton-decayoperators in a generic flipped SU(5) x U(1)' model. We construct all possibleviable fermion mass textures and give various examples of effective low-energymodels which are distinguished from each other by their different predictionsfor B-, L- and R-violating effects. We pay particular attention to predictionsfor neutrino masses, in the light of the recent Super-Kamiokande data.
SU(5)×U(1)X grand unification with minimal seesaw and Z‧-portal dark matter
Okada, Nobuchika; Okada, Satomi; Raut, Digesh
2018-05-01
We propose a grand unified SU (5) × U(1)X model, where the standard SU(5) grand unified theory is supplemented by minimal seesaw and a right-handed neutrino dark matter with an introduction of a global Z2-parity. In the presence of three right-handed neutrinos (RHNs), the model is free from all gauge and mixed-gravitational anomalies. The SU(5) symmetry is broken into the Standard Model (SM) gauge group at MGUT ≃ 4 ×1016GeV in the standard manner, while the U(1)X symmetry breaking occurs at the TeV scale, which generates the TeV-scale mass of the U(1)X gauge boson (Z‧ boson) and the three Majorana RHNs. A unique Z2-odd RHN is stable and serves as the dark matter (DM) in the present Universe, while the remaining two RHNs work to generate the SM neutrino masses through the minimal seesaw. We investigate the Z‧-portal RHN DM scenario in this model context. We find that the constraints from the DM relic abundance, and the Z‧ boson search at the Large Hadron Collider (LHC), and the perturbativity bound on the U(1)X gauge coupling are complementary to narrow down the allowed parameter region in the range of 3.0 ≤mZ‧ [TeV ] ≤ 9.2 for the Z‧ boson mass. The allowed region for mZ‧ ≤ 5TeV will be fully covered by the future LHC experiments. We also briefly discuss the successful implementation of Baryogenesis and cosmological inflation scenarios in the present model.
New approach to SU2LxU1 radiative corrections in e+e- annihilation processes near the Z0 resonance
International Nuclear Information System (INIS)
Jadach, S.; Ward, B.F.L.
1988-08-01
We show explicitly how to proceed in the Monte Carlo simulation of SU 2L xU 1 radiative corrections in order to include multiple soft photon emission on an event by event basis. The method is based on the rigorous theory of summing infrared contributions to the respective cross section by Yennie, Frautschi and Suura. Our method is illustrated on the example of initial state bremsstrahlung. (author). 10 refs, 2 figs
Unitary relation for the time-dependent SU(1,1) systems
International Nuclear Information System (INIS)
Song, Dae-Yup
2003-01-01
The system whose Hamiltonian is a linear combination of the generators of SU(1,1) group with time-dependent coefficients is studied. It is shown that there is a unitary relation between the system and a system whose Hamiltonian is simply proportional to the generator of the compact subgroup of SU(1,1). The unitary relation is described by the classical solutions of a time-dependent (harmonic) oscillator. Making use of the relation, the wave functions satisfying the Schroedinger equation are given, for a general unitary representation, in terms of the matrix elements of a finite group transformation (Bargmann function). The wave functions of the harmonic oscillator with an inverse-square potential is studied in detail, and it is shown that through an integral, the model provides a way of deriving the Bargmann function for the representation of positive discrete series of SU(1,1)
Entropy of entangled states and SU(1,1) and SU(2) symmetries
International Nuclear Information System (INIS)
Santana, A.E.; Khanna, F.C.; Revzen, M.
2002-01-01
Based on a recent definition of a measure for entanglement [Plenio and Vedral, Contemp. Phys. 39, 431 (1998)], examples of maximum entangled states are presented. The construction of such states, which have symmetry SU(1,1) and SU(2), follows the guidance of thermofield dynamics formalism
Neutrino masses in the flipped SU(5) x U(1) and the SU(4) x O(4) GUT models
Energy Technology Data Exchange (ETDEWEB)
Ranfone, S.; Papageorgiu, E.
1992-03-01
We classify the different neutrino-mass pattern arising in string-inspired Grand Universal Theory (GUT) and supersymmetric GUT models based on the flipped SU(5)xU(1) and the SU(4)xO(4) gauge groups. Phenomenologically interesting spectra are obtained through the interplay of the two seesaw mechanisms present, with typical neutrino masses {approx}10{sup -3} eV in the supersymmetric GUT models and of order 0.1 - 10 KeV in the ordinary GUTs. (author).
Neutrino masses in the flipped SU(5)xU(1) and the SU(4)xO(4) GUT models
Energy Technology Data Exchange (ETDEWEB)
Papageorgiu, E.; Ranfone, S. (Rutherford Appleton Lab., Chilton (United Kingdom))
1992-05-21
We classify the different neutrino-mass patterns arising in string-inspired GUT and supersymmetric GUT models based on the flipped SU(5)xU(1) and the SU(4)xO(4) gauge groups. Phenomenologically interesting spectra are obtained through the interplay of the two seesaw mechanisms present, with typical neutrino masses {proportional to}10{sup -3} eV in the supersymmetric GUT models and of order 0.1-10 keV in the ordinary GUTs. (orig.).
International Nuclear Information System (INIS)
Dubovik, V.M.; Zenkin, S.V.
1983-01-01
On the basis of the total effective Hamiltonian of the parity nonconserving (PNC) hadron-hadron interactions found within the standard model SU(2)sUb(L)XU(1)xSU(3)sub(c) in all orders of the leading logarithms allowing for the difference of quark mass scales (msub(c)>>msub(u, d, s)) the PNC πNN vertex generating the long-range part of the PNC nuclear forces is considered. The origin and the methods of calculation of various contributions to this vertex with a special attention to possible artifacts of these methods is anatyzed. Within the self-consistence calculational framework partly including the MIT bag model the total value of the constant hsub(π) determining the PNC πNN vertex is evaluated. Value of hsub(π) (approximately 1.3x10 -7 ) is 2-4 times as small as previous estimates and does not contradict the experimental data
Dimensional reduction of U(1) x SU(2) Chern-Simons bosonization: Application to the t - J model
International Nuclear Information System (INIS)
Marchetti, P.A.
1996-09-01
We perform a dimensional reduction of the U(1) x SU(2) Chern-Simons bosonization and apply it to the t - J model, relevant for high T c superconductors. This procedure yields a decomposition of the electron field into a product of two ''semionic'' fields, i.e. fields obeying Abelian braid statistics with statistics parameter θ = 1/4, one carrying the charge and the other the spin degrees of freedom. A mean field theory is then shown to reproduce correctly the large distance behaviour of the correlation functions of the 1D t - J model at >> J. This result shows that to capture the essential physical properties of the model one needs a specific ''semionic'' form of spin-charge separation. (author). 31 refs
Heavy charged leptons in an SU(3)L x U(1)N model
International Nuclear Information System (INIS)
Pleitez, V.; Tonasse, M.D.
1992-12-01
An SU(3) L x U(1) N model for the electroweak interactions which includes additional heavy charged leptons is considered. These leptons have not strong constraints on their masses since they do not couple in the same way as the lightest leptons to the neutral-currents and also because new contributions to the muon g-2 factor already suppressed because of the massive new vector boson present in this model. (author)
Analiza kvalitete procesa sušenja u klasičnim komornim sušionicama
Sedlar, Tomislav; Pervan, Stjepan
2010-01-01
U radu su dani rezultati ispitivanja kvalitete sušenja u klasičnoj komornoj sušionici. Ispitivanje se temelji na novoj metodologiji kojom se prikazuje razina uspješnosti procesa sušenja na temelju analize kvalitete tog procesa u klasičnoj komornoj sušionici, korištenjem znanstveno unaprijeđene verzije liste provjere u svakodnevnoj praktičnoj primjeni. Za verificiranje nove metodologije ispitivanja izabrano je poduzeće koje se specijaliziralo za izradu lamel parketa i klasičnog parketa. U s...
Cvetic, Mirjam; Piragua, Hernan; Taylor, Washington
2015-01-01
We construct the general form of an F-theory compactification with two U(1) factors based on a general elliptically fibered Calabi-Yau manifold with Mordell-Weil group of rank two. This construction produces broad classes of models with diverse matter spectra, including many that are not realized in earlier F-theory constructions with U(1)xU(1) gauge symmetry. Generic U(1)xU(1) models can be related to a Higgsed non-Abelian model with gauge group SU(2)xSU(2)xSU(3), SU(2)^3xSU(3), or a subgroup thereof. The nonlocal horizontal divisors of the Mordell-Weil group are replaced with local vertical divisors associated with the Cartan generators of non-Abelian gauge groups from Kodaira singularities. We give a global resolution of codimension two singularities of the Abelian model; we identify the full anomaly free matter content, and match it to the unHiggsed non-Abelian model. The non-Abelian Weierstrass model exhibits a new algebraic description of the singularities in the fibration that results in the first expl...
String completion of an SU(3c⊗SU(3L⊗U(1X electroweak model
Directory of Open Access Journals (Sweden)
Andrea Addazi
2016-08-01
Full Text Available The extended electroweak SU(3c⊗SU(3L⊗U(1X symmetry framework “explaining” the number of fermion families is revisited. While 331-based schemes can not easily be unified within the conventional field theory sense, we show how to do it within an approach based on D-branes and (unoriented open strings, on Calabi–Yau singularities. We show how the theory can be UV-completed in a quiver setup, free of gauge and string anomalies. Lepton and baryon numbers are perturbatively conserved, so neutrinos are Dirac-type, and their lightness results from a novel TeV scale seesaw mechanism. Dynamical violation of baryon number by exotic instantons could induce neutron–antineutron oscillations, with proton decay and other dangerous R-parity violating processes strictly forbidden.
International Nuclear Information System (INIS)
Segre, G.; Arthur Weldon, H.
1980-01-01
The general problem of conservation of strangeness and other quark flavors by the exchange of several neutral Higgs mesons is investigated in SU (2)/sub L/ x U (1). We find that the horizontal symmetries necessary to enforce this conservation conflict with the known Cabibbo mixing. In particular, if the quarks form an irreducible representation of the horizontal symmetry, the mixing angles are all trivial (i.e. 0 or π/2); if they form a reducible representation, it is possible to have some nontrivial mixing angles, but only if there are several unmixed generations of quarks with exactly the same relative pattern of masses and mixings
SU(3)xSU(2) color symmetry and Usub(B)(1)xSUsub(f)(4) quark model of hadrons
International Nuclear Information System (INIS)
Khrushchov, V.V.
1982-01-01
A quark model with a generalized color group SUsub(c)(3)xSU'sub(c)(2) is treated in the framework of the SUsub(f)(4)xUsub(B)(1) symnetry of strong interactions. The model contains twelve standard u, d, s, c quarks and new quarks belonging to representation 6 of the SU(4) group. The properties of new quarks are considered with respect to the color group and some properties of the exotic states, predicted by the model are presented
String derived exophobic SU(6)×SU(2) GUTs
International Nuclear Information System (INIS)
Bernard, Laura; Faraggi, Alon E.; Glasser, Ivan; Rizos, John; Sonmez, Hasan
2013-01-01
With the apparent discovery of the Higgs boson, the Standard Model has been confirmed as the theory accounting for all sub-atomic phenomena. This observation lends further credence to the perturbative unification in Grand Unified Theories (GUTs) and string theories. The free fermionic formalism yielded fertile ground for the construction of quasi-realistic heterotic-string models, which correspond to toroidal Z 2 ×Z 2 orbifold compactifications. In this paper we study a new class of heterotic-string models in which the GUT group is SU(6)×SU(2) at the string level. We use our recently developed fishing algorithm to extract an example of a three generation SU(6)×SU(2) GUT model. We explore the phenomenology of the model and show that it contains the required symmetry breaking Higgs representations. We show that the model admits flat directions that produce a Yukawa coupling for a single family. The novel feature of the SU(6)×SU(2) string GUT models is that they produce an additional family universal anomaly free U(1) symmetry, and may remain unbroken below the string scale. The massless spectrum of the model is free of exotic states.
Deep-inelastic lepton scattering in an SU(3) x U(1) gauge model
International Nuclear Information System (INIS)
Maharana, K.; Sastry, C.V.
1976-01-01
Linear relations and sum rules for deep-inelastic lepton scattering are derived in the light-cone algebra approach from a set of weak, neutral, and electromagnetic currents based on an SU(3) x U(1) gauge model proposed by Schechter and Ueda
Model with a gauged lepton flavor SU(2) symmetry
Chiang, Cheng-Wei; Tsumura, Koji
2018-05-01
We propose a model having a gauged SU(2) symmetry associated with the second and third generations of leptons, dubbed SU(2) μτ , of which U{(1)}_{L_{μ }-L_{τ }} is an Abelian subgroup. In addition to the Standard Model fields, we introduce two types of scalar fields. One exotic scalar field is an SU(2) μτ doublet and SM singlet that develops a nonzero vacuum expectation value at presumably multi-TeV scale to completely break the SU(2) μτ symmetry, rendering three massive gauge bosons. At the same time, the other exotic scalar field, carrying electroweak as well as SU(2) μτ charges, is induced to have a nonzero vacuum expectation value as well and breaks mass degeneracy between the muon and tau. We examine how the new particles in the model contribute to the muon anomalous magnetic moment in the parameter space compliant with the Michel decays of tau.
International Nuclear Information System (INIS)
Govil, Karan; Gunaydin, Murat
2013-01-01
Quantization of the geometric quasiconformal realizations of noncompact groups and supergroups leads directly to their minimal unitary representations (minreps). Using quasiconformal methods massless unitary supermultiplets of superconformal groups SU(2,2|N) and OSp(8 ⁎ |2n) in four and six dimensions were constructed as minreps and their U(1) and SU(2) deformations, respectively. In this paper we extend these results to SU(2) deformations of the minrep of N=4 superconformal algebra D(2,1;λ) in one dimension. We find that SU(2) deformations can be achieved using n pair of bosons and m pairs of fermions simultaneously. The generators of deformed minimal representations of D(2,1;λ) commute with the generators of a dual superalgebra OSp(2n ⁎ |2m) realized in terms of these bosons and fermions. We show that there exists a precise mapping between symmetry generators of N=4 superconformal models in harmonic superspace studied recently and minimal unitary supermultiplets of D(2,1;λ) deformed by a pair of bosons. This can be understood as a particular case of a general mapping between the spectra of quantum mechanical quaternionic Kähler sigma models with eight super symmetries and minreps of their isometry groups that descends from the precise mapping established between the 4d, N=2 sigma models coupled to supergravity and minreps of their isometry groups.
Q-creation and annihilation tensors for the two parameters deformation of U(SU(2))
International Nuclear Information System (INIS)
Wehrhahn, R.F.; Vraceanu, D.
1993-03-01
The Jordan-Schwinger construction for the Hopf algebra U qp (su(2)) is realized. The creation and annihilation tensor operators together with their tensor products including the Casimir operators are calculated. (orig.)
Phenomenological implications of the flipped SU(5) x U(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Tamvakis, K. (Physics Dept., Univ. of Ioannina (Greece))
1991-07-01
We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. D and F-flatness restricts the number of massless isodoublets to four. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet v.e.v's associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150GeV {<=} m{sub 1} < 200GeV, for most part of the parameter space, while lower values are possible only in a very small extermal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2} {theta}{sub w}, {alpha}{sub 3}(M{sub w})) in the presence of a heavy top quark. (orig.).
Neutrinoless double beta decay in an SU(3)L x U(1)N model
International Nuclear Information System (INIS)
Pleitez, V.; Tonasse, M.D.
1993-01-01
A model for the electroweak interactions with SU (3) L x U(1) N gauge symmetry is considered. It is shown that, it is the conservation of F = L + B which forbids massive neutrinos and the neutrinoless double beta decay, (β β) On u. Explicit and spontaneous breaking of F imply that the neutrinos have an arbitrary mass and (β β) On u proceeds also with some contributions that do not depend explicitly on the neutrino mass. (author)
International Nuclear Information System (INIS)
Desai, B.R.; Xu, G.
1990-01-01
Based on the idea that electromagnetism is responsible for mass differences within isotopic multiplets (e.g., pointlike neutron and proton or u and d quarks), we generalize an SU(2)xU(1) model in a toy field theory of vectors to a supersymmetric model and investigate the finite mass difference within the isotopic doublet. It is found that under soft-supersymmetry breaking, a positive n-p mass difference can be obtained under reasonable assumptions for the parameters involved
Gauge symmetry breaking in the hidden sector of the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Antoniadis, I.; Rizos, J. (Centre de Physique Theorique, Ecole Polytechnique, 91 - Palaiseau (France)); Tamvakis, K. (Theoretical Physics Div., Univ. Ioannina (Greece))
1992-03-26
We analyze the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSU(4) superstring model with a spontaneously broken hidden sector down to SO(7)xSO(5) taking into account non-renormalizable superpotential terms up to eight order. As a result of the hidden sector breaking the 'exotic' states get a mass and the 'observable' spectrum is composed of the standard three families. In addition, Cabibbo mixing arises at sixth order and an improved fermion mass hierarchy emerges. (orig.).
A separate SU(2) for the third family: Topflavor
International Nuclear Information System (INIS)
Muller, D.J.; Nandi, S.; Univ. of Texas, Austin, TX
1996-01-01
The authors consider the extended electroweak gauge group SU(2) 1 xSU(2) x xU(1) Y where the first and second families of fermions couple to SU(2) 1 while the third family couples to SU(2) 2 . Bounds based on precision electroweak observables and heavy gauge boson searches are placed on the new parameters of the theory. The extra gauge bosons can be as light as about a TeV and can be discovered at future colliders such as the NLC and LHC for a wide range of the parameter space. FCNC interactions are also considered
International Nuclear Information System (INIS)
Hoang Ngoc Long; Nguyen Quynh Lan
2003-05-01
We show that the SU(3) C x SU(3) L x U(1) N (3-3-1) model with right-handed neutrinos can provide candidates for self-interacting dark matter, namely they are the CP-even and odd Higgs bosons. These dark matters are stable without imposing of new symmetry and should be weak-interacting. (author)
Phenomenology of the SU(3)cxSU(3)LxU(1)X model with exotic charged leptons
International Nuclear Information System (INIS)
Salazar, Juan C.; Ponce, William A.; Gutierrez, Diego A.
2007-01-01
A phenomenological analysis of the three-family model based on the local gauge group SU(3) c xSU(3) L xU(1) X with exotic charged leptons, is carried out. Instead of using the minimal scalar sector able to break the symmetry in a proper way, we introduce an alternative set of four Higgs scalar triplets, which combined with an anomaly-free discrete symmetry, produce quark and charged lepton mass spectrum without hierarchies in the Yukawa coupling constants. We also embed the structure into a simple gauge group and show some conditions to achieve a low energy gauge coupling unification, avoiding possible conflict with proton decay bounds. By using experimental results from the CERN-LEP, SLAC linear collider, and atomic parity violation data, we update constraints on several parameters of the model
Strongest experimental constraints on SU(5)xU(1) supergravity models
International Nuclear Information System (INIS)
Lopez, J.L.; Nanopoulos, D.V.; Park, G.T.; Zichichi, A.
1994-01-01
We consider a class of well-motivated string-inspired flipped SU(5) supergravity models which include four supersymmetry-breaking scenarios: no-scale, strict no-scale, dilaton, and special dilaton, such that only three parameters are needed to describe all new phenomena (m t ,tanβ,m g ). We show that the CERN LEP precise measurements of the electroweak parameters in the form of the ε 1 variable and the CLEO II allowed range for B(b→sγ) are at present the most important experimental constraints on this class of models. For m t approx-gt 155 (165) GeV, the ε 1 constraint [at 90 (95)% C.L.] requires the presence of light charginos (m χ1 ± approx-lt 50--100 GeV depending on m t ). Since all sparticle masses are proportional to m g , m χ1 ± approx-lt 100 GeV implies m χ1 0 approx-lt 55 GeV, m χ2 0 approx-lt 100 GeV, m g approx-lt 360 GeV, m q approx-lt 350 (365) GeV, m e R approx-lt 80 (125) GeV, m e L approx-lt 120 (155) GeV, and m n u approx-lt 100 (140) GeV in the no-scale (dilaton) flipped SU(5) supergravity model. The B(b→sγ) constraint excludes a significant fraction of the otherwise allowed region in the (m χ1 ± ,tanβ) plane (irrespective of the magnitude of the chargino mass), while future experimental improvements will result in decisive tests of these models
Kim, Jihn E.; Kyae, Bumseok; Nam, Soonkeon
2017-12-01
In string compactifications, frequently the anomalous U(1) gauge symmetry appears which belongs to E_8 × E_8' of the heterotic string. This anomalous U(1) gauge boson obtains mass at the compactification scale (≈ 10^{18 } {GeV}) by absorbing one pseudoscalar (corresponding to the model-independent axion) from the second rank antisymmetric tensor field B_{MN}. Below the compactification scale a global symmetry U(1)_{anom} results whose charge Q_anom is the original gauge U(1) charge. This is the most natural global symmetry, realizing the "invisible" axion. This global symmetry U(1)_{anom} is suitable for a flavor symmetry. In the simplest compactification model with the flipped SU(5) grand unification, all the low energy parameters are calculated in terms of the vacuum expectation values of the standard model singlets.
DEFF Research Database (Denmark)
Schneider, Uffe Vest; Nielsen, Rikke Lyngaa; Pedersen, Court
2007-01-01
BACKGROUND: High blood levels of soluble urokinase Plasminogen Activator Receptor (suPAR) are associated with poor outcomes in human immunodeficiency-1 (HIV-1) infected individuals. Research on the clinical value of suPAR in HIV-1 infection led to the development of the suPARnosticTM assay...... for commercial use in 2006. The aim of this study was to: 1) Evaluate the prognostic value of the new suPARnosticTM assay and 2) Determine whether polymorphisms in the active promoter of uPAR influences survival and/or suPAR values in HIV-1 patients who are antiretroviral therapy (ART) naive. METHODS: DNA...... and an A to G transition at -465 comparative to the transcription start site. These promoter transitions did not influence neither the suPAR levels nor patient survival. CONCLUSION: Plasma suPAR levels, as measured by the suPARnosticTM assay, were strongly predictive of survival in ART-naive HIV-1 infected...
A minimal spontaneous CP violation model with small neutrino mass and SU(2) x U(1) x Z3 symmetry
International Nuclear Information System (INIS)
Geng, C.Q.; Ng, J.N.
1988-04-01
It is shown that spontaneous CP violation and natural flavor conservation can occur in the SU(2) L x U(1) Y model based on two Higgs doublet and one Higgs singlet fields with a Z 3 discrete symmetry. Physical CP nonconservation is purely due to scalar-pseudoscalar mixings. In order for this to be a major source of CP violation a light spin-O boson of mass less than 10 GeV is required. The see-saw mechanism can be implemented to generate small neutrino masses. The model implies a relatively large electric dipole moment for charged leptons and small value for ε'/ε
Retracing the phenomenology of the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Dept. of Physics)
1990-11-22
We study in detail gauge symmetry breaking in the SU(5)xU(1)'xU(1){sup 4}xSO(10)xSO(6) superstring model, solving the D- and F-flatness conditions and taking into account quartic and quintic superpotential terms. We find that, to this order, the model describes two massive generations of quarks and leptons as well as a massless generation expected to receive naturally suppressed masses from higher order non-renormalizable terms. We show that D-flatness restricts the number of massless isodoublets to four. We also extract an inequality relating the top quark mass to M{sub W}. (orig.).
3D gauged supergravity from SU(2) reduction of $N=1$ 6D supergravity
Gava, Edi; Narain, K S
2010-01-01
We obtain Yang-Mills $SU(2)\\times G$ gauged supergravity in three dimensions from $SU(2)$ group manifold reduction of (1,0) six dimensional supergravity coupled to an anti-symmetric tensor multiplet and gauge vector multiplets in the adjoint of $G$. The reduced theory is consistently truncated to $N=4$ 3D supergravity coupled to $4(1+\\textrm{dim}\\, G)$ bosonic and $4(1+\\textrm{dim}\\, G)$ fermionic propagating degrees of freedom. This is in contrast to the reduction in which there are also massive vector fields. The scalar manifold is $\\mathbf{R}\\times \\frac{SO(3,\\, \\textrm{dim}\\, G)}{SO(3)\\times SO(\\textrm{dim}\\, G)}$, and there is a $SU(2)\\times G$ gauge group. We then construct $N=4$ Chern-Simons $(SO(3)\\ltimes \\mathbf{R}^3)\\times (G\\ltimes \\mathbf{R}^{\\textrm{dim}G})$ three dimensional gauged supergravity with scalar manifold $\\frac{SO(4,\\,1+\\textrm{dim}G)}{SO(4)\\times SO(1+\\textrm{dim}G)}$ and explicitly show that this theory is on-shell equivalent to the Yang-Mills $SO(3)\\times G$ gauged supergravity the...
Flavor violations in no-scale flipped SU(5)xU(1)
Energy Technology Data Exchange (ETDEWEB)
Faraggi, A.E.; Lopez, J.L.; Nonopoulos, D.V.; Yuan, K.
1989-05-04
We study lepton-number violations in the flipped SU(5)xU(1) model in the context of no-scale supergravity. We find that the experimental limits on ..mu..->e..gamma.., ..mu..->eeanti e, and ..mu.. conversion in nuclei generally imply an upper bound on the top quark mass and a lower bound on the gaugino mass. We conclude that the seed of supersymmetry breaking in no-scale models (gaugino masses) radically changes some results obtained in ''minimal'' N=1 supergravity in the leptonic sector, while results in the hadronic sector (e.g. K-anti K, B-anti B mixings, and b->s..gamma..) remain essentially unchanged.
Dark revelations of the [SU(3)]3 and [SU(3)]4 gauge extensions of the standard model
Kownacki, Corey; Ma, Ernest; Pollard, Nicholas; Popov, Oleg; Zakeri, Mohammadreza
2018-02-01
Two theoretically well-motivated gauge extensions of the standard model are SU(3)C × SU(3)L × SU(3)R and SU(3)q × SU(3)L × SU(3)l × SU(3)R, where SU(3)q is the same as SU(3)C and SU(3)l is its color leptonic counterpart. Each has three variations, according to how SU(3)R is broken. It is shown here for the first time that a built-in dark U(1)D gauge symmetry exists in all six versions. However, the corresponding symmetry breaking pattern does not reduce properly to that of the standard model, unless an additional Z2‧ symmetry is defined, so that U(1)D ×Z2‧ is broken to Z2 dark parity. The available dark matter candidates in each case include fermions, scalars, as well as vector gauge bosons. This work points to the possible unity of matter with dark matter, the origin of which may not be ad hoc.
Dark revelations of the [SU(3]3 and [SU(3]4 gauge extensions of the standard model
Directory of Open Access Journals (Sweden)
Corey Kownacki
2018-02-01
Full Text Available Two theoretically well-motivated gauge extensions of the standard model are SU(3C×SU(3L×SU(3R and SU(3q×SU(3L×SU(3l×SU(3R, where SU(3q is the same as SU(3C and SU(3l is its color leptonic counterpart. Each has three variations, according to how SU(3R is broken. It is shown here for the first time that a built-in dark U(1D gauge symmetry exists in all six versions. However, the corresponding symmetry breaking pattern does not reduce properly to that of the standard model, unless an additional Z2′ symmetry is defined, so that U(1D×Z2′ is broken to Z2 dark parity. The available dark matter candidates in each case include fermions, scalars, as well as vector gauge bosons. This work points to the possible unity of matter with dark matter, the origin of which may not be ad hoc.
Static forces in d=2+1 SU(N) gauge theories
International Nuclear Information System (INIS)
Meyer, H.B.
2006-07-01
Using a three-level algorithm we perform a high-precision lattice computation of the static force up to 1fm in the 2+1 dimensional SU(5) gauge theory. Discretization errors and the continuum limit are discussed in detail. By comparison with existing SU(2) and SU(3) data it is found that σr 2 0 =1.65-(π)/(24) holds at an accuracy of 1% for all N≥2, where r 0 is the Sommer reference scale. The effective central charge c(r) is obtained and an intermediate distance r s is defined via the property c(r s )=(π)/(24). It separates in a natural way the short-distance regime governed by perturbation theory from the long-distance regime described by an effective string theory. The ratio τ s /τ 0 decreases significantly from SU(2) to SU(3) to SU(5), where r s 0 . We give a preliminary estimate of its value in the large-N limit. The static force in the smallest representation of N-ality 2, which tends to the k=2 string tension as r→∞, is also computed up to 0.7 fm. The deviation from Casimir scaling is positive and grows from 0.1% to 1% in that range. (Orig.)
International Nuclear Information System (INIS)
Gipson, J.M.; Marshak, R.E.
1984-01-01
The supersymmetric versions of the left-right-symmetric SU/sub C/(4) x SU/sub L/(2) x SU/sub R/(2) Pati-Salam theory and the grand unified SO(10) theory are studied. In the minimal versions of these models the requirement of soft or spontaneous breaking of supersymmetry, together with renormalizibility, leads to an accidental global U(1) symmetry which leads to baryon-number conservation. A necessary condition for this symmetry to be broken is the existence of fields which are antisymmetric in at least two SU/sub C/(4) indices. The introduction of such fields may allow for observable neutron oscillation
SU(1,2) invariance in two-dimensional oscillator
Energy Technology Data Exchange (ETDEWEB)
Krivonos, Sergey [Bogoliubov Laboratory of Theoretical Physics,Joint Institute for Nuclear Research, 141980 Dubna (Russian Federation); Nersessian, Armen [Yerevan State University,1 Alex Manoogian St., Yerevan, 0025 (Armenia); Tomsk Polytechnic University,Lenin Ave. 30, 634050 Tomsk (Russian Federation)
2017-02-01
Performing the Hamiltonian analysis we explicitly established the canonical equivalence of the deformed oscillator, constructed in arXiv:1607.03756, with the ordinary one. As an immediate consequence, we proved that the SU(1,2) symmetry is the dynamical symmetry of the ordinary two-dimensional oscillator. The characteristic feature of this SU(1,2) symmetry is a non-polynomial structure of its generators written in terms of the oscillator variables.
International Nuclear Information System (INIS)
Yamaguchi, A.; Sugamoto, A.
2000-01-01
Applying Genetic Algorithm for the Lattice Gauge Theory is formed to be an effective method to minimize the action of gauge field on a lattice. In 4 dimensions, the critical point and the Wilson loop behaviour of SU(2) lattice gauge theory as well as the phase transition of U(1) theory have been studied. The proper coding methodi has been developed in order to avoid the increase of necessary memory and the overload of calculation for Genetic Algorithm. How hichhikers toward equilibrium appear against kidnappers is clarified
Phenomenology of the SU(3)c x SU(3)L x U(1)X model with right-handed neutrinos
International Nuclear Information System (INIS)
Gutierrez, D.A.; Ponce, W.A.; Sanchez, L.A.
2006-01-01
A phenomenological analysis of the three-family model based on the local gauge group SU(3) c x SU(3) L x U(1) X with right-handed neutrinos is carried out. Instead of using the minimal scalar sector able to break the symmetry in a proper way, we introduce an alternative set of four Higgs scalar triplets, which combined with an anomaly-free discrete symmetry, produces a quark mass spectrum without hierarchies in the Yukawa coupling constants. We also embed the structure into a simple gauge group and show some conditions for achieving a low energy gauge coupling unification, avoiding possible conflict with proton decay bounds. By using experimental results from the CERN-LEP, SLAC linear collider, and atomic parity violation data, we update constraints on several parameters of the model. (orig.)
Superheavy contributions to FCNC in the flipped SU(5) x U(1)
Energy Technology Data Exchange (ETDEWEB)
Gabbiani, F.; Masiero, A.
1988-08-04
In the supersymmetric GUT's the presence of the superheavy fields yields new contributions to flavour-changing neutral-current effects at low energy. We analyse this phenomenon in the context of the flipped SU(5) x U(1) superstring (-inspired) model. We show that possibly sizeable flavour leptonic changes (..mu.. -> e..gamma.., ..mu.. -> eeanti e, ..mu..-e conversion in nuclei) are generated. K-anti K, B-anti B mixings and b -> s..gamma.. constrain new couplings at the superlarge scale, which are unrelated to the standard Yukawa coefficients.
International Nuclear Information System (INIS)
Kibler, M.; Grenet, G.
1979-07-01
The SU 2 unit tensor operators tsub(k,α) are studied. In the case where the spinor point group G* coincides with U 1 , then tsub(k α) reduces up to a constant to the Wigner-Racah-Schwinger tensor operator tsub(kqα), an operator which produces an angular momentum state. One first investigates those general properties of tsub(kα) which are independent of their realization. The tsub(kα) in terms of two pairs of boson creation and annihilation operators are realized. This leads to look at the Schwinger calculus relative to one angular momentum of two coupled angular momenta. As a by-product, a procedure is given for producing recursion relationships between SU 2 Wigner coefficients. Finally, some of the properties of the Wigner and Racah operators for an arbitrary compact group and the SU 2 coupling coefficients are studied
Calculation of the top quark mass in the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Leontaris, G.K.; Rizos, J.; Tamvakis, K. (Ioannina Univ. (Greece). Dept. of Physics)
1990-11-08
We present a complete renormalization group calculation of the top-quark mass in the SU(5)xU(1) superstring model. We solve the coupled renormalization group equations for the gauge and Yukawa couplings in the two-loop approximation and obtain the top-quark mass as a function of two parameters of the model which could be chosen to be ratios of singlet VEVs associated with the surplus (U(1)){sup 4} breaking. We obtain a heavy top-quark with 150 GeV{le}m{sub t}<200 GeV, for most part of the parameter space, while lower values are possible only in a very small extremal region. We also compute the allowed range of unification parameters (M{sub x}, sin{sup 2}{theta}{sub w}, {alpha}{sub 3}(M{sub W})) in the presence of a heavy top-quark. (orig.).
Phase structure of the SU(5) Coleman-Weinberg theory
International Nuclear Information System (INIS)
Tkachev, I.I.
1984-01-01
The phase structure of the SU(5) Coleman-Weinberg theory in the one-loop approximation is obtained with account of temperature and space-time curvature. We show that the most essential contribution is that from the interaction between 5 and 24 scalar fields which reflects the existence of two strongly different mass scales in the model. A stability boundary of the SU(3) x SU(2) x U(1) phase is found. It is shown that the SU(4) x U(1) phase in the Coleman-Weinberg theory is unstable. (orig.)
Kuutma, Kristin, 1959-
2008-01-01
Vaadeldakse saami autori Johan Turi raamatut Muitalus s{u00E1miid birra (1910) ja selle tõlget taani keelede Emilie Demant Hatti poolt ning uuritakse, millist autoritaarsust ja kultuurilist poeetikat see peegeldab ja millist sotsiaalset ja kultuurilist kriitikat ta edasi arendab
Diversity of off-shell twisted (4,4) multiplets in SU(2)xSU(2) harmonic superspace
International Nuclear Information System (INIS)
Ivanov, E.A.; Sutulin, A.O.
2004-01-01
We elaborate on four different types of twisted N=(4,4) supermultiplets in the SU(2)xSU(2), 2D harmonic superspace. In the conventional N=(4,4), 2D superspace they are described by the superfields q ia , q Ia , q IA , subjected to proper differential constraints, (i, I, a, A) being the doublet indices of four groups SU(2) which form the full R-symmetry group SO(4) L xSO(4) R of N=(4,4) supersymmetry. We construct the torsionful off-shell sigma-model actions for each type of these multiplets, as well as the corresponding invariant mass terms, in an analytic subspace of the SU(2)xSU(2) harmonic superspace. As an instructive example, N=(4,4) superconformal extension of the SU(2)xU(1) WZNW sigma-model action and its massive deformation are presented for the multiplet q iA . We prove that N=(4,4) supersymmetry requires the general sigma-model action of pair of different multiplets to split into a sum of sigma-model actions of each multiplet. This phenomenon also persists if a larger number of non-equivalent multiplets are simultaneously included. We show that different multiplets may interact with each other only through mixed mass terms which can be set up for multiplets belonging to 'self-dual' pairs (q ia , q IA ) and (q Ia , q iA ). The multiplets from different pairs cannot interact at all. For a 'self-dual' pair of the twisted multiplets we give the most general form of the on-shell scalar potential
A Realistic $U(2)$ Model of Flavor arXiv
Linster, Matthias
We propose a simple $U(2)$ model of flavor compatible with an $SU(5)$ GUT structure. All hierarchies in fermion masses and mixings arise from powers of two small parameters that control the $U(2)$ breaking. In contrast to previous $U(2)$ models this setup can be realized without supersymmetry and provides an excellent fit to all SM flavor observables including neutrinos. We also consider a variant of this model based on a $D_6 \\times U(1)_F$ flavor symmetry, which closely resembles the $U(2)$ structure, but allows for Majorana neutrino masses from the Weinberg operator. Remarkably, in this case one naturally obtains large mixing in the lepton sector from small mixing in the quark sector. The model also offers a natural option for addressing the Strong CP Problem and Dark Matter by identifying the Goldstone boson of the $U(1)_F$ factor as the QCD axion.
International Nuclear Information System (INIS)
Nha, Hyunchul; Kim, Jaewan
2006-01-01
We derive a class of inequalities, from the uncertainty relations of the su(1,1) and the su(2) algebra in conjunction with partial transposition, that must be satisfied by any separable two-mode states. These inequalities are presented in terms of the su(2) operators J x =(a † b+ab † )/2, J y =(a † b-ab † )/2i, and the total photon number a +N b >. They include as special cases the inequality derived by Hillery and Zubairy [Phys. Rev. Lett. 96, 050503 (2006)], and the one by Agarwal and Biswas [New J. Phys. 7, 211 (2005)]. In particular, optimization over the whole inequalities leads to the criterion obtained by Agarwal and Biswas. We show that this optimal criterion can detect entanglement for a broad class of non-Gaussian entangled states, i.e., the su(2) minimum-uncertainty states. Experimental schemes to test the optimal criterion are also discussed, especially the one using linear optical devices and photodetectors
Unitary gauge calculation of K0/sub L/ → μ+μ- in the Weinberg SU(2)'/sub L/ x U(1) gauge theory
International Nuclear Information System (INIS)
Olenick, R.P.
1979-01-01
The rare weak decay K 0 /sub L/ → μ + μ - is calculated in the unitary gauge of the Weinberg SU(2)/sub L/ x U(1) model of weak and electromagnetic interactions. A historical development of gauge theories is presented first; this indicates the need for extension of the hadron symmetry group to SU(4). The GIM mechanism, which extends this group by introducing the charmed quark, is incorporated into Weinberg theory. Explicit calculations of the fourth-order Feynman diagrams representing W + W - , Z 0 , γ, and Higgs scalar intermediate states are performed. Through the technique of dimensional regularization the divergent amplitudes are evaluated, and the calculation is shown to be renormalizable by counterterms generated from the original Lagrangian. The Higgs scalar contribution to the effective Lagrangian is found to be greatly suppressed compared to the W + W - and Z 0 contributions, which are used to estimate the charmed quark mass. Analysis reveals that a charmed quark mass less than or equal to 5 GeV will suppress the decay rate to the experimentally observed value. Concluding remarks are made
Low bass resonances (ρ, ω, Φ) in S-U and O-U interactions at 200 GeV/nucleon
International Nuclear Information System (INIS)
Baldisseri, A.
1990-05-01
Quantum Chromodynamics (QCD) predicts a phase transition between hadronic matter and quark gluon plasma (QGP), for high energy density (3-4 GeV/fm 3 ) and/or high temperature (200 MeV). An enhancement of Φ production with the energy density of the collision has been predicted as a signature of QGP. We study dimuon production in 200 GeV per nucleon S-U and O-U interactions. We compare the production of Φ, ρ, ω and continuum (between 1.7 and 2.7 GeV/c 2 ) as a function of neutral transverse energy (proportional to energy density) of the collision. A cut on single muon momentum has been applied to reduce the high level background coming from light mesons decays, which restricts the analysis to dimuons with high transverse momenta. We find an increasing Φ/ρ+ω ratio as a function of neutral transverse energy in S-U and O-U collisions. This behavior is due to Φ/continuum enhancement while (ρ+ω)/continuum is constant. These results are in agreement with the Φ enhancement, as a consequence of increasing strangeness, expected in a QGP. We show that some other classical models can also explain our results [fr
Energy Technology Data Exchange (ETDEWEB)
Kim, Jihn E. [Kyung Hee University, Department of Physics, Seoul (Korea, Republic of); Center for Axion and Precision Physics Research (IBS), Daejeon (Korea, Republic of); Kyae, Bumseok [Pusan National University, Department of Physics, Busan (Korea, Republic of); Nam, Soonkeon [Kyung Hee University, Department of Physics, Seoul (Korea, Republic of)
2017-12-15
In string compactifications, frequently the anomalous U(1) gauge symmetry appears which belongs to E{sub 8} x E{sub 8}{sup '} of the heterotic string. This anomalous U(1) gauge boson obtains mass at the compactification scale (∼ 10{sup 18} GeV) by absorbing one pseudoscalar (corresponding to the model-independent axion) from the second rank antisymmetric tensor field B{sub MN}. Below the compactification scale a global symmetry U(1){sub anom} results whose charge Q{sub anom} is the original gauge U(1) charge. This is the most natural global symmetry, realizing the ''invisible'' axion. This global symmetry U(1){sub anom} is suitable for a flavor symmetry. In the simplest compactification model with the flipped SU(5) grand unification, all the low energy parameters are calculated in terms of the vacuum expectation values of the standard model singlets. (orig.)
Alternative [SU(3]4 model of leptonic color and dark matter
Directory of Open Access Journals (Sweden)
Corey Kownacki
2018-03-01
Full Text Available The alternative [SU(3]4 model of leptonic color and dark matter is discussed. It unifies at MU∼1014 GeV and has the low-energy subgroup SU(3q×SU(2l×SU(2L×SU(2R×U(1X with (u,hR instead of (u,dR as doublets under SU(2R. It has the built-in global U(1 dark symmetry which is generalized B–L. In analogy to SU(3q quark triplets, it has SU(2l hemion doublets which have half-integral charges and are confined by SU(2l gauge bosons (stickons. In analogy to quarkonia, their vector bound states (hemionia are uniquely suited for exploration at a future e−e+ collider.
Alternative [SU(3)]4 model of leptonic color and dark matter
Kownacki, Corey; Ma, Ernest; Pollard, Nicholas; Popov, Oleg; Zakeri, Mohammadreza
2018-03-01
The alternative [ SU (3) ] 4 model of leptonic color and dark matter is discussed. It unifies at MU ∼1014 GeV and has the low-energy subgroup SU(3)q × SU(2)l × SU(2)L × SU(2)R × U(1)X with (u , h) R instead of (u , d) R as doublets under SU(2)R. It has the built-in global U (1) dark symmetry which is generalized B- L. In analogy to SU(3)q quark triplets, it has SU(2)l hemion doublets which have half-integral charges and are confined by SU(2)l gauge bosons (stickons). In analogy to quarkonia, their vector bound states (hemionia) are uniquely suited for exploration at a future e-e+ collider.
Intersecting Branes Flip SU(5)
Ellis, Jonathan Richard; Nanopoulos, Dimitri V; Ellis, John
2002-01-01
Within a toroidal orbifold framework, we exhibit intersecting brane-world constructions of flipped SU(5) \\times U(1) GUT models with various numbers of generations, other chiral matter representations and Higgs representations. We exhibit orientifold constructions with integer winding numbers that yield 8 or more conventional SU(5) generations, and orbifold constructions with fractional winding numbers that yield flipped SU(5) \\times U(1) models with just 3 conventional generations. Some of these models have candidates for the 5 and {\\bar 5} Higgs representations needed for electroweak symmetry breaking, but not for the 10 and {\\bar 10} representations needed for GUT symmetry breaking, or vice-versa.
O(5) x U(1) electroweak theory
International Nuclear Information System (INIS)
Mukku, C.; Sayed, W.A.
1980-12-01
An anomaly free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' non-sequential type fermions of the standard model are introduced as has been the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above the Wsup(+-), Z and photon fields of SU(2) x U(1) giving rise to new neutral and charged currents. In this note we outline our reasons for proposing the present electroweak scheme, give the basic structure of the model, discuss the symmetry breaking pattern which ensures that SU(2)sub(L) x U(1) is the low energy symmetry, point out the new interactions present in the extended framework and obtain limits on the masses of all the gauge fields. (author)
D-term contributions and CEDM constraints in E6 × SU(2)F × U(1)A SUSY GUT model
Shigekami, Yoshihiro
2017-11-01
We focus on E6 × SU(2)F × U(1)A supersymmetric (SUSY) grand unified theory (GUT) model. In this model, realistic Yukawa hierarchies and mixings are realized by introducing all allowed interactions with 𝓞(1) coefficients. Moreover, we can take stop mass is smaller than the other sfermion masses. This type of spectrum called by natural SUSY type sfermion mass spectrum can suppress the SUSY contributions to flavor changing neutral current (FCNC) and stabilize weak scale at the same time. However, light stop predicts large up quark CEDM and stop contributions are not decoupled. Since there is Kobayashi-Maskawa phase, stop contributions to the up quark CEDM is severely constrained even if all SUSY breaking parameters and Higgsino mass parameter μ are real. In this model, real up Yukawa couplings are realized at the GUT scale because of spontaneous CP violation. Therefore CEDM bounds are satisfied, although up Yukawa couplings are complex at the SUSY scale through the renormalization equation group effects. We calculated the CEDMs and found that EDM constraints can be satisfied even if stop mass is 𝓞(1) TeV. In addition, we investigate the size of D-terms in this model. Since these D-term contributions is flavor dependent, the degeneracy of sfermion mass spectrum is destroyed and the size of D-term is strongly constrained by FCNCs when SUSY breaking scale is the weak scale. However, SUSY breaking scale is larger than 1 TeV in order to obtain 125 GeV Higgs mass, and therefore sizable D-term contribution is allowed. Furthermore, we obtained the non-trivial prediction for the difference of squared sfermion mass.
Compact versus noncompact quantum dynamics of time-dependent su(1,1)-valued Hamiltonians
International Nuclear Information System (INIS)
Penna, V.
1996-01-01
We consider the Schroedinger problem for time-dependent (TD) Hamiltonians represented by a linear combination of the compact generator and the hyperbolic generator of su(1,1). Several types of transitions, characterized by different time initial conditions on the generator coefficients, are analyzed by resorting to the harmonic oscillator model with a frequency vanishing for t→+∞. We provide examples that point out how the TD states of the transitions can be constructed either by the compact eigenvector basis or by the noncompact eigenvector basis depending on the initial conditions characterizing the frequency time behavior. Copyright copyright 1996 Academic Press, Inc
International Nuclear Information System (INIS)
Drapier, O.
1990-05-01
We study in this thesis the transverse momentum dependence of dimuons produced with mass greated than 1.7 GeV/c 2 in p-U, 16 O-U and 32 S-U collisions at 200 GeV per nucleon. The NA38 experiment, performed at the CERN SPS, measures muon pairs produced in these collisions using the NA10 spectrometer. The neutral transverse energy, which is related to the centrality of the interaction, is deduced from the energy flow measured in an electromagnetic calorimeter located downstream an active target. Data are analysed with a method taking into account apparatus effects which are simulated through transfer matrices. The 16 O-U and 32 S-U results show that the T > and T 2 > values of J/Ψ dimuons increase with the measured neutral transverse energy and that such a correlation is not seen for the mass continuum dimuons. A comparison of these results with different models is presented. Results are first compared with quark-gluon plasma models which inhibits J/Ψ formation via a color screening effect. Models based on J/Ψ absorption in a dense hadron gas combined with parton multiple scattering in the entrance channel are also considered. Experimental data do not allow to distinguish between these different models [fr
Energy Technology Data Exchange (ETDEWEB)
Barbier, R
1995-09-22
This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U{sub qp}(u{sub 2}). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U{sub qp}(u{sub 2}) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U{sub qp}(u{sub 2}). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U{sub qp}(u{sub 2}), U{sub q{sup 2}}(su{sub 2}) and U{sub qp}(u{sub 1,1}). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U{sub qp}(u{sub 2}). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U{sub qp}(u{sub 2}) leads to a generalization of the U{sub q}(su{sub 2})-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U{sub qp}(u{sub 2}). We show that the system of the U{sub q}(su{sub 2})-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U{sub qp}(u{sub 2}). A ro-vibration energy formula and expansion `a la` Dunham are obtained. The aim of the last part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A{approx}130 - 150 and A{approx}190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies.
SU(N) Irreducible Schwinger Bosons
Mathur, Manu; Raychowdhury, Indrakshi; Anishetty, Ramesh
2010-01-01
We construct SU(N) irreducible Schwinger bosons satisfying certain U(N-1) constraints which implement the symmetries of SU(N) Young tableaues. As a result all SU(N) irreducible representations are simple monomials of $(N-1)$ types of SU(N) irreducible Schwinger bosons. Further, we show that these representations are free of multiplicity problems. Thus all SU(N) representations are made as simple as SU(2).
Constraints from proton decay in the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Leontaris, G.K.; Tamvakis, K. (Ioannina Univ. (Greece). Theoretical Physics Div.)
1991-05-16
We discuss the constraints the emerge from the existence of dimension-5 baryon-violating operators in the flipped SU(5) x U(1) superstring model. These are constraints on matter field assignments and on singlet VEV values. Although baryon-violating dimension-5 operators that appear as quintic non-renormalizable terms vanish as has been proven before and as we verify here, effective dimension-5 operators resulting from Higgs exchange put non-trivial but feasible constraints on the model. Constraints are also extracted from the presence of higher order non-renormalizable terms that generate such operators which do not a priori vanish. (orig.).
Phenomenology of the spontaneous C P violation in SU(3)L x U(1)Y electroweak models
International Nuclear Information System (INIS)
Epele, Luis N.; Gomez Dumm, Daniel A.
1994-01-01
This work studies the phenomenological consequence of the spontaneous C P violation in a SU(3) L x U(1) Y model with three Higgs triplets and one sextuplet, which has been recently proposed. Since this C P-violating effects are due to the presence of complex vacuum expectation values in the Higgs sector, our analysis requires a detailed study of the enlarged potential
Representations of the q-deformed algebras Uq (so2,1) and Uq (so3,1)
International Nuclear Information System (INIS)
Gavrilik, O.M.; Klimyk, A.U.
1993-01-01
Representations of algebra U q (so 2 ,1) are studied. This algebra is a q-deformation of the universal enveloping algebra U(so 2 ,1) of the Lie algebra of the group SO 0 (2,1) and differs from the quantum algebra U q (SU 1 ,1). Classifications of irreducible representations and of infinitesimally irreducible representations of U q (SU 1 ,1). The sets of irreducible representations and of infinitesimally unitary irreducible representations of the algebra U q (so 3 ,1) are given. We also consider representations of U q (so n ,1) which are of class 1 with respect to subalgebra U q (so n ). (author). 22 refs
Flipped SU(6) from ten dimensions
Energy Technology Data Exchange (ETDEWEB)
Panagiotakopoulos, C. (Bartol Research Inst., Univ. of Delaware, Newark, DE (US))
1990-06-20
The authors study the compactification of the heterotic supersting on the only known three generation Calabi-Yau space with flux breakings leading to SU(6) {times} U(1) as the gauge group in four dimensions. We compute the massless spectrum and identify the discrete symmetries of the internal space that survive flux breaking. The possible four-dimensional models are classified according to their honest discrete symmetries. The allowed breaking chains of SU(6) {times} U(1) are listed. Model building with SU(6) {times} U(1) is discussed in general and a concrete realistic model is constructed which does not suffer from the gauge hierarchy problem, fast proton decay or any other obvious phenomenological disaster. A distinct experimental signature of this class of models is the presence in the low energy spectrum of vector-like quarks and antiquarks, outside the three known families, with masses of the order of the supersymmetry breaking scale.
Super-No-Scale F-SU(5): A dynamic determination of M{sub 1/2} and tan{beta}
Energy Technology Data Exchange (ETDEWEB)
Li Tianjun, E-mail: junlt@physics.tamu.edu [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Key Laboratory of Frontiers in Theoretical Physics, Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100190 (China); Maxin, James A., E-mail: jmaxin@physics.tamu.edu [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Nanopoulos, Dimitri V., E-mail: dimitri@physics.tamu.edu [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece); Walker, Joel W., E-mail: jwalker@shsu.edu [Department of Physics, Sam Houston State University, Huntsville, TX 77341 (United States)
2011-09-20
We study the Higgs potential in No-Scale F-SU(5), a model built on the tripodal foundations of the F-lipped SU(5)xU(1){sub X} Grand Unified Theory, extra F-theory derived TeV scale vector-like particle multiplets, and the high scale boundary conditions of no-scale supergravity. V{sub min}, the minimum of the potential following radiative electroweak symmetry breaking, is a function at fixed Z-boson mass of the universal gaugino boundary mass M{sub 1/2} and tan{beta}, the ratio of Higgs vacuum expectation values. The so-scale nullification of the bilinear Higgs soft term B{sub {mu}} at the boundary reduces V{sub min}(M{sub 1/2}) to a one-dimensional dependency, which may be secondarily minimized. This 'Super-No-Scale' condition dynamically fixes tan{beta} and M{sub 1/2} at the local minimum minimorum of V{sub min}. Fantastically, the walls of this theoretically established secondary potential coalesce in descent to a striking concurrency with the previously phenomenologically favored 'Golden Point' and 'Golden Strip'.
Supersymmetric flipped SU(5) revitalized
Energy Technology Data Exchange (ETDEWEB)
Antoniadis, I.; Ellis, J.; Hagelin, J.S.; Nanopoulos, D.V.
1987-08-06
We describe a simple N = 1 supersymmetric GUT based on the group SU(5) x U(1) which has the following virtues: the gauge group is broken down to the SU(3)/sub C/ x SU(2)/sub L/ x U(1)/sub y/ of the standard model using just 10, 10 Higgs representations, and the doublet-triplet mass splitting problem is solved naturally by a very simple missing-partner mechanism. The successful supersymmetric GUT prediction for sin/sup 2/theta/sub w/ can be maintained, whilst there are no fermion mass relations. The gauge group and representation structure of the model may be obtainable from the superstring.
Spin transistor action from Onsager reciprocity and SU(2) gauge theory
Energy Technology Data Exchange (ETDEWEB)
Adagideli, Inanc [Faculty of Engineering and Natural Sciences, Sabanci University, Istanbul (Turkey); Lutsker, Vitalij; Scheid, Matthias; Richter, Klaus [Institut fuer Theoretische Physik, Universitaet Regensburg, 93040 Regensburg (Germany); Jacquod, Philippe [Physics Department, University of Arizona, Tucson, AZ (United States)
2012-07-01
We construct a local gauge transformation to show how, in confined systems, a generic, weak non-homogeneous SU(2) spin-orbit Hamiltonian reduces to two U(1) Hamiltonians for spinless fermions at opposite magnetic fields, to leading order in the spin-orbit strength. Using an Onsager relation, we further show how the resulting spin conductance vanishes in a two-terminal setup, and how it is turned on by either weakly breaking time-reversal symmetry or opening additional transport terminals. We numerically check our theory for mesoscopic cavities as well as Aharonov-Bohm rings.
Klevers, Denis
2016-01-01
We give an explicit construction of a class of F-theory models with matter in the three-index symmetric (4) representation of SU(2). This matter is realized at codimension two loci in the F-theory base where the divisor carrying the gauge group is singular; the associated Weierstrass model does not have the form associated with a generic SU(2) Tate model. For 6D theories, the matter is localized at a triple point singularity of arithmetic genus g=3 in the curve supporting the SU(2) group. This is the first explicit realization of matter in F-theory in a representation corresponding to a genus contribution greater than one. The construction is realized by "unHiggsing" a model with a U(1) gauge factor under which there is matter with charge q=3. The resulting SU(2) models can be further unHiggsed to realize non-Abelian G_2xSU(2) models with more conventional matter content or SU(2)^3 models with trifundamental matter. The U(1) models used as the basis for this construction do not seem to have a Weierstrass real...
Operator realization of the SU(2) WZNW model
International Nuclear Information System (INIS)
Furlan, P.; Hadjiivanov, L.K.; Todorov, I.T.
1996-01-01
Decoupling the chiral dynamics in the canonical approach to the WZNW model requires an extended phase space that includes left and right monodromy variables M and M. Earlier work on the subject, which traced back the quantum group symmetry of the model to the Lie-Poisson symmetry of the chiral symplectic form, left some open questions: - How to reconcile the necessity to set MM -1 =1 (in order to recover the monodromy invariance of the local 2D group valued field g=uu) with the fact the M and M obey different exchange relations? - What is the status of the quantum symmetry in the 2D theory in which the chiral fields u(x-t) and u(x+t) commute? - Is there a consistent operator formalism in the chiral (and the extended 2D) theory in the continuum limit? We propose a constructive affirmative answer to these questions for G=SU(2) by presenting the quantum fields u and u as sums of products of chiral vertex operators and q-Bose creation and annihilation operators. (orig.)
String threshold corrections and flipped SU(5)
Energy Technology Data Exchange (ETDEWEB)
Antoniadis, I. (Ecole Polytechnique, Centre de Physique Theorique, 91 - Palaiseau (France) Theory Div., CERN, Geneva (Switzerland)); Ellis, J. (Theory Div., CERN, Geneva (Switzerland)); Lacaze, R. (Service de Physique Theorique, CEN-Saclay, 91 - Gif-sur-Yvette (France)); Nanopoulos, D.V. (Center for Theoretical Physics, Dept. of Physics, Texas A and M Univ., College Station, TX (United States) Astroparticle Physics Group, HARC, The Woodlands, TX (United States) Theory Div., CERN, Geneva (Switzerland))
1991-10-10
We revise previous calculations of the effective unification scale m{sub SU} at which the extrapolated low-energy gauge couplings should appear to become equal, and we show explicitly how to calculate m{sub SU} in the fermionic construction of four-dimensional strings. In the case of the flipped SU(5) GUT derived from the string, the SU(5) and U(1) couplings defined in the anti Danti R scheme become equal to g{sub SU} at m{sub SU} {approx equal} 1.76 x g{sub SU} x 10{sup 18} GeV. This scale is significantly larger than m{sub GUT}, the scale at which the low-energy SU(3) and SU(2) couplings become equal if extrapolated using the renormalization group equations of the minimal supersymmetric extension of the standard model. The existence of an intermediate SU(5) x U(1) phase could have an observable effect on the calculated value of sin{sup 2}{theta}{sub w}. (orig.).
Path integral for coherent states of the dynamical U2 group and U2/1 supergroup
International Nuclear Information System (INIS)
Kochetov, E.A.
1992-01-01
A part-integral formulation in the representation of coherent states for the unitary U 2 group and U 2/1 supergroup is introduced. U 2 and U 2/1 path integrals are shown to be defined on the coset spaces U 2 /U 1 xU 1 and U 2/1 /U 1/1 xU 1 , respectively. These coset appears as curved classical phase spaces. Partition functions are expressed as path integrals over these spaces. In the case when U 2 and U 2/1 are the dynamical groups, the corresponding path integrals are evaluated with the help of linear fractional transformations that appear as the group (supergroup) action in the coset space (superspace). Possible applications for quantum models are discussed. 9 refs
On the topological structure of the vacuum in SU(2) and SU(3) lattice gauge theories
International Nuclear Information System (INIS)
Ishikawa, K.; Schierholz, G.; Schneider, H.; Teper, M.
1983-01-01
We present Monte Carlo measurements of the net topological charge of the vacuum in SU(2) and SU(3) lattice gauge theories. In both cases there is no evidence of any topological structure, and the values obtained are a factor of 0(100) smaller than expectations based on analyses of the U(1) problem. Moreover we find a strong sensitivity to the lattice size and to the boundary conditions imposed on the lattice. We comment on the physical significance of these results, establish criteria for the reliable performance of such calculations, and remark on the possibly detrimental impact of these findings on the calculation of hadron spectra
O(5) x U(1) electroweak theory
International Nuclear Information System (INIS)
Mukku, C.; Sayed, W.A.
1981-01-01
An anomaly-free O(5) x U(1) theory of electroweak interactions is described which provides a unified description of electroweak phenomena for two families of standard leptons and quarks. No ''new'' nonsequential-type fermions are introduced, unlike the case for all past studies based on this group. The present scheme requires the introduction of two further charged and three more neutral gauge fields over and above those of SU(2) x U(1) giving rise to new neutral and charged currents
U(N) instantons on N=(1/2) superspace: Exact solution and geometry of moduli space
International Nuclear Information System (INIS)
Britto, Ruth; Feng Bo; Lunin, Oleg; Rey, Soo-Jong
2004-01-01
We construct the exact solution of one (anti-)instanton in N=(1/2) super Yang-Mills theory defined on non(anti-)commutative superspace. We first identify N=(1/2) superconformal invariance as maximal spacetime symmetry. For the gauge group U(2), the SU(2) part of the solution is given by the standard (anti-)instanton, but the U(1) field strength also turns out to be nonzero. The solution is SO(4) rotationally symmetric. For the gauge group U(N), in contrast with the U(2) case, we show that the entire U(N) part of the solution is deformed by non(anti-)commutativity and fermion zero modes. The solution is no longer rotationally symmetric; it is polarized into an axially symmetric configuration because of the underlying non(anti-)commutativity. We compute the 'information metric' of one (anti-)instanton. We find that the moduli space geometry is deformed from the hyperbolic space H 5 (Euclidean anti-de Sitter space) in a way anticipated from reduced spacetime symmetry. Remarkably, the volume measure of the moduli space turns out to be independent of the non(anti-)commutativity. Implications for D branes in the Ramond-Ramond flux background and the gauge-gravity correspondence are discussed
Fundamental U-Theory of Time. Part 1
Directory of Open Access Journals (Sweden)
Yuvraj J. Gopaul
2016-02-01
Full Text Available The Fundamental U-Theory of Time (Part 1 is an original theory that aims to unravel the mystery of what exactly is ‘time’. To date very few explanations, from the branches of physics or cosmology, have succeeded to provide an accurate and comprehensive depiction of time. Most explanations have only managed to provide partial understanding or at best, glimpses of its true nature. The U-Theory uses ‘Thought Experiments’ to uncover the determining characteristics of time. In part 1 of this theory, the focus is not on the mathematics as it is on the accuracy of the depiction of time. Moreover, it challenges current views on theoretical physics, particularly on the idea of ‘time travel’. Notably, it is a theory seeking to present a fresh approach for reviewing Einstein’s Theory of Relativity, while unlocking new pathways for upcoming research in the field of physics and cosmology.
Path representation of su-hat (2){sub k} states I: Operators and particles for k=1,2
Energy Technology Data Exchange (ETDEWEB)
Lamy-Poirier, Joel, E-mail: jlamypoirier@perimeterinstitute.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada); Mathieu, Pierre, E-mail: pmathieu@phy.ulaval.c [Departement de physique, de genie physique et d' optique, Universite Laval, Quebec, G1K 7P4 (Canada)
2011-04-11
This is the first of two articles devoted to the analysis of the path description of the states in su-hat (2){sub k} WZW models, a representation well suited for constructive derivations of the fermionic characters. In this first article, the cases k=1,2 are treated in detail, emphasizing a different description in each case (operators vs particles). For k=1, we first prove, as a side result, the equivalence of two known path representations for the finitized su-hat (2){sub 1} states by displaying an explicit bijection. An immediate offshoot is the gain of a new and simple weighting for the (Kyoto) path representation that generalizes to level k. The bijection also suggests two operator constructions for the su-hat (2){sub 1} paths, a local and a nonlocal one, both interrelated. These are formal operators that map a path to another path, so that any path can be obtained by successive applications of these operators on a simple reference (ground-state) path. The nonlocal operator description is the starting point for a direct and elementary derivation of the su-hat (2){sub 1} spinon character. The second part presents an extensive study of the su-hat (2){sub 2} paths from their particle point of view, where the particles are defined as the path building blocks. The resulting generating functions appear to provide new (at least superficially) fermionic forms of the characters. In particular, a nice relationship between the sum of the j=0,1 characters at k=2 and the two ones at k=1 is unraveled.
Operator realization of the SU(2) WZNW model
International Nuclear Information System (INIS)
Furlan, P.; Todorov, I.T.
1995-12-01
Decoupling the chiral dynamics in the canonical approach to the WZNW model requires an extended phase space that includes left and right monodromy variables M and M-bar. Earlier work on the subject, which traced back the quantum group symmetry of the model to the Lie-Poisson symmetry of the chiral symplectic form, left some open questions: How to reconcile the necessity to set M M-bar -1 = 1 (in order to recover the monodromy invariance of the local 2D group valued field g = uu-bar) with the fact the M and M-bar obey different exchange relations? What is the status of the quantum symmetry in the 2D theory in which the chiral fields u(x-t) and u-bar(x+t) commute? Is there a consistent operator formalism in the chiral (and the extended 2D) theory in the continuum limit? We propose a constructive affirmative answer to these questions for G = SU(2) by presenting the quantum field u and u-bar as sums of products of chiral vertex operators and q Bose creation and annihilation operators. (author). 17 refs
White dwarf axions, PAMELA data, and flipped-SU(5)
Energy Technology Data Exchange (ETDEWEB)
Bae, Kyu Jung [Department of Physics and Astronomy and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of); Huh, Ji-Haeng [Department of Physics and Astronomy and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of)], E-mail: jhhuh@phya.snu.ac.kr; Kim, Jihn E. [Department of Physics and Astronomy and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of)], E-mail: jekim@ctp.snu.ac.kr; Kyae, Bumseok [Department of Physics and Astronomy and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of)], E-mail: bskyae@gmail.com; Viollier, Raoul D. [Institute of Theoretical Physics and Astrophysics, Department of Physics, University of Cape Town, Private Bag, Rondebosch 7701 (South Africa)
2009-08-11
Recently, there are two hints arising from physics beyond the standard model. One is a possible energy loss mechanism due to emission of very weakly interacting light particles from white dwarf stars, with a coupling strength {approx}0.7x10{sup -13}, and another is the high energy positrons observed by the PAMELA satellite experiment. We construct a supersymmetric flipped-SU(5) model, SU(5)xU(1){sub X} with appropriate additional symmetries, [U(1){sub H}]{sub gauge}x[U(1){sub R}xU(1){sub {gamma}}]{sub global}xZ{sub 2}, such that these are explained by a very light electrophilic axion of mass 0.5 meV from the spontaneously broken U(1){sub {gamma}} and two component cold dark matters from Z{sub 2} parity. We show that in the flipped-SU(5) there exists a basic mechanism for allowing excess positrons through the charged SU(5) singlet leptons, but not allowing antiproton excess due to the absence of the SU(5) singlet quarks. We show the discovery potential of the charged SU(5) singlet E at the LHC experiments by observing the electron and positron spectrum. With these symmetries, we also comment on the mass hierarchy between the top and bottom quarks.
Independent SU(2)-loop variables
International Nuclear Information System (INIS)
Loll, R.
1991-04-01
We give a reduction procedure for SU(2)-trace variables and introduce a complete set of indepentent, gauge-invariant and almost local loop variables for the configuration space of SU(2)-lattice gauge theory in 2+1 dimensions. (orig.)
Phenomenology of the hierarchical lepton mass spectrum in the flipped SU(5)xU(1) string model
Energy Technology Data Exchange (ETDEWEB)
Leontaris, G.K.; Nanopoulos, D.V.
1988-09-29
A detailed phenomenological analysis of the lepton mass matrices and their implications in the low energy theory are discussed, within the recently proposed SU(5)xU(1) string model. The unification scale is highly constrained while the Yukawa couplings lie in a natural region. The flavour changing decays ..mu.. -> e..gamma.., ..mu.. -> 3e, ..mu.. -> e are highly suppressed while the depletion in the flux of muon neutrinos reported by the Kamiokande is explained through ..nu../sub ..mu../ reversible ..nu../sub tau/ oscillations.
Classification of three-family grand unification in string theory. II. The SU(5) and SU(6) models
International Nuclear Information System (INIS)
Kakushadze, Z.; Tye, S.H.
1997-01-01
Requiring that supersymmetric SU(5) and SU(6) grand unifications in the heterotic string theory must have three chiral families, adjoint (or higher representation) Higgs fields in the grand unified gauge group, and a non-Abelian hidden sector, we construct such string models within the framework of free conformal field theory and asymmetric orbifolds. Within this framework, we construct all such string models via Z 6 asymmetric orbifolds that include a Z 3 outerautomorphism, the latter yielding a level-three current algebra for the grand unification gauge group SU(5) or SU(6). We then classify all such Z 6 asymmetric orbifolds that result in models with a non-Abelian hidden sector. All models classified in this paper have only one adjoint (but no other higher representation) Higgs field in the grand unified gauge group. This Higgs field is neutral under all other gauge symmetries. The list of hidden sectors for three-family SU(6) string models are SU(2), SU(3), and SU(2)circle-times SU(2). In addition to these, three-family SU(5) string models can also have an SU(4) hidden sector. Some of the models have an apparent anomalous U(1) gauge symmetry. copyright 1997 The American Physical Society
Energy Technology Data Exchange (ETDEWEB)
Klevers, Denis [Theoretical Physics Department, CERN,CH-1211 Geneva 23 (Switzerland); Taylor, Washington [Center for Theoretical Physics, Department of Physics, Massachusetts Institute of Technology,77 Massachusetts Avenue Cambridge, MA 02139 (United States)
2016-06-29
We give an explicit construction of a class of F-theory models with matter in the three-index symmetric (4) representation of SU(2). This matter is realized at codimension two loci in the F-theory base where the divisor carrying the gauge group is singular; the associated Weierstrass model does not have the form associated with a generic SU(2) Tate model. For 6D theories, the matter is localized at a triple point singularity of arithmetic genus g=3 in the curve supporting the SU(2) group. This is the first explicit realization of matter in F-theory in a representation corresponding to a genus contribution greater than one. The construction is realized by “unHiggsing” a model with a U(1) gauge factor under which there is matter with charge q=3. The resulting SU(2) models can be further unHiggsed to realize non-Abelian G{sub 2}×SU(2) models with more conventional matter content or SU(2){sup 3} models with trifundamental matter. The U(1) models used as the basis for this construction do not seem to have a Weierstrass realization in the general form found by Morrison-Park, suggesting that a generalization of that form may be needed to incorporate models with arbitrary matter representations and gauge groups localized on singular divisors.
Panesi, Marco; Jaffe, Richard L; Schwenke, David W; Magin, Thierry E
2013-01-28
A rovibrational collisional model is developed to study energy transfer and dissociation of N(2)((1)Σ(g)(+)) molecules interacting with N((4)S(u)) atoms in an ideal isochoric and isothermal chemical reactor. The system examined is a mixture of molecular nitrogen and a small amount of atomic nitrogen. This mixture, initially at room temperature, is heated by several thousands of degrees Kelvin, driving the system toward a strong non-equilibrium condition. The evolution of the population densities of each individual rovibrational level is explicitly determined via the numerical solution of the master equation for temperatures ranging from 5000 to 50,000 K. The reaction rate coefficients are taken from an ab initio database developed at NASA Ames Research Center. The macroscopic relaxation times, energy transfer rates, and dissociation rate coefficients are extracted from the solution of the master equation. The computed rotational-translational (RT) and vibrational-translational (VT) relaxation times are different at low heat bath temperatures (e.g., RT is about two orders of magnitude faster than VT at T = 5000 K), but they converge to a common limiting value at high temperature. This is contrary to the conventional interpretation of thermal relaxation in which translational and rotational relaxation timescales are assumed comparable with vibrational relaxation being considerable slower. Thus, this assumption is questionable under high temperature non-equilibrium conditions. The exchange reaction plays a very significant role in determining the dynamics of the population densities. The macroscopic energy transfer and dissociation rates are found to be slower when exchange processes are neglected. A macroscopic dissociation rate coefficient based on the quasi-stationary distribution, exhibits excellent agreement with experimental data of Appleton et al. [J. Chem. Phys. 48, 599-608 (1968)]. However, at higher temperatures, only about 50% of dissociation is found to
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Bjelanovic, J; Minincic, Z; Komatina, R; Raicevic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1985-12-01
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. It was found that the maximum individual dose from external irradiation amounted to 8.2 mSV during past 10 months. Individual exposures for 7/10 of the personnel were less than 1/10 of the annual permissible exposure. Data are compared to radiation doses for last year and previous five years. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. The last part analyzes accidents occurred at the reactor during 1985. It was found that there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radiacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila 8.2 mSv, a da su pojedinacna izlaganja vise od 7/10 radnog osoblja bila manja od 1/10 godisnje granicne vrednosti. Dati su takodje uporedni podaci o
Directory of Open Access Journals (Sweden)
Maurice R. Kibler
2010-07-01
Full Text Available We propose a group-theoretical approach to the generalized oscillator algebra Aκ recently investigated in J. Phys. A: Math. Theor. 2010, 43, 115303. The case κ ≥ 0 corresponds to the noncompact group SU(1,1 (as for the harmonic oscillator and the Pöschl-Teller systems while the case κ < 0 is described by the compact group SU(2 (as for the Morse system. We construct the phase operators and the corresponding temporally stable phase eigenstates for Aκ in this group-theoretical context. The SU(2 case is exploited for deriving families of mutually unbiased bases used in quantum information. Along this vein, we examine some characteristics of a quadratic discrete Fourier transform in connection with generalized quadratic Gauss sums and generalized Hadamard matrices.
The production of Φ in 200 GeV/nucleon S-U and O-U interactions
International Nuclear Information System (INIS)
Baldisseri, A.
1989-11-01
Preliminary results on the low mass resonances region (ρ, ω and Φ) from NA38 experiment are presented. The ratio Φ/ω is studied (for high ρ T dimuons) in correlation with the transverse neutral energy E T of the collision. This ratio increases with increasing E T , for both S-U and O-U interactions
International Nuclear Information System (INIS)
Chang, D.; Mohapatra, R.N.; Parida, M.K.
1984-01-01
A new approach to left-right symmetric models is proposed, where the left-right discrete-symmetry- and SU(2)/sub R/-breaking scales are decoupled from each other. This changes the spectrum of physical Higgs bosons which leads to different patterns for gauge hierarchies in SU(2)/sub L/xSU(2)/sub R/xSU(4)/sub C/ and SO(10) models. Most interesting are two SO(10) symmetry-breaking chains with an intermediate U(1)/sub R/ symmetry. These are such as to provide new motivation to search for ΔB = 2 and right-handed current effects at low energies
On the SU(2 vertical stroke 1) WZNW model and its statistical mechanics applications
Energy Technology Data Exchange (ETDEWEB)
Saleur, H [CEA Centre d' Etudes de Saclay, 91 - Gif-sur-Yvette (France). Service de Physique Theorique; [University of Southern California, Los Angeles, CA (United States). Dept. of Physics; Schomerus, V [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)
2006-11-15
Motivated by a careful analysis of the Laplacian on the supergroup SU(2 vertical stroke 1) we formulate a proposal for the state space of the SU(2 vertical stroke 1) WZNW model. We then use properties of sl(2 vertical stroke 1) characters to compute the partition function of the theory. In the special case of level k=1 the latter is found to agree with the properly regularized partition function for the continuum limit of the integrable sl(2 vertical stroke 1)3- anti 3 super-spin chain. Some general conclusions applicable to other WZNW models (in particular the case k=-1/2) are also drawn. (orig.)
Mambrini, Matthieu; Orús, Román; Poilblanc, Didier
2016-11-01
We elaborate a simple classification scheme of all rank-5 SU(2) spin rotational symmetric tensors according to (i) the onsite physical spin S , (ii) the local Hilbert space V⊗4 of the four virtual (composite) spins attached to each site, and (iii) the irreducible representations of the C4 v point group of the square lattice. We apply our scheme to draw a complete list of all SU(2)-symmetric translationally and rotationally invariant projected entangled pair states (PEPS) with bond dimension D ≤6 . All known SU(2)-symmetric PEPS on the square lattice are recovered and simple generalizations are provided in some cases. More generally, to each of our symmetry class can be associated a (D -1 )-dimensional manifold of spin liquids (potentially) preserving lattice symmetries and defined in terms of D -independent tensors of a given bond dimension D . In addition, generic (low-dimensional) families of PEPS explicitly breaking either (i) particular point-group lattice symmetries (lattice nematics) or (ii) time-reversal symmetry (chiral spin liquids) or (iii) SU(2) spin rotation symmetry down to U(1 ) (spin nematics or Néel antiferromagnets) can also be constructed. We apply this framework to search for new topological chiral spin liquids characterized by well-defined chiral edge modes, as revealed by their entanglement spectrum. In particular, we show how the symmetrization of a double-layer PEPS leads to a chiral topological state with a gapless edge described by a SU (2) 2 Wess-Zumino-Witten model.
Analysis list: Su(var)205 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Su(var)205 Adult,Embryo,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3.../target/Su(var)205.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Su(var)205.5.tsv http://dbarc...hive.biosciencedbc.jp/kyushu-u/dm3/target/Su(var)205.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/c...olo/Su(var)205.Adult.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(var)205.Embryo.tsv,http:...//dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(var)205.Larvae.tsv http://dbarchive
SU(5) monopoles, magnetic symmetry and confinement
International Nuclear Information System (INIS)
Daniel, M.; Lazarides, G.; Shafi, Q.
1980-01-01
The monopoles of the unified SU(5) gauge theory broken down to Hsub(E) = SU(3)sub(c) x U(1)sub(EM) [or to Ksub(E) = SU(3)sub(c) x SU(2) x U(1)sub(γ)], are classified. They belong to representations of a magnetic group Hsub(M)(Ksub(M)), which is found to be isomorphic to Hsub(E)(Ksub(E)). For SU(5) broken down to Hsub(E), there exists a regular and stable monopole which is a colour magnetic triplet, and carries a non-zero abelian magnetic charge. It is suggested that composite operators made out of this monopole and its antiparticle fields develop a non-zero vacuum expectation value, and so lead to a squeezing of the colour electric flux. Finally, we comment on the cosmological production of SU(5) monopoles. (orig.)
An SU(2) x SU(2) symmetric Higgs-Fermion model with staggered fermions
International Nuclear Information System (INIS)
Berlin, J.; Heller, U.M.
1991-01-01
We have simulated on SU(2)xSU(2) symmetric Higgs-Fermion model with a four component scalar field coupled with a Yukawa type coupling to two flavours of staggered fermions. The results show two qualitatively different behaviours in the broken phase. One for weak coupling where the fermion masses obey the perturbative tree level relation M F =y , and one for strong coupling where the behaviour agrees with a 1/d expansion. (orig.)
Radiative gauge symmetry breaking in supersymmetric flipped SU(5)
Energy Technology Data Exchange (ETDEWEB)
Drees, M.
1988-05-19
The radiative breaking of the SU(5)xU(1) symmetry in the flipped SU(5) model recently proposed by Antoniadis et al. is studied using renormalization group techniques. It is shown that gaugino masses can only be the dominant source of supersymmetry breaking at the Planck scale if the U(1) gaugino mass M/sub 1/ is at least 10 times larger than the SU(5) gaugino mass M/sub 5/. If M/sub 1/ approx. = M/sub 5/ at the Planck scale, non-vanishing trilinear soft breaking terms ('A-terms') are needed already at the Planck scale. In both cases consequences for the sparticle spectrum at the weak scale are discussed.
SU(3) chiral symmetry for baryons
International Nuclear Information System (INIS)
Dmitrasinovic, V.
2011-01-01
Three-quark nucleon interpolating fields in QCD have well-defined SU L (3)xSU R (3) and U A (1) chiral transformation properties, viz. [(6,3)+(3,6)], [(3,3-bar)+(3-bar,3)], [(8,1)+(1,8)] and their 'mirror' images. It has been shown (phenomenologically) in Ref. [2] that mixing of the [(6,3)+(3,6)] chiral multiplet with one ordinary ('naive') and one 'mirror' field belonging to the [(3,3-bar)+(3-bar,3)], [(8,1)+(1,8)] multiplets can be used to fit the values of the isovector (g A (3) ) and the flavor-singlet (isoscalar) axial coupling (g A (0) ) of the nucleon and then predict the axial F and D coefficients, or vice versa, in reasonable agreement with experiment. In an attempt to derive such mixing from an effective Lagrangian, we construct all SU L (3)xSU R (3) chirally invariant non-derivative one-meson-baryon interactions and then calculate the mixing angles in terms of baryons' masses. It turns out that there are (strong) selection rules: for example, there is only one non-derivative chirally symmetric interaction between J 1/2 fields belonging to the [(6,3)+(3,6)] and the [(3,3-bar)+(3-bar,3)] chiral multiplets, that is also U A (1) symmetric. We also study the chiral interactions of the [(3,3-bar)+(3-bar,3)] and [(8,1)+(1,8)] nucleon fields. Again, there are selection rules that allow only one off-diagonal non-derivative chiral SU L (3)xSU R (3) interaction of this type, that also explicitly breaks the U A (1) symmetry. We use this interaction to calculate the corresponding mixing angles in terms of baryon masses and fit two lowest lying observed nucleon (resonance) masses, thus predicting the third (J = 1/2, I = 3/2)Δ resonance, as well as one or two flavor-singlet Λ hyperon(s), depending on the type of mixing. The effective chiral Lagrangians derived here may be applied to high density matter calculations.
su(1,2) Algebraic Structure of XYZ Antiferromagnetic Model in Linear Spin-Wave Frame
International Nuclear Information System (INIS)
Jin Shuo; Xie Binghao; Yu Zhaoxian; Hou Jingmin
2008-01-01
The XYZ antiferromagnetic model in linear spin-wave frame is shown explicitly to have an su(1,2) algebraic structure: the Hamiltonian can be written as a linear function of the su(1,2) algebra generators. Based on it, the energy eigenvalues are obtained by making use of the similar transformations, and the algebraic diagonalization method is investigated. Some numerical solutions are given, and the results indicate that only one group solution could be accepted in physics
Weinberg Angle Derivation from Discrete Subgroups of SU(2 and All That
Directory of Open Access Journals (Sweden)
Potter F.
2015-01-01
Full Text Available The Weinberg angle W of the Standard Model of leptons and quarks is derived from specific discrete (i.e., finite subgroups of the electroweak local gauge group SU(2 L U(1 Y . In addition, the cancellation of the triangle anomaly is achieved even when there are four quark families and three lepton families!
F-theory GUTs with U(1) symmetries: Generalities and survey
International Nuclear Information System (INIS)
Dolan, Matthew J.; Marsano, Joseph; Saulina, Natalia; Schaefer-Nameki, Sakura
2011-01-01
We study the structure of SU(5) F-theory grand unified theory (GUT) models that engineer additional U(1) symmetries. These are highly constrained by a set of relations observed by Dudas and Palti (DP) that originate from the physics of four-dimensional anomaly cancellation. Using the DP relations, we describe a general tension between unification and the suppression of dimension 5 proton decay when one or more U(1)'s are Peccei-Quinn (PQ) symmetries and hypercharge flux is used to break the SU(5) GUT group. We then specialize to spectral cover models, whose global completions in F theory we know how to construct. In that setting, we provide a technical derivation of the DP relations, construct spectral covers that yield all possible solutions to them, and provide a complete survey of spectral cover models for SU(5) GUTs that exhibit two U(1) symmetries.
Tank 241-U-102, Grab Samples 2U-99-1, 2U-99-2 and 2U-99-3 Analytical Results for the Final Report
International Nuclear Information System (INIS)
STEEN, F.H.
1999-01-01
This document is the final report for tank 241-U-102 grab samples. Five grab samples were collected from riser 13 on May 26, 1999 and received by the 222-S laboratory on May 26 and May 27, 1999. Samples 2U-99-3 and 2U-99-4 were submitted to the Process Chemistry Laboratory for special studies. Samples 2U-99-1, 2U-99-2 and 2U-99-5 were submitted to the laboratory for analyses. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan for Fiscal year 1999 (TSAP) (Sasaki, 1999) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Fowler 1995, Mulkey and Miller 1998). The analytical results are presented in the data summary report. None of the subsamples submitted for differential scanning calorimetry (DSC), total organic carbon (TOC) and plutonium 239 (Pu239) analyses exceeded the notification limits as stated in TSAP
Closed flux tubes in D=2+1SU(N) gauge theories: dynamics and effective string description
Energy Technology Data Exchange (ETDEWEB)
Athenodorou, Andreas [Department of Physics, University of Cyprus,POB 20537, 1678 Nicosia (Cyprus); Computation-based Science and Technology Research Center, The Cyprus Institute,20 Kavafi Str., Nicosia 2121 (Cyprus); Teper, Michael [Rudolf Peierls Centre for Theoretical Physics, University of Oxford,1 Keble Road, Oxford OX1 3NP (United Kingdom)
2016-10-18
We extend our earlier calculations of the spectrum of closed flux tubes in SU(N) gauge theories in 2+1 dimensions, with a focus on questions raised by recent theoretical progress on the effective string action of long flux tubes and the world-sheet action for flux tubes of moderate lengths. Our new calculations in SU(4) and SU(8) provide evidence that the leading O(1/l{sup γ}) non-universal correction to the flux tube ground state energy does indeed have a power γ≥7. We perform a study in SU(2), where we can traverse the length at which the Nambu-Goto ground state becomes tachyonic, to obtain an all-N view of the spectrum. Our comparison of the k=2 flux tube excitation energies in SU(4) and SU(6) suggests that the massive world sheet excitation associated with the k=2 binding has a scale that knows about the group and hence the theory in the bulk, and we comment on the potential implications of world sheet massive modes for the bulk spectrum. We provide a quantitative analysis of the surprising (near-)orthogonality of flux tubes carrying flux in different SU(N) representations, which implies that their screening by gluons is highly suppressed even at small N.
Closed flux tubes in D=2+1SU(N) gauge theories: dynamics and effective string description
International Nuclear Information System (INIS)
Athenodorou, Andreas; Teper, Michael
2016-01-01
We extend our earlier calculations of the spectrum of closed flux tubes in SU(N) gauge theories in 2+1 dimensions, with a focus on questions raised by recent theoretical progress on the effective string action of long flux tubes and the world-sheet action for flux tubes of moderate lengths. Our new calculations in SU(4) and SU(8) provide evidence that the leading O(1/l"γ) non-universal correction to the flux tube ground state energy does indeed have a power γ≥7. We perform a study in SU(2), where we can traverse the length at which the Nambu-Goto ground state becomes tachyonic, to obtain an all-N view of the spectrum. Our comparison of the k=2 flux tube excitation energies in SU(4) and SU(6) suggests that the massive world sheet excitation associated with the k=2 binding has a scale that knows about the group and hence the theory in the bulk, and we comment on the potential implications of world sheet massive modes for the bulk spectrum. We provide a quantitative analysis of the surprising (near-)orthogonality of flux tubes carrying flux in different SU(N) representations, which implies that their screening by gluons is highly suppressed even at small N.
Analysis list: Su(z)12 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available Su(z)12 Embryo,Larvae + dm3 http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/S...u(z)12.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/target/Su(z)12.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/target/Su(z)12.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Embryo....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Su(z)12.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/dm3/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/dm3/colo/Larvae.gml ...
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Raicevic, J; Bjelanovic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1990-12-15
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. It was found that the individual dose from external exposure during previous ten months was less than 2.5 mSv, and that single exposures of the staff was less than 1/10 of the annual dose limit. Comparison with the data for previous five years shows that the exposures in 1990 were lower than during past five years. It is stated that there has been no accident that would result in significant surface contamination. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radijacionih merenja. Dati su takodje rezultati merenja sadrzaja radioaktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. U trecem delu izvestaja navedeni su osnovni podaci o ukupnim kolicinama sakupljenog radioaktivnog materijala, ukupnoj velicini kontaminiranih i dekontaminiranih povrsina i broju dekontaminiranih predmeta. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila manja od 2,5 mSv a da su pojedinacna izlaganja radnog
Geometrical theory of ghost and Higgs fields and SU(2/1)
International Nuclear Information System (INIS)
Ne'eman, Y.; Thierry-Mieg, J.
1979-10-01
That a Principal Fiber Bundle provides a precise geometrical representation of Yang-Mills gauge theories has been known since 1963 and used since 1975. This work presents an entirely new domain of applications. The Feynman-DeWitt-Fadeev-Popov ghost-fields required in the renormalization procedure are identified with geometrical objects in the Principal Bundle. This procedure directly yields the BRS equations guaranteeing unitarity and Slavnov-Taylor invariance of the quantum effective Lagrangian. Except for one ghost field and its variation, this entire symmetry thus corresponds to classical notions, in that it is geometrical, and completely independent of the gauge-fixing procedure, which determines the quantized Lagrangian. These results may be used to fix the signs associated with the various ghost loops of quantum supergravity. The result is based upon the identification of a geometrical Z(2) x Z(2) double-gradation of the generalized fields in supergravity: [physical/ghost] fields and [integer/half integer] spins. Then the case of a supergroup as an internal symmetry gauge is considered. Ghosts geometrically associated to odd generators may be identified with the Goldstone-Nambu Higgs-Kibble scalar fields of conventional models with spontaneous symmetry breakdown. As an example, the chiral SU(3)/sub L/ x SU(3)/sub R/ flavor symmetry is realized by gauging the supergroup Q(3).Lastly, the main results concerning asthenodynamics (Weak-EM Unification) as given by the ghost-gauge SU(2/1) supergroup are recalled. 1 table
International Nuclear Information System (INIS)
Partensky, A.; Maguin, C.
1976-11-01
The main results of a work concerning the calculation of the matrices of the generators of SU(4) in a given (p,p',p'') irreducible representation, in which the states are labelled by the spin quantum numbers, S, MS, are given. Then the SU(4) algebra is defined, the labelling problem of the states is discussed and the Racah formula transformed, which facilitates the calculation. The semi-reduced matrix elements of the Q, Vsup(Q) and Wsup(Q) vectors are defined. Finally an explicit formulation of the matrix elements of Q is given, in the particular case T=p for any S, or S=p for any T; the example of the (3 2 0) irreducible representation is treated
Couplings in D(2,1;α) superconformal mechanics from the SU(2) perspective
Energy Technology Data Exchange (ETDEWEB)
Galajinsky, Anton [Laboratory of Mathematical Physics, Tomsk Polytechnic University,Lenin Ave. 30, 634050 Tomsk (Russian Federation)
2017-03-09
Dynamical realizations of the most general N=4 superconformal group in one dimension D(2,1;α) are reconsidered from the perspective of the R-symmetry subgroup SU(2). It is shown that any realization of the R-symmetry subalgebra in some phase space can be extended to a representation of the Lie superalgebra corresponding to D(2,1;α). Novel couplings of arbitrary number of supermultiplets of the type (1,4,3) and (0,4,4) to a single supermultiplet of either the type (3,4,1), or (4,4,0) are constructed. D(2,1;α) superconformal mechanics describing superparticles propagating near the horizon of the extreme Reissner-Nordström-AdS-dS black hole in four and five dimensions is considered. The parameter α is linked to the cosmological constant.
Quantum algebra Uqp(u2) and application to the rotational collective dynamics of the nuclei
International Nuclear Information System (INIS)
Barbier, R.
1995-01-01
This thesis concerns some aspects of new symmetries in Nuclear Physics. It comprises three parts. The first one is devoted to the study of the quantum algebra U qp (u 2 ). More precisely, we develop its Hopf algebraic structure and we study its co-product structure. The bases of the representation theory of U qp (u 2 ) are introduced. On one hand, we construct the finite-dimensional irreducible representations of U qp (u 2 ). On the other hand, we calculate the Clebsch-Gordan coefficients with the projection operator method. To complete our study, we construct some deformed boson mappings of the quantum algebras U qp (u 2 ), U q 2 (su 2 ) and U qp (u 1,1 ). The second part deals with the construction of a new phenomenological model of the non rigid rotator. This model is based on the quantum algebra U qp (u 2 ). The rotational energy and the E2 reduced transition probabilities are obtained. They depend on the two deformation parameters q and p of the quantum algebra. We show how the use of the two-parameter deformation of the algebra U qp (u 2 ) leads to a generalization of the U q (su 2 )-rotator model. We also introduce a new model of the anharmonic oscillator on the basis of the quantum algebra U qp (u 2 ). We show that the system of the U q (su 2 )-rotator and of the anharmonic oscillator can be coupled with the use of the deformation parameters of U qp (u 2 ). A ro-vibration energy formula and expansion 'a la' Dunham are obtained. The aim of the lest part is to apply our non rigid rotator model to the rotational collective dynamics of the superdeformed nuclei of the A∼130 - 150 and A∼190 mass regions and deformed nuclei of the actinide and rare earth series. We adjust the free parameters of our model and compare our results with those arising from four other models of the non rigid rotator. A comparative analysis is given in terms of transition energies. We calculate the dynamical moments of inertia with the fitted parameters. A comparison between the
Unconstrained SU(2) and SU(3) Yang-Mills classical mechanics
International Nuclear Information System (INIS)
Dahmen, B.; Raabe, B.
1992-01-01
A systematic study of contraints in SU(2) and SU(3) Yang-Mills classical mechanics is performed. Expect for the SU(2) case with spatial angular momenta they turn out to be nonholonomic. The complete elimination of the unphysical gauge and rotatinal degrees of freedom is achieved using Dirac's constraint formalism. We present an effective unconstrained formulation of the general SU(2) Yang-Mills classical mechanics as well as for SU(3) in the subspace of vanishing spatial angular momenta that is well suited for further explicit dynamical investigations. (orig.)
Geometry and time scales of self-consistent orbits in a modified SU(2) model
International Nuclear Information System (INIS)
Jezek, D.M.; Hernandez, E.S.; Solari, H.G.
1986-01-01
We investigate the time-dependent Hartree-Fock flow pattern of a two-level many fermion system interacting via a two-body interaction which does not preserve the parity symmetry of standard SU(2) models. The geometrical features of the time-dependent Hartree-Fock energy surface are analyzed and a phase instability is clearly recognized. The time evolution of one-body observables along self-consistent and exact trajectories are examined together with the overlaps between both orbits. Typical time scales for the determinantal motion can be set and the validity of the time-dependent Hartree-Fock approach in the various regions of quasispin phase space is discussed
Unconstrained SU(2) and SU(3) Yang-Mills clasical mechanics
International Nuclear Information System (INIS)
Dahmen, B.; Raabe, B.
1992-01-01
A systematic study of constraints in SU(2) and SU(3) Yang-Mills classical mechanics is performed. Expect for the SU(2) case with vanishing spatial angular momenta they turn out to be non-holonomic. Using Dirac's constraint formalism we achieve a complete elimination of the unphysical gauge and rotational degrees of freedom. This leads to an effective unconstrained formulation both for the full SU(2) Yang-Mills classical mechanics and for the SU(3) case in the subspace of vanishing spatial angular momenta. We believe that our results are well suited for further explicit dynamical investigations. (orig.)
An SU(3)xU(1) theory of weak-electromagnetic interactions with charged boson mixing
International Nuclear Information System (INIS)
Singer, M.
1978-01-01
An SU(3)xU(1) gauge theory of weak electromagnetic interactions is proposed in which the charged bosons mix with each other. The model naturally ensures e-μ and quark-lepton universality in couplings, and the charged boson mixing permits an equal number of leptons and quark flavours. There are no new stable leptons. All the fermions are placed in triplets and singlets and the theory is vector-like and hence free of anomalies. In addition one of the charged bosons can have a mass less than 43 GeV. Discrete symmetries and specific choices for Higgs fields are postulated to obtain the appropriate boson and fermion masses. Calculations for the decay of the tau particle, which is described as a heavy electron, are given. Multimuon events are discussed as are neutrino neutral currents. Calculations are also given for testing asymmetries in e-hadron scattering due to weak electron neutral currents along with other phenomenology of the model
On the SU(2)× SU(2) symmetry in the Hubbard model
Jakubczyk, Dorota; Jakubczyk, Paweł
2012-08-01
We discuss the one-dimensional Hubbard model, on finite sites spin chain, in context of the action of the direct product of two unitary groups SU(2)× SU(2). The symmetry revealed by this group is applicable in the procedure of exact diagonalization of the Hubbard Hamiltonian. This result combined with the translational symmetry, given as the basis of wavelets of the appropriate Fourier transforms, provides, besides the energy, additional conserved quantities, which are presented in the case of a half-filled, four sites spin chain. Since we are dealing with four elementary excitations, two quasiparticles called "spinons", which carry spin, and two other called "holon" and "antyholon", which carry charge, the usual spin- SU(2) algebra for spinons and the so called pseudospin-SU(2) algebra for holons and antiholons, provide four additional quantum numbers.
DEFF Research Database (Denmark)
Schneider, Uffe; Nielsen, Rikke; Pedersen, Court
2007-01-01
. METHODS: DNA samples were collected retrospectively from 145 Danes infected with HIV-1 with known seroconversion times. In addition, plasma was collected retrospectively from 81 of these participants for use in the suPAR analysis. Survival was analysed using Kaplan Meier analysis. RESULTS: Survival...... to A transition at -118 and an A to G transition at -465 comparative to the transcription start site. These promoter transitions did not influence neither the suPAR levels nor patient survival. CONCLUSION: Plasma suPAR levels, as measured by the suPARnosticTM assay, were strongly predictive of survival in ART...
Non(anti)commutative N = (1,1/2) supersymmetric U(1) gauge theory
International Nuclear Information System (INIS)
Araki, Takeo; Ito, Katsushi; Ohtsuka, Akihisa
2005-01-01
We study a reduction of deformation parameters in non(anti)commutative N = 2 harmonic superspace to those in non(anti)commutative N = 1 superspace. By this reduction we obtain the exact gauge and supersymmetry transformations in the Wess-Zumino gauge of non(anti)commutative N = 2 supersymmetric U(1) gauge theory defined in the deformed harmonic superspace. We also find that the action with the first order correction in the deformation parameter reduces to the one in the N = 1 superspace by some field redefinition. We construct deformed N = (1,1/2) supersymmetry in N = 2 supersymmetric U(1) gauge theory in non(anti)commutative N = 1 superspace
SU(2)xSU(2) coupling rule and a tensor glueball candidate
International Nuclear Information System (INIS)
Lanik, J.
1984-01-01
The data on the decay of THETA(1640) particles are considered. It is shown that the SU(2)xSU(2) mechanism for coupling of theta(1640) tensor glueball candidate to pseudoscalar Gold-stone mesons is in a remarkable agreement with existing experimental data
International Nuclear Information System (INIS)
Vyas, Manan; Kota, V.K.B.
2010-01-01
For m fermions in Ω number of single particle orbitals, each fourfold degenerate, we introduce and analyze in detail embedded Gaussian unitary ensemble of random matrices generated by random two-body interactions that are SU(4) scalar [EGUE(2)-SU(4)]. Here the SU(4) algebra corresponds to the Wigner's supermultiplet SU(4) symmetry in nuclei. Embedding algebra for the EGUE(2)-SU(4) ensemble is U(4Ω) contains U(Ω) x SU(4). Exploiting the Wigner-Racah algebra of the embedding algebra, analytical expression for the ensemble average of the product of any two m particle Hamiltonian matrix elements is derived. Using this, formulas for a special class of U(Ω) irreducible representations (irreps) {4 r , p}, p = 0, 1, 2, 3 are derived for the ensemble averaged spectral variances and also for the covariances in energy centroids and spectral variances. On the other hand, simplifying the tabulations of Hecht for SU(Ω) Racah coefficients, numerical calculations are carried out for general U(Ω) irreps. Spectral variances clearly show, by applying Jacquod and Stone prescription, that the EGUE(2)-SU(4) ensemble generates ground state structure just as the quadratic Casimir invariant (C 2 ) of SU(4). This is further corroborated by the calculation of the expectation values of C 2 [SU(4)] and the four periodicity in the ground state energies. Secondly, it is found that the covariances in energy centroids and spectral variances increase in magnitude considerably as we go from EGUE(2) for spinless fermions to EGUE(2) for fermions with spin to EGUE(2)-SU(4) implying that the differences in ensemble and spectral averages grow with increasing symmetry. Also for EGUE(2)-SU(4) there are, unlike for GUE, non-zero cross-correlations in energy centroids and spectral variances defined over spaces with different particle numbers and/or U(Ω) [equivalently SU(4)] irreps. In the dilute limit defined by Ω → ∞, r >> 1 and r/Ω → 0, for the {4 r , p} irreps, we have derived analytical
We live in the quantum 4-dimensional Minkowski space-time
Hwang, W-Y. Pauchy
2015-01-01
We try to define "our world" by stating that "we live in the quantum 4-dimensional Minkowski space-time with the force-fields gauge group $SU_c(3) \\times SU_L(2) \\times U(1) \\times SU_f(3)$ built-in from the outset". We begin by explaining what "space" and "time" are meaning for us - the 4-dimensional Minkowski space-time, then proceeding to the quantum 4-dimensional Minkowski space-time. In our world, there are fields, or, point-like particles. Particle physics is described by the so-called ...
Flipped SU(5) from Z{sub 12-I} orbifold with Wilson line
Energy Technology Data Exchange (ETDEWEB)
Kim, Jihn E. [Department of Physics and Astronomy, and Center for Theoretical Physics, Seoul National University, Seoul 151-747 (Korea, Republic of)]. E-mail: jekim@phyp.snu.ac.kr; Kyae, Bumseok [School of Physics, Korea Institute for Advanced Study, 207-43 Cheongryangri-dong, Dongdaemun-gu, Seoul 130-722 (Korea, Republic of)]. E-mail: bkyae@kias.re.kr
2007-05-14
We construct a three family flipped SU(5) model from the heterotic string theory compactified on the Z{sub 12-I} orbifold with one Wilson line. The gauge group is SU(5)xU(1){sub X}xU(1){sup 3}x[SU(2)xSO(10)xU(1){sup 2}]{sup '}. This model does not derive any non-Abelian group except SU(5) from E{sub 8}, which is possible only for two cases in case of one shift V, one in Z{sub 12-I} and the other in Z{sub 12-II}. We present all possible Yukawa couplings. We place the third quark family in the twisted sectors and two light quark families in the untwisted sector. From the Yukawa couplings, the model provides the R-parity, the doublet-triplet splitting, and one pair of Higgs doublets. It is also shown that quark and lepton mixings are possible. So far we have not encountered a serious phenomenological problem. There exist vector-like flavor SU(5) exotics (including Q{sub em}=+/-16 color exotics and Q{sub em}=+/-12 electromagnetic exotics) and SU(5) vector-like singlet exotics with Q{sub em}=+/-12 which can be removed near the GUT scale. In this model, sin{sup 2}{theta}{sub W}{sup 0}=38 at the full unification scale.
Point group invariants in the Uqp(u(2)) quantum algebra picture
International Nuclear Information System (INIS)
Kibler, M.
1993-07-01
Some consequences of a qp-quantization of a point group invariant developed in the enveloping algebra of SU(2) are examined. A set of open problems concerning such invariants in the U qp (u(2)) quantum algebra picture is briefly discussed. (author) 18 refs
Infinite statistics and the SU(1, 1) phase operator
International Nuclear Information System (INIS)
Gerry, Christopher C
2005-01-01
A few years ago, Agarwal (1991 Phys. Rev. A 44 8398) showed that the Susskind-Glogower phase operators, expressible in terms of Bose operators, provide a realization of the algebra for particles obeying infinite statistics. In this paper we show that the SU(1, 1) phase operators, constructed in terms of the elements of the su(1, 1) Lie algebra, also provide a realization of the algebra for infinite statistics. There are many realizations of the su(1, 1) algebra in terms of single or multimode bose operators, three of which are discussed along with their corresponding phase states. The Susskind-Glogower phase operator is a special case of the SU(1, 1) phase operator associated with the Holstein-Primakoff realization of su(1, 1). (letter to the editor)
Fabrication of thin SU-8 cantilevers: initial bending, release and time stability
International Nuclear Information System (INIS)
Keller, Stephan; Boisen, Anja; Haefliger, Daniel
2010-01-01
SU-8 cantilevers with a thickness of 2 µm were fabricated using a dry release method and two steps of SU-8 photolithography. The processing of the thin SU-8 film defining the cantilevers was experimentally optimized to achieve low initial bending due to residual stress gradients. In parallel, the rotational deformation at the clamping point allowed a qualitative assessment of the device release from the fluorocarbon-coated substrate. The change of these parameters during several months of storage at ambient temperature was investigated in detail. The introduction of a long hard bake in an oven after development of the thin SU-8 film resulted in reduced cantilever bending due to removal of residual stress gradients. Further, improved time-stability of the devices was achieved due to the enhanced cross-linking of the polymer. A post-exposure bake at a temperature T PEB = 50 °C followed by a hard bake at T HB = 90 °C proved to be optimal to ensure low cantilever bending and low rotational deformation due to excellent device release and low change of these properties with time. With the optimized process, the reproducible fabrication of arrays with 2 µm thick cantilevers with a length of 500 µm and an initial bending of less than 20 µm was possible. The theoretical spring constant of these cantilevers is k = 4.8 ± 2.5 mN m −1 , which is comparable to the value for Si cantilevers with identical dimensions and a thickness of 500 nm.
Structure and Lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+
International Nuclear Information System (INIS)
Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.R.; Chen, M.H.
1993-01-01
The first Doppler-shift-free crystal-spectrometer measurement of stationary highly stripped uranium ions from a high-energy electron beam ion trap is presented. Thirteen 2s 1/2- 2p 3/2 transitions in eight ionization states bteween Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 37 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamic effects in highly charged multielectron ions. A value of 47.39±0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with theory
Structure and lamb shift of 2s1/2-2p3/2 levels in lithiumlike U89+ through neonlike U82+
International Nuclear Information System (INIS)
Beiersdorfer, P.; Knapp, D.; Marrs, R.E.; Elliott, S.; Chen, M.H.
1993-01-01
The first Doppler-shift-free crystal- spectrometer measurements from stationary highly stripped uranium ions are presented. Eleven 2s 1/2 -2p 3/2 transitions in eight ionization stages between Li-like U 89+ and Ne-like U 82+ are identified and measured with an accuracy as high as 45 ppm, providing benchmarks for testing relativistic correlation and quantum electrodynamical effects in highly charged multi-electron ions. A value of 47.38 ± 0.35 eV is found for the 2s 1/2 Lamb shift in Li-like U 89+ , in excellent agreement with the theoretical value of 47.58 eV
Coherent states related with SU(N) and SU(N,1) groups
International Nuclear Information System (INIS)
Gitman, D.M.; Shelepin, A.L.
1990-01-01
The basis of coherent state (CS) for symmetric presentations of groups SU(N) and SU(N,1) is plotted, its properties being investigated. Evolution of CS is considered. Relation between CS of groups SU(N) and Glauber is ascertained
Rare B-meson decays in SU(2)LxSU(2)RxU(1) model
International Nuclear Information System (INIS)
Asatryan, H.M.; Ioannissian, A.N.
1989-01-01
Rare B-meson decays are investigated in the left-right synmmetric models. The scalar particle contribution to the amplitude of the b → s γ decay is calculated. It is shown that this contribution can be essential even for the scalar particles masses of about several TeV. The effects due to the left-right symmetry and scalar particles can be detected by measuring the photon polarization in the decay B → K * γ. 9 refs.; 1 fig.; 1 tab
Coherent states for a polynomial su(1, 1) algebra and a conditionally solvable system
International Nuclear Information System (INIS)
Sadiq, Muhammad; Inomata, Akira; Junker, Georg
2009-01-01
In a previous paper (2007 J. Phys. A: Math. Theor. 40 11105), we constructed a class of coherent states for a polynomially deformed su(2) algebra. In this paper, we first prepare the discrete representations of the nonlinearly deformed su(1, 1) algebra. Then we extend the previous procedure to construct a discrete class of coherent states for a polynomial su(1, 1) algebra which contains the Barut-Girardello set and the Perelomov set of the SU(1, 1) coherent states as special cases. We also construct coherent states for the cubic algebra related to the conditionally solvable radial oscillator problem.
Upper bounds on Higgs and top quark masses in the flipped SU(5)xU(1) superstring model
Energy Technology Data Exchange (ETDEWEB)
Durand, L.; Lopez, J.L.
1989-02-02
In this letter, we use a simplified method to calculate high-energy unitarity constraints on grand unified broken supersymmetric models. We apply the method to the ''flipped'' SU(5)xU(1) superstring model, obtain the constraints at a grand unified mass scale M/sub G/=4x10/sup 16/ GeV, and then use the renormalization group equations to evolve the constraints to the low-energy mass scale M/sub W/. We find upper bounds on the low-energy superpotential parameters which in turn imply absolute upper bounds on the top quark mass, m/sub t/< or approx.200 GeV, and on the lightest neutral Higgs boson mass, Msub(H/sub 1//sup 0/)< or approx.155 GeV. We also obtain an upper bound on Msub(H/sub 1//sup 0/) as a function of m/sub t/ which shows that for favored values of the ratio of Higgs vacuum expectation values Msub(H/sub 1//sup 0/)< or approx.125 GeV.
SU(8) family unification with boson-fermion balance
CERN. Geneva
2014-01-01
Grand unification has been intensively investigated for over forty years, and many different approaches have been tried. In this talk I propose a model that involves three ingredients that do not appear in the usual constructions: (1) boson--fermion balance without full supersymmetry, (2) canceling the spin 1/2 fermion gauge anomalies against the anomaly from a gauged spin 3/2 gravitino, and (3) using a scalar field representation with non-zero U(1) generator to break the SU(8) gauge symmetry through a ground state which, before dynamical symmetry breaking, has a periodic U(1) generator structure. The model has a number of promising features: (1) natural incorporation of three families, (2) incorporation of the experimentally viable flipped SU(5) model, (3) a symmetry breaking pathway to the standard model using the scalar field required by boson-fermion balance, together with a stage of most attractive channel dynamical symmetry breaking, without postulating additional Higgs fields, (4) vanishing of bare Yuk...
Notes on basic materials A (1)
International Nuclear Information System (INIS)
Donald, R.
1977-01-01
The lecture is in sections entitled: notation and generalities, symmetries (introduction, time development of a system, symmetry principles and conservation laws, parity, charge conjugation, continuous transformations, SU2, the quark model, extensions to SU3 (charm)); relativistic wave equations (general transformations, spin in a relativistic system, spin 1/2 particles, the Dirac equation, projection operators, spin 1 particles, the Proca equation). (U.K.)
Dark Gauge U(1) symmetry for an alternative left-right model
Kownacki, Corey; Ma, Ernest; Pollard, Nicholas; Popov, Oleg; Zakeri, Mohammadreza
2018-02-01
An alternative left-right model of quarks and leptons, where the SU(2)_R lepton doublet (ν ,l)_R is replaced with (n,l)_R so that n_R is not the Dirac mass partner of ν _L, has been known since 1987. Previous versions assumed a global U(1)_S symmetry to allow n to be identified as a dark-matter fermion. We propose here a gauge extension by the addition of extra fermions to render the model free of gauge anomalies, and just one singlet scalar to break U(1)_S. This results in two layers of dark matter, one hidden behind the other.
SU2 nonstandard bases: the case of mutually unbiased bases
International Nuclear Information System (INIS)
Olivier, Albouy; Kibler, Maurice R.
2007-02-01
This paper deals with bases in a finite-dimensional Hilbert space. Such a space can be realized as a subspace of the representation space of SU 2 corresponding to an irreducible representation of SU 2 . The representation theory of SU 2 is reconsidered via the use of two truncated deformed oscillators. This leads to replace the familiar scheme [j 2 , j z ] by a scheme [j 2 , v ra ], where the two-parameter operator v ra is defined in the universal enveloping algebra of the Lie algebra su 2 . The eigenvectors of the commuting set of operators [j 2 , v ra ] are adapted to a tower of chains SO 3 includes C 2j+1 (2j belongs to N * ), where C 2j+1 is the cyclic group of order 2j + 1. In the case where 2j + 1 is prime, the corresponding eigenvectors generate a complete set of mutually unbiased bases. Some useful relations on generalized quadratic Gauss sums are exposed in three appendices. (authors)
Energy Technology Data Exchange (ETDEWEB)
Markovic, H [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1962-07-15
This report describes the task concerned with measurements of neutron flux in four experimental channels, called VISA-2 channels. All the channels are made of aluminium tubes, one is sealed to prevent contact of foils with heavy water, and are placed in the regular reactor lattice next to the central experimental channel VK-5. Measuring results, i.e. absolute values of neutron flux and flux distribution are needed for realisation of the VISA-2 project. Measurements of neutron flux are done by activation method. Activation foils are placed in cylindrical aluminium tubes specially prepared for this purpose and placed in VISA-2 channels. Foils are irradiated simultaneously for 5 hours at reactor power of 150 kW. Neutron flux distribution is determined by measuring the relative activity of cobalt foils. [Serbo-Croat] Ovaj izvestaj opisuje merenja neutronskog fluksa u cetiri eksperimentalna kanala VISA-2. Svi VISA-2 kanali nacinjeni su od aluminijuma, jedan je hermeticki zatvoren da folije koje se ozacuju ne dodju ukontakt sa teskom vodom i svi su smesteni neposredno pored centralnog eksperimentalnog kanala VK-5. Rezultati merenja, odnosno apsolutne vrednosti neutronskog fluksa i reposdele fluksa potrebni su za realizaciju projekta VISA-2. Mrerenja neutronskog fluksa izvreseno je aktivacionom tehnikom. Aktivacione folije smestene su u prethodno napravljene aluminijumske cevcice. Folije su ozracivane istovremeno pri snazi od 150 kW pe casova. Raspodela neutronskog fluksa odredjena je merenjem relativne aktivnosti folija od kobalta.
Energy Technology Data Exchange (ETDEWEB)
Lamy-Poirier, Joel, E-mail: jlamypoirier@perimeterinstitute.c [Departement de Physique, de Genie Physique et d' Optique, Universite Laval, Quebec, Canada, G1V 0A6 (Canada); Mathieu, Pierre, E-mail: pmathieu@phy.ulaval.c [Departement de Physique, de Genie Physique et d' Optique, Universite Laval, Quebec, Canada, G1V 0A6 (Canada)
2011-06-01
This is the second of two articles (independent of each other) devoted to the analysis of the path description of the states in su-hat (2){sub k} WZW models. Here we present a constructive derivation of the fermionic character at level k based on these paths. The starting point is the expression of a path in terms of a sequence of nonlocal (formal) operators acting on the vacuum ground-state path. Within this framework, the key step is the construction of the level-k operator sequences out of those at level-1 by the action of a new type of operators. These actions of operators on operators turn out to have a path interpretation: these paths are precisely the finitized RSOS paths related to the unitary minimal models M(k+1,k+2). We thus unravel - at the level of the path representation of the states - a direct factorization into a k=1 spinon part times a RSOS factor. It is also pointed out that since there are two fermionic forms describing these finite RSOS paths, the resulting fermionic su-hat (2){sub k} characters arise in two versions. Finally, the relation between the present construction and the Nagoya spectral decomposition of the path space is sketched.
Symmetry breaking of SO(10) and constraints on Higgs potential, (1)
International Nuclear Information System (INIS)
Yasue, Masaki.
1980-08-01
The symmetry breaking of SO(10) is studied in the tree approximation of the potential for an adjoint (45) representation and a spinorial (16) representation. The potential can break SO(10) down to SU(3)sub(c) x SU(2)sub(L) x U(1). It is not allowed to break SO(10) down to SU(3)sub(c) x U(1)sub(em) via SU(3)sub(c) x SU(2)sub(L) x U(1) even in the presence of a cubic (16) (16*) (45) coupling. Instead, SU(3) x U(1) comes from SU(4) x U(1). The masses for the physical Higgs scalars are calculated in SU(3)sub(c) x SU(2)sub(L) x U(1). The dynamically allowed region of the vacuum expectation values of the (45) is found to be strongly restricted. As a result, SO(6) and SO(4) cannot show up in the course of the breaking. (author)
Semiclassical description of quantum rotator in terms of SU(2) coherent states
International Nuclear Information System (INIS)
Gitman, D M; Petrusevich, D A; Shelepin, A L
2013-01-01
We introduce coordinates of the rigid body (rotator) using mutual positions between body-fixed and space-fixed reference frames. Wave functions that depend on such coordinates can be treated as scalar functions of the group SU(2). Irreducible representations of the group SU(2) × SU(2) in the space of such functions describe their possible transformations under independent rotations of the both reference frames. We construct sets of the corresponding group SU(2) × SU(2) Perelomov coherent states (CS) with a fixed angular momentum j of the rotator as special orbits of the latter group. Minimization of different uncertainty relations is discussed. The classical limit corresponds to the limit j → ∞. Considering Hamiltonians of rotators with different characteristics, we study the time evolution of the constructed CS. In some cases, the CS time evolution is completely or partially reduced to their parameter time evolution. If these parameters are chosen as Euler angles, then they obey the Euler equations in the classical limit. Quantum corrections to the motion of the quantum rotator can be found from exact equations on the CS parameters. (paper)
Finite size giant magnons in the SU(2) x SU(2) sector of AdS4 x CP3
International Nuclear Information System (INIS)
Lukowski, Tomasz; Sax, Olof Ohlsson
2008-01-01
We use the algebraic curve and Luescher's μ-term to calculate the leading order finite size corrections to the dispersion relation of giant magnons in the SU(2) x SU(2) sector of AdS 4 x CP 3 . We consider a single magnon as well as one magnon in each SU(2). In addition the algebraic curve computation is generalized to give the leading order correction for an arbitrary multi-magnon state in the SU(2) x SU(2) sector.
Particle-hole excitations in the interacting boson model; 4, the U(5)-SU(3) coupling
De Coster, C; Heyde, Kris L G; Jolie, J; Lehmann, H; Wood, J L
1999-01-01
In the extended interacting boson model (EIBM) both particle- and hole-like bosons are incorporated to encompass multi-particle-multi-hole excitations at and near to closed shells.We apply the group theoretical concepts of the EIBM to the particular case of two coexisting systems in the same nucleus exhibiting a U(5) (for the regular configurations) and an SU(3) symmetry (for the intruder configurations).Besides the description of ``global'' symmetry aspects in terms of I-spin , also the very specific local mixing effects characteristic for the U(5)-SU(3) symmetry coupling are studied.The model is applied to the Po isotopes and a comparison with a morerealistic calculation is made.
Random SU(2) invariant tensors
Li, Youning; Han, Muxin; Ruan, Dong; Zeng, Bei
2018-04-01
SU(2) invariant tensors are states in the (local) SU(2) tensor product representation but invariant under the global group action. They are of importance in the study of loop quantum gravity. A random tensor is an ensemble of tensor states. An average over the ensemble is carried out when computing any physical quantities. The random tensor exhibits a phenomenon known as ‘concentration of measure’, which states that for any bipartition the average value of entanglement entropy of its reduced density matrix is asymptotically the maximal possible as the local dimensions go to infinity. We show that this phenomenon is also true when the average is over the SU(2) invariant subspace instead of the entire space for rank-n tensors in general. It is shown in our earlier work Li et al (2017 New J. Phys. 19 063029) that the subleading correction of the entanglement entropy has a mild logarithmic divergence when n = 4. In this paper, we show that for n > 4 the subleading correction is not divergent but a finite number. In some special situation, the number could be even smaller than 1/2, which is the subleading correction of random state over the entire Hilbert space of tensors.
Non-planar diagrams in the large N limit of U(N) and SU(N) lattice gauge theories
International Nuclear Information System (INIS)
Weingarten, D.
1980-01-01
It is shown that the limit as N → infinitely with g 2 N fixed of the strong coupling expansion for the vacuum expectation values of a U(N) or SU(N) lattice gauge theory is not given by a sum of planar diagrams. This contradicts a result claimed by De Wit and 't Hooft. (orig.)
The phase transition in the SU(5) model at high temperatures
International Nuclear Information System (INIS)
Daniel, M.; Vayonakis, C.E.
1981-01-01
Within the minimum GUT model we have studied the nature of the fluctuation-induced transition between the SU(5) and the SU(3)sub(c) x SU(2) x U(1) phase which occurs at high temperatures. Our analysis is limited to the case when the phase transition occurs outside the critical (fluctuation-dominated) region. For this to happen the SU(5) model has to be in a mode analogous to the type I superconductor. This corresponds to having the scalar quartic couplings in the Higgs sector less than the squared gauge coupling. For generic values of the coupling constants the phase transition is found to be weakly first order. As we approach the boundaries for the region of the SU(3)sub(c) x SU(2) x U(1) phase, however, a strong first-order transition occurs. The SU(5) mode (analogous to the type II superconductor) when the phase transition occurs inside the fluctuation-dominated region has been recently studied by Ginsparg. His results together with ours show that there is a continuous merging of the type I mode into the type II mode. Finally our analysis elucidates some aspects of the monopole problem in grand unified theories. (orig.)
Inflation and monopoles in supersymmetric SU(4)c x SU(2)L x SU(2)R
International Nuclear Information System (INIS)
Jeannerot, R.; Khalil, S.; Lazarides, G.; Shafi, Q.
2000-02-01
We show how hybrid inflation can be successfully realized in a supersymmetric model with gauge group G PS = SU(4) c x SU(2) L x SU(2) R . By including a non-renormalizable superpotential term, we generate an inflationary valley along which G PS is broken to the standard model gauge group. Thus, catastrophic production of the doubly charged magnetic monopoles, which are predicted by the model, cannot occur at the end of inflation. The results of the cosmic background explorer can be reproduced with natural values (of order 10 -3 ) of the relevant coupling constant, and symmetry breaking scale of G PS close to 10 16 GeV. The spectral index of density perturbations lies between unity and 0.94. Moreover, the μ-term is generated via a Peccei-Quinn symmetry and proton is practically stable. Baryogenesis in the universe takes place via leptogenesis. The low deuterium abundance constraint on the baryon asymmetry, the gravitino limit on the reheat temperature and the requirement of almost maximal ν μ - ν τ mixing from SuperKamiokande can be simultaneously met with m νμ , m ντ and heaviest Dirac neutrino mass determined from the large angle MSW resolution of the solar neutrino problem, the SuperKamiokande results and SU(4) c symmetry respectively. (author)
Relationship between harmonic analysis on SU(2) and on SL(2,C)/SU(2)
International Nuclear Information System (INIS)
Healy, D.M. Jr.
1986-01-01
A topic of interest in harmonic analysis is the comparison of Fourier transforms on compact and noncompact spaces. The Poisson summation formula provides a classical example of this idea by providing an explicit relationship between harmonic analysis on the real line R and on the circle S 1 . This dissertation provides a new geometric proof of this formula, and then generalizes this approach to obtain a relationship between Fourier transforms on Upsilon, the space of positive matrices in SL(2,C), and Fourier transforms on SU(2)
International Nuclear Information System (INIS)
Jelassi, H.; Viaris de Lesegno, B.; Pruvost, L.
2006-01-01
We report on photoassociation of cold 87 Rb atoms providing the spectroscopy of (5s 1/2 +5p 1/2 )0 u + long-range molecular states, in the energy range of [-12.5, -0.7 cm -1 ] below the dissociation limit. A Lu-Fano approach coupled to the LeRoy-Bernstein formula is used to analyze the data. The Lu-Fano graph exhibits the coupling of the molecular series with the (5s 1/2 +5p 3/2 )0 u + one, which is due to spin effects in the molecule. A two-channel model involving an improved LeRoy-Bernstein formula allows us to characterize the molecular series, to localize (5s 1/2 +5p 3/2 )0 u + levels, to evaluate the coupling, and to predict the energy and width of the first predissociated level of (5s 1/2 +5p 3/2 )0 u + series. An experimental spectrum confirms the prediction
Mixing angles in SU(2)/sub L/ x U(1) gauge model
International Nuclear Information System (INIS)
Nandi, S.; Tanaka, K.
1979-01-01
Exact expressions for the mixing parameters are obtained in terms of mass ratios in the standard Weinberg-Salam model with permutation symmetry S 3 for six quarks. The CP-violating phase is ignored, and there are no arbitrary parameters except for the quark masses. In the lowest order, the angles defined by Kobayashi-Maskawa are sin theta/sub 1/ = sin theta/sub c/ = (m/sub d//m/sub d/ + m/sub s/)/sup 1/2/, sin theta 3 = -sin theta/sub 3/ = -m 2 /sub s//m 2 /sub b/, and m/sub t/m/sub s/ greater than or equal to m/sub c/m/sub b/ = 7.2 GeV 2 or m/sub t/ greater than or equal to 24 GeV for m/sub s/ = 0.3 GeV
Austalides S-U, New Meroterpenoids from the Sponge-Derived Fungus Aspergillus aureolatus HDN14-107
Directory of Open Access Journals (Sweden)
Jixing Peng
2016-07-01
Full Text Available Three new meroterpenoids, named austalides S-U (1–3, were isolated from the culture of a sponge-derived fungus Aspergillus aureolatus HDN14-107, together with eleven known austalides derivates (4–14. Their structures, including absolute configurations, were assigned on the basis of NMR, MS data, and TDDFT ECD calculations. Compound 1 is the first case of austalides with the terpene ring fused to the chroman ring in trans configuration. Compounds 3 and 5 exhibited activities against influenza virus A (H1N1, with IC50 values of 90 and 99 μM, respectively.
N-anti N oscillation in SO(10) and SU(6) supersymmetric grand unified models
International Nuclear Information System (INIS)
Fujimoto, Y.; Zhiyong, Z.
1982-06-01
N-anti N oscillation in SO(10) and SU(6) S.G.U.M. is considered. We find a new type of diagram leading to a faster oscillation rate than in non-supersymmetric case. It is also noted that in SO(10) S.G.U.M. with intermediate SU(4)sub(C)xSU(2)sub(L)xSU(2)sub(R) symmetry N-anti N oscillation would be highly suppressed, which may not necessarily be the case for SU(6) S.G.U.M. (author)
Dark gauge U(1) symmetry for an alternative left-right model
Energy Technology Data Exchange (ETDEWEB)
Kownacki, Corey; Ma, Ernest; Pollard, Nicholas; Popov, Oleg; Zakeri, Mohammadreza [University of California, Department of Physics and Astronomy, Riverside, CA (United States)
2018-02-15
An alternative left-right model of quarks and leptons, where the SU(2){sub R} lepton doublet (ν, l){sub R} is replaced with (n, l){sub R} so that n{sub R} is not the Dirac mass partner of ν{sub L}, has been known since 1987. Previous versions assumed a global U(1){sub S} symmetry to allow n to be identified as a dark-matter fermion. We propose here a gauge extension by the addition of extra fermions to render the model free of gauge anomalies, and just one singlet scalar to break U(1){sub S}. This results in two layers of dark matter, one hidden behind the other. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Bjelanovic, J; Glodic, S; Raicevic, J; Pavlovic, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1989-12-15
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. It was found that the individual dose from external exposure during previous ten months was less than 4.0 mSv, and that single exposures of the staff was less than 1/10 of the annual dose limit. Comparison with the data for previous five years shows that the exposures in 1989 were lower than during past five years. It is stated that there has been no accident that would result in significant surface contamination. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radijacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. U trecem delu izvestaja navedeni su osnovni podaci o ukupnim kolicinama sakupljenog radioaktivnog materijala, ukupnoj velicini kontaminiranih i dekontaminiranih povrsina i broju dekontaminiranih predmeta. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila manja od 4,0 mSv a da su pojedinacna izlaganja radnog
Nonleptonic decays of 1/2+-baryons and pseudo-connected-line diagrams, 1
International Nuclear Information System (INIS)
Abe, Yoshikazu; Fujii, Kanji
1978-01-01
Under the SU(4)-20''-spurion dominance in nonleptonic weak decays, we investigate algebraic structures of the effective Hamiltonian H sub(eff) which describes the main features of the nonleptonic weak decays of ordinary baryons. When H sub(eff) is written by using 20'-baryon (1/2 + ) wave function of the form B sub(α)sup([βγ]), one can select out of H sub(eff) two terms which describe most simply the main features of the P-wave amplitudes for ordinary baryons. Only these terms are s-u dual in the sense of 'pseudo-connected-line diagrams' (pseudo-CLD's) obtained by writing CLD's with 4- and 4*-lines corresponding directly to the lower and the upper indices of B sub(α)sup([βγ]). By assuming Lee-Sugawara relation and s-u dual property of the P-wave amplitudes, various relations among ordinary and charmed baryon decays are derived. Comments on the parity-violating amplitudes are also given. (auth.)
Symmetry breaking of u(6/2j+1) supersymmetric models
International Nuclear Information System (INIS)
Baake, M.; Reinicke, P.
1985-09-01
In this paper, we present the group theory of models with broken u(6/2j+1) supersymmetry described by the chain u(6/2j+1) contains usub(B)(6) x usub(F)(2j+1) contains usub(B)(6) x spsub(F)(2j+1) contains ... contains sosub(B)(3) x susub(F)(2) contains susub(B+F)(2) which has recently been suggested for application to nuclear physics. We present all invariants that are needed for the construction of the general Hamiltonian for this model. (orig.)
Quantum critical spin-2 chain with emergent SU(3) symmetry.
Chen, Pochung; Xue, Zhi-Long; McCulloch, I P; Chung, Ming-Chiang; Huang, Chao-Chun; Yip, S-K
2015-04-10
We study the quantum critical phase of an SU(2) symmetric spin-2 chain obtained from spin-2 bosons in a one-dimensional lattice. We obtain the scaling of the finite-size energies and entanglement entropy by exact diagonalization and density-matrix renormalization group methods. From the numerical results of the energy spectra, central charge, and scaling dimension we identify the conformal field theory describing the whole critical phase to be the SU(3)_{1} Wess-Zumino-Witten model. We find that, while the Hamiltonian is only SU(2) invariant, in this critical phase there is an emergent SU(3) symmetry in the thermodynamic limit.
SU{sub 2} nonstandard bases: the case of mutually unbiased bases
Energy Technology Data Exchange (ETDEWEB)
Olivier, Albouy; Kibler, Maurice R. [Universite de Lyon, Institut de Physique Nucleaire de Lyon, Universite Lyon, CNRS/IN2P3, 43 bd du 11 novembre 1918, F-69622 Villeurbanne Cedex (France)
2007-02-15
This paper deals with bases in a finite-dimensional Hilbert space. Such a space can be realized as a subspace of the representation space of SU{sub 2} corresponding to an irreducible representation of SU{sub 2}. The representation theory of SU{sub 2} is reconsidered via the use of two truncated deformed oscillators. This leads to replace the familiar scheme [j{sub 2}, j{sub z}] by a scheme [j{sup 2}, v{sub ra}], where the two-parameter operator v{sub ra} is defined in the universal enveloping algebra of the Lie algebra su{sub 2}. The eigenvectors of the commuting set of operators [j{sup 2}, v{sub ra}] are adapted to a tower of chains SO{sub 3} includes C{sub 2j+1} (2j belongs to N{sup *}), where C{sub 2j+1} is the cyclic group of order 2j + 1. In the case where 2j + 1 is prime, the corresponding eigenvectors generate a complete set of mutually unbiased bases. Some useful relations on generalized quadratic Gauss sums are exposed in three appendices. (authors)
Bose-Fermi U(6/2j+1) supersymmetries and high-spin anomalies
International Nuclear Information System (INIS)
Morrison, I.; Jarvis, P.D.
1985-01-01
A supersymmetric extension of the interacting boson model (IBM) is constructed to describe high-spin anomalies in both even- and odd-mass spectra of the Hg, Pt region (190<=A<=200). Supergroup chains such as U(6/2j+1)containsOsp(6/2j+1)containsO(6)xSp(2j+1)... or U(6/2j+1)containsU(5/2j+1)xU(1)containsOsp(5/2j+1)... incorporate a single j-shell fermion in addition to the usual 's' and 'd' bosons (L=0 and L=2). The orthosympletic supergroup reflects the strong pairing force in the subspace of the fermion intruder level. The model agrees favourably with experiment and microscopic calculation. (orig.)
PT symmetry and a dynamical realization of the SU(1, 1) algebra
Banerjee, Rabin; Mukherjee, Pradip
2016-01-01
We show that the elementary modes of the planar harmonic oscillator can be quantized in the framework of quantum mechanics based on pseudo-hermitian Hamiltonians. These quantized modes are demonstrated to act as dynamical structures behind a new Jordan-Schwinger realization of the SU(1, 1) algebra. This analysis complements the conventional Jordan-Schwinger construction of the SU(2) algebra based on hermitian Hamiltonians of a doublet of oscillators.
SO(2N) and SU(N) gauge theories
Lau, Richard; Teper, Michael
2013-01-01
We present our preliminary results of SO(2N) gauge theories, approaching the large-N limit. SO(2N) theories may help us to understand QCD at finite chemical potential since there is an orbifold equivalence between SO(2N) and SU(N) gauge theories at large-N and SO(2N) theories do not have the sign problem present in QCD. We consider the string tensions, mass spectra, and deconfinement temperatures in the SO(2N) pure gauge theories in 2+1 dimensions, comparing them to their corresponding SU(N) ...
String tensions for lattice gauge theories in 2+1 dimensions
International Nuclear Information System (INIS)
Ambjoern, J.; Hey, A.J.G.; Otto, S.
1982-01-01
Compact U(1) and SU(2) lattice gauge theories in 3 euclidean dimensions are studied by standard Monte Carlo techniques. The question of extracting reliable string tensions from these theories is examined in detail, including a comparison of the Monte Carlo Wilson loop data with weak coupling predictions and a careful error analysis: our conclusions are rather different from those of previous investigations of these theories. In the case of U(1) theory, we find that only a tiny range of β values can possibly be relevant for extracting a string tension and we are unable to convincingly demonstrate the expected exponential dependence of the string tension on β. For the SU(2) theory we are able to determine, albeit with rather large errors, a string tension from a study of Wilson loops. (orig.)
Avoiding the secondary magnetic monopole problem in the inflation theories: The 75 of SU(5)
International Nuclear Information System (INIS)
Kim, C.W.; Kim, J.E.; Kim, J.S.
1985-01-01
A class of inflation models suffer from the secondary monopole problem which cannot be diluted by inflation. Using the Coleman-Weinberg potential for the 75-dimensional representation of SU(5), we suggest a group theoretical way to avoid the problem. It is shown that the vacuum, when released from the origin, starts to evolve and roll down along the Sp(4) . U(1) direction. It is noticed that the 75 provides an option for the vacuum to roll down to the SU(3) . SU(2) . U(1) vacuum without causing the secondary cosmological monopole problem. (orig.)
Park, Hyo-Young
2017-04-21
The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3\\' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins\\' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.
Park, Hyo-Young; Lee, Keh Chien; Jang, Yun Hee; Kim, SoonKap; Thu, May Phyo; Lee, Jeong Hwan; Kim, Jeong-Kook
2017-01-01
The Arabidopsis splicing factors, AtU2AF65, AtU2AF35, and AtSF1 shuttle between nuclei and cytoplasms. These proteins also move rapidly and continuously in the nuclei, and their movements are affected by ATP depletion. The U2AF65 proteins are splicing factors that interact with SF1 and U2AF35 proteins to promote U2snRNP for the recognition of the pre-mRNA 3' splice site during early spliceosome assembly. We have determined the subcellular localization and movement of these proteins' Arabidopsis homologs. It was found that Arabidopsis U2AF65 homologs, AtU2AF65a, and AtU2AF65b proteins interact with AtU2AF35a and AtU2AF35b, which are Arabidopsis U2AF35 homologs. We have examined the mobility of these proteins including AtSF1 using fluorescence recovery after photobleaching and fluorescence loss in photobleaching analyses. These proteins displayed dynamic movements in nuclei and their movements were affected by ATP depletion. We have also demonstrated that these proteins shuttle between nuclei and cytoplasms, suggesting that they may also function in cytoplasm. These results indicate that such splicing factors show very similar characteristics to their human counterparts, suggesting evolutionary conservation.
Coherent states for polynomial su(2) algebra
International Nuclear Information System (INIS)
Sadiq, Muhammad; Inomata, Akira
2007-01-01
A class of generalized coherent states is constructed for a polynomial su(2) algebra in a group-free manner. As a special case, the coherent states for the cubic su(2) algebra are discussed. The states so constructed reduce to the usual SU(2) coherent states in the linear limit
Balanced Hermitian metrics from SU(2)-structures
International Nuclear Information System (INIS)
Fernandez, M.; Tomassini, A.; Ugarte, L.; Villacampa, R.
2009-01-01
We study the intrinsic geometrical structure of hypersurfaces in six-manifolds carrying a balanced Hermitian SU(3)-structure, which we call balanced SU(2)-structure. We provide sufficient conditions, in terms of suitable evolution equations, which imply that a five-manifold with such structure can be isometrically embedded as a hypersurface in a balanced Hermitian SU(3)-manifold. Any five-dimensional compact nilmanifold has an invariant balanced SU(2)-structure, and we show how some of them can be evolved to give new explicit examples of balanced Hermitian SU(3)-structures. Moreover, for n=3,4, we present examples of compact solvmanifolds endowed with a balanced SU(n)-structure such that the corresponding Bismut connection has holonomy equal to SU(n)
U2AF1 mutations alter splice site recognition in hematological malignancies.
Ilagan, Janine O; Ramakrishnan, Aravind; Hayes, Brian; Murphy, Michele E; Zebari, Ahmad S; Bradley, Philip; Bradley, Robert K
2015-01-01
Whole-exome sequencing studies have identified common mutations affecting genes encoding components of the RNA splicing machinery in hematological malignancies. Here, we sought to determine how mutations affecting the 3' splice site recognition factor U2AF1 alter its normal role in RNA splicing. We find that U2AF1 mutations influence the similarity of splicing programs in leukemias, but do not give rise to widespread splicing failure. U2AF1 mutations cause differential splicing of hundreds of genes, affecting biological pathways such as DNA methylation (DNMT3B), X chromosome inactivation (H2AFY), the DNA damage response (ATR, FANCA), and apoptosis (CASP8). We show that U2AF1 mutations alter the preferred 3' splice site motif in patients, in cell culture, and in vitro. Mutations affecting the first and second zinc fingers give rise to different alterations in splice site preference and largely distinct downstream splicing programs. These allele-specific effects are consistent with a computationally predicted model of U2AF1 in complex with RNA. Our findings suggest that U2AF1 mutations contribute to pathogenesis by causing quantitative changes in splicing that affect diverse cellular pathways, and give insight into the normal function of U2AF1's zinc finger domains. © 2015 Ilagan et al.; Published by Cold Spring Harbor Laboratory Press.
Ocjena kultivara artičoke (Cynara scolymus L.) u trogodišnjem uzgoju
Bučan, Lovre; Perica, Slavko; Goreta, Smiljana
2000-01-01
Kultivari artičoke za višegodišnji uzgoj porijeklom iz Italije (Romanesco i Catanese), Francuske (Violetto di Provenza) te jedan domaći kultivar (Domaća viška) ispitani su u istraživanju provedenom na području Dalmacije od 1992. do 1995. godine. Sadnja je obavljena 25. kolovoza 1992. na razmak 1.0 m u redu i 1.2 m između redova. Fenofaze, odnos prema niskim temperaturama, rani prinos te komponente prinosa praćeni su kroz tri godine istraživanja. Fenofaze su započinjale u različito vrijeme ovi...
UTJECAJ RAZLIČITIH KRMIVA NA ABIOTIČKE PARAMETRE VODE U UZGOJU ŠARANSKIH MLADUNACA
Bogut, Ivan; Opačak, Andelko; Stević, Ivan
1992-01-01
Istraživanja utjecaja različitih krmiva na abiotičke parametre vode provedena su u devet ribnjaka ribnjačarstva Koprivna. U svaki ribnjak nasađena su 1, 3 milijuna ličinaka šarana, a podrašćivanje je trajalo 25 dana. U postupku 1. ličinke i mladunci su hranjeni starterom tvrtke »Boha, a postupku 2. hrana je sastavljena od 50% startera »Boha« i 50% suhoga pivskog kvasca, dok su a postupku 3. mladunci hranjeni isključivo pivskim kvascem. Pokusom je utvrđena interakcija navedenih krmiva i nji...
Duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory
International Nuclear Information System (INIS)
Dayi, Oemer F.; Kelleyane, Lara T.; Uelker, Kayhan
2005-01-01
A parent action is introduced to formulate (S-) dual of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory. Partition function for parent action in phase space is utilized to establish the equivalence of partition functions of the theories which this parent action produces. Thus, duality invariance of non-anticommutative N = 1/2 supersymmetric U(1) gauge theory follows. The results which we obtained are valid at tree level or equivalently at the first order in the nonanticommutativity parameter C μν
Independent SU(2)-loop variables and the reduced configuration space of SU(2)-lattice gauge theory
International Nuclear Information System (INIS)
Loll, R.
1992-01-01
We give a reduction procedure for SU(2)-trace variables and an explicit description of the reduced configuration sace of pure SU(2)-gauge theory on the hypercubic lattices in two, three and four dimensions, using an independent subset of the gauge-invariant Wilson loops. (orig.)
Strongest experimental constraints on SU(5)×U(1) supergravity models
Lopez, Jorge L.; Nanopoulos, D. V.; Park, Gye T.; Zichichi, A.
1994-01-01
We consider a class of well-motivated string-inspired flipped SU(5) supergravity models which include four supersymmetry-breaking scenarios: no-scale, strict no-scale, dilaton, and special dilaton, such that only three parameters are needed to describe all new phenomena (mt,tanβ,mg~). We show that the CERN LEP precise measurements of the electroweak parameters in the form of the ɛ1 variable and the CLEO II allowed range for B(b-->sγ) are at present the most important experimental constraints on this class of models. For mt>~155 (165) GeV, the ɛ1 constraint [at 90 (95)% C.L.] requires the presence of light charginos (m+/-χ1360 GeV, mq~sγ) constraint excludes a significant fraction of the otherwise allowed region in the (m+/-χ1,tanβ) plane (irrespective of the magnitude of the chargino mass), while future experimental improvements will result in decisive tests of these models. In light of the ɛ1 constraint, we conclude that the outlook for chargino and selectron detection at LEP II and at DESY HERA is quite favorable in this class of models.
Nonperturbative flipped SU(5) vacua in heterotic M-theory
Energy Technology Data Exchange (ETDEWEB)
Faraggi, Alon E. E-mail: faraggi@thphys.ox.ac.uk; Garavuso, Richard E-mail: garavuso@thphys.ox.ac.uk; Isidro, Jose M. E-mail: isidro@thphys.ox.ac.uk
2002-10-07
The evidence for neutrino masses in atmospheric and solar neutrino experiments provides further support for the embedding of the Standard Model fermions in the chiral 16 SO(10) representation. Such an embedding is afforded by the realistic free fermionic heterotic-string models. In this paper we advance the study of these string models toward a nonperturbative analysis by generalizing the work of Donagi, Pantev, Ovrut and Waldram from the case of G=SU(2n+1) to G=SU(2n) stable holomorphic vector bundles on elliptically fibered Calabi-Yau manifolds with fundamental group Z{sub 2}. We demonstrate existence of G=SU(4) solutions with three generations and SO(10) observable gauge group over Hirzebruch base surface, whereas we show that certain classes of del Pezzo base surface do not admit such solutions. The SO(10) symmetry is broken to SU(5)xU(1) by a Wilson line. The overlap with the realistic free fermionic heterotic-string models is discussed.
The 1+1 SU(2) Yang-Mills path integral
International Nuclear Information System (INIS)
Swanson, Mark S
2004-01-01
The path integral for SU(2) invariant two-dimensional Yang-Mills theory is recast in terms of the chromoelectric field strength by integrating the gauge fields from the theory. Implementing Gauss's law as a constraint in this process induces a topological term in the action that is no longer invariant under large gauge transformations. For the case that the partition function is considered over a circular spatial degree of freedom, it is shown that the effective action of the path integral is quantum mechanically WKB exact and localizes onto a set of chromoelectric zero modes satisfying antiperiodic boundary conditions. Summing over the zero modes yields a partition function that can be reexpressed using the Poisson resummation technique, allowing an easy determination of the energy spectrum, which is found to be identical to that given by other approaches
Low scale composite Higgs model and 1.8 ˜2 TeV diboson excess
Bian, Ligong; Liu, Da; Shu, Jing
2018-04-01
We consider a simple solution to explain the recent diboson excess observed by ATLAS and CMS Collaborations in models with custodial symmetry SU(2)L × SU(2)R → SU(2)c. The SU(2)L triplet vector boson ρ with mass range of 1.8 ˜ 2 TeV would be produced through the Drell-Yan process with sizable diboson decay branching to account for the excess. The other SU(2)L × SU(2)R bidoublet axial vector boson a would cancel all deviations of electroweak obervables induced by ρ even if the SM fermions mix with some heavy vector-like (composite) fermions which couple to ρ (“nonuniversally partially composite”), therefore allows arbitrary couplings between each SM fermion and ρ. We present our model in the “General Composite Higgs” framework with SO(5) × U(1)X → SO(4) × U(1)X breaking at scale f and demand the first Weinberg sum rule and positive gauge boson form factors as the theoretical constraints. We find that our model can fit the diboson excess very well if the left-handed SM light quarks, charged leptons and tops have zero, zero/moderately small and moderate/large composite components for reasonable values of gρ and f. The correlation between tree level S parameter and the h → Zγ suggest a large a contribution to h → Zγ and it is indeed a 𝒪(1) effect in our parameter space which provides a strong hint for our scenario if this diboson excess is confirmed by the 13 ˜ 14 TeV LHC Run II.
UTC(SU) and EOP(SU) - the only legal reference frames of Russian Federation
Koshelyaevsky, Nikolay B.; Blinov, Igor Yu; Pasynok, Sergey L.
2015-08-01
There are two legal time reference frames in Russian Federation. UTC(SU) deals with atomic time and play a role of reference for legal timing through the whole country. The other one, EOP(SU), deals with Earth's orientation parameters and provides the official EOP data for scientific, technical and metrological applications in Russia.The atomic time is based on two essential hardware components: primary Cs fountain standards and ensemble of continuously operating H-masers as a time unit/time scale keeper. Basing on H-maser intercomparison system data, regular H-maser frequency calibration against Cs standards and time algorithm autonomous TA(SU) time scale is maintained by the Main Metrological Center. Since 2013 time unit in TA(SU) is the second (SU) reproduced independently by VNIIFTRI Cs primary standards in accordance to it’s definition in the SI. UTC(SU) is relied on TA(SU) and steering to UTC basing on TWSTFT/GNSS time link data. As a result TA(SU) stability level relative to TT considerably exceeds 1×10-15 for sample time one month and more, RMS[UTC-UTC(SU)] ≤ 3 ns for the period of 2013-2015. UTC(SU) is broadcasted by different national means such as specialized radio and TV stations, NTP servers and GLONASS. Signals of Russian radio stations contains DUT1 and dUT1 values at 0.1s and 0.02s resolution respectively.The definitive EOP(SU) are calculated by the Main Metrological Center basing on composition of the eight independent individual EOP data streams delivered by four Russian analysis centers: VNIIFTRI, Institute of Applied Astronomy, Information-Analytical Center of Russian Space Agency and Analysis Center of Russian Space Agency. The accuracy of ultra-rapid EOP values for 2014 is estimated ≤ 0.0006" for polar motion, ≤ 70 microseconds for UT1-UTC and ≤ 0.0003" for celestial pole offsets respectively.The other VNIIFTRI EOP activities can be grouped in three basic directions:- arrangement and carrying out GNSS and SLR observations at five
VG2 URA TRAJECTORY DERIVED SUMM U1 COORDS 48SEC V1.0
National Aeronautics and Space Administration — This dataset contains Voyager 2 spacecraft position vectors relative to Uranus in minus U1 coordinates. The U1 or Uranus West Longitude System coordinate system is a...
SU (2) with fundamental fermions and scalars
DEFF Research Database (Denmark)
Hansen, Martin; Janowski, Tadeusz; Pica, Claudio
2018-01-01
We present preliminary results on the lattice simulation of an SU(2) gauge theory with two fermion flavors and one strongly interacting scalar field, all in the fundamental representation of SU(2). The motivation for this study comes from the recent proposal of "fundamental" partial compositeness...... the properties of light meson resonances previously obtained for the SU(2) model. Preprint: CP3-Origins-2017-047 DNRF90...
Serum suPAR in patients with FSGS: trash or treasure?
Maas, Rutger J H; Deegens, Jeroen K J; Wetzels, Jack F M
2013-07-01
The urokinase-type plasminogen activator receptor (uPAR) has important functions in cell migration. uPAR can be shed from the cell membrane resulting in soluble uPAR (suPAR). Further cleavage gives rise to shorter fragments with largely unknown functions. Recent studies have demonstrated that both overexpression of uPAR on podocytes and the administration of suPAR cause proteinuria in mice. The common pathogenic mechanism involves the activation of podocyte β3-integrin. Increased activation of β3-integrin is also observed in patients with focal and segmental glomerulosclerosis (FSGS). These observations form the basis for the hypothesis that suPAR may be the circulating factor causing FSGS. A recent study fosters this idea by demonstrating increased suPAR levels in the serum of patients with FSGS and reporting an association with recurrence after transplantation and response to plasmapheresis. However, this study was heavily biased, and subsequent studies have given conflicting results. Although the experimental work is very suggestive, at present there is no proof that any known human suPAR fragment causes FSGS in humans. We therefore suggest that the measurement of suPAR using currently available assays has absolutely no value at the present time in decision-making in routine clinical practice.
International Nuclear Information System (INIS)
Dahmen, B.
1994-12-01
A recently proposed method for a strong coupling analysis of scattering phenomena in hamiltonian lattice field theories is applied to the SU(2) Yang-Mills model in (2 + 1) dimensions. The calculation is performed up to second order in the hopping parameter. All relevant quantities that characterize the collision between the lightest glueballs in the elastic region - cross section, phase shifts, resonance parameters - are determined. (orig.)
Study of infrared emission spectroscopy for the B1Δg–A1Πu and B′1Σg+–A1Πu systems of C2
International Nuclear Information System (INIS)
Chen, Wang; Kawaguchi, Kentarou; Tang, Jian; Bernath, Peter F.
2016-01-01
Thirteen bands for the B 1 Δ g –A 1 Π u system and eleven bands for the B ′1 Σ g + –A 1 Π u system of C 2 were identified in the Fourier transform infrared emission spectra of hydrocarbon discharges. The B ′1 Σ g + v = 4 and the B 1 Δ g v = 6, 7, and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B 1 Δ g –A 1 Π u system except for a small perturbation in the B 1 Δ g v = 6 level. The calculated rovibrational term energies up to B 1 Δ g v = 12 showed that the level crossing between the B 1 Δ g and d 3 Π g states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen forbidden transitions of the B 1 Δ g –a 3 Π u transition were identified and the off-diagonal spin-orbit interaction constant A dB between d 3 Π g and B 1 Δ g was derived as 8.3(1) cm −1 . For the B ′1 Σ g + –A 1 Π u system, only individual band analyses for each vibrational level in the B′ 1 Σ g + state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ω e x e is anomalously small (nearly zero). Inspection of the RKR (Rydberg-Klein-Rees) potential curves for the B ′1 Σ g + and X 1 Σ g + states revealed that an avoided crossing or nearly avoided crossing may occur around 30 000 cm −1 , which is responsible for the anomalous molecular constants in these two states
On Euclidean connections for su(1,1), suq(1,1) and the algebraic approach to scattering
International Nuclear Information System (INIS)
Ionescu, R.A.
1994-11-01
We obtain a general Euclidean connection for su(1,1) and suq(1,1) algebras. Our Euclidean connection allows an algebraic derivation for the S matrix. These algebraic S matrices reduce to the known ones in suitable circumstances. Also, we obtain a map between su(1,1) and su q (1,1) representations. (author). 8 refs
Energy Technology Data Exchange (ETDEWEB)
Espinosa P, G.; Estrada P, C.E. [Universidad Autonoma Metropolitana-Iztapalapa, 09000 Mexico D.F. (Mexico); Nunez C, A.; Amador G, R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Mexico D.F. (Mexico)
2001-07-01
The computer code ANESLI-1 developed by the CNSNS and UAM-I, has the main goal of making stability analysis of nuclear reactors of the BWR type, more specifically, the reactors of the U1 and U2 of the CNLV. However it can be used for another kind of applications. Its capacity of real time simulator, allows the prediction of operational transients, and conditions of dynamic steady states. ANESLI-1 was developed under a modular scheme, which allows to extend or/and to improve its scope. The lineal stability analysis predicts the instabilities produced by the wave density phenomenon. (Author)
Fabrication of thin SU-8 cantilevers: initial bending, release and time stability
DEFF Research Database (Denmark)
Keller, Stephan Urs; Haefliger, D.; Boisen, Anja
2010-01-01
SU-8 cantilevers with a thickness of 2 mu m were fabricated using a dry release method and two steps of SU-8 photolithography. The processing of the thin SU-8 film defining the cantilevers was experimentally optimized to achieve low initial bending due to residual stress gradients. In parallel......, the rotational deformation at the clamping point allowed a qualitative assessment of the device release from the fluorocarbon-coated substrate. The change of these parameters during several months of storage at ambient temperature was investigated in detail. The introduction of a long hard bake in an oven after...... development of the thin SU-8 film resulted in reduced cantilever bending due to removal of residual stress gradients. Further, improved time-stability of the devices was achieved due to the enhanced cross-linking of the polymer. A post-exposure bake at a temperature T-PEB = 50 degrees C followed by a hard...
Dicty_cDB: Contig-U15814-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available id... 54 0.030 1 ( EU435873 ) Parapalaeosepsis plebeia voucher su35 cytochrome ... 54 0.030 1 ( EU435865 ) Dicranosepsis... unipilosa voucher su24 cytochrome o... 54 0.030 1 ( EU435863 ) Dicranosepsis olfactoria voucher... su22 cytochrome ... 54 0.030 1 ( EU435861 ) Dicranosepsis hamata voucher su20 cy...tochrome oxid... 54 0.030 1 ( EU435858 ) Dicranosepsis crinita voucher su17 cytochrome oxi... 54 0.030 1 ( EU435856 ) Dicranosepsis...use DNA sequence from clone RP23-373N5 on chrom... 52 0.12 1 ( EU435862 ) Dicranosepsis javanica voucher su2
International Nuclear Information System (INIS)
Akopyan, M E; Baturo, V V; Lukashov, S S; Poretsky, S A; Pravilov, A M
2015-01-01
The stepwise three-step three-color laser population of the I 2 (β1 g , ν β , J β ) rovibronic states via the B0 u + , ν B , J B rovibronic states and rovibronic levels of the 1 u (bb) and 0 g + (bb) states mixed by hyperfine interaction is used for determination of rovibronic level energies of the weakly bound I 2 (1 u (bb)) state. Dunham coefficients of the state, Y i0 (i = 0–3), Y i1 (i = 0–2), Y 02 and Y 12 for the v 1 u = 1–5, 8, 10, 15 and J 1 u ≈ 9–87 ranges, the dissociation energy of the state, D e , and equilibrium I–I distance, R e , as well as the potential energy curve are determined. There are aperiodicities in the excitation spectrum corresponding to the β, ν β = 23, J β ← 1 u (bb), ν 1u = 4, 5, J 1u progressions in the I 2 + Rg = He, Ar mixture, namely, a great number of lines which do not coincide with the R or P line progressions. Their positions conflict with the ΔJ-even selection rule. Furthermore, they do not correspond to the ΔJ-odd progression. (paper)
Contraction of graded su(2) algebra
International Nuclear Information System (INIS)
Patra, M.K.; Tripathy, K.C.
1989-01-01
The Inoenu-Wigner contraction scheme is extended to Lie superalgebras. The structure and representations of extended BRS algebra are obtained from contraction of the graded su(2) algebra. From cohomological consideration, we demonstrate that the graded su(2) algebra is the only superalgebra which, on contraction, yields the full BRS algebra. (orig.)
Paramagnetic properties of the (U1-xTbx)Co2Ge2 solid solutions
International Nuclear Information System (INIS)
Kuznietz, Moshe; Pinto, Haim; Ettedgui, Hanania
1995-01-01
Polycrystalline (U 1-x Tb x )Co 2 Ge 2 solid solutions have the ThCr 2 Si 2 -type crystal structure and order antiferromagnetically. AC-susceptibility at 80-295 K yields paramagnetic Curie temperatures θ=-350±50, -15±5, -50±15, -12±5, and -80±5 K, and effective magnetic moments μ eff =4.5, 5.9, 7.3, 8.5, and 12.0 (±0.5)μ B , for samples with x=0, 0.25, 0.50, 0.75 and 1, respectively. The high μ eff values are related to occurrence of paramagnetic moments on U, Tb and Co, of which only U and Tb moments order magnetically. ((orig.))
O(5)sub(L)xO(5)sub(R)xU(1)sub(V) electro-weak gauge theory and the neutrino pairing mechanism
International Nuclear Information System (INIS)
Samiullah, M.; Mubarak, A.
1981-08-01
The possibility of using the group O(5)sub(L)xO(5)sub(R)xU(1)sub(V) for unifying the weak and electromagnetic interactions is studied. We are led to an anomaly free theory. Potentially the theory has the advantage of incorporating the previous results. For example, all the results of O(5)sub(L)xU(1) studies are, as a special case, obtainable at low energies. In the process of breaking the symmetry down to Weinberg-Salam theory at the level of SU(2)sub(L)xSU(2)sub(R)xU(1)sub(V), we have employed the neutrino proposed by Mannheim. We have been able to reproduce several of the conventional electroweak aspects such as the parity violation in both the lepton and charged quark sectors, Weinberg mixing pattern in the neutral current sector while keeping the left-handed neutrinos massless. All the salient features of low energy phenomenology are shown to follow. (author)
Energy Technology Data Exchange (ETDEWEB)
Almen, E; Holmqvist, B; Wiedling, T
1971-09-15
The shapes of fission neutron spectra are of interest for power reactor calculations. Recently it has been suggested that the neutron induced fission spectrum of 235U may be harder than was earlier assumed. For this reason measurements of the neutron spectra of some fissile isotopes are in progress at our laboratory. This report will present results from studies of the energy spectra of the neutrons emitted in the neutron induced fission of 235U and 238U. The measurements were performed at an incident neutron energy of 0.95 MeV for 235U and at energies of 1.35 and 2.02 MeV for 238U using time-of-flight techniques. The time-of-flight spectra were only analysed at energies higher than those of the incident neutrons and up to about 10 MeV. Corrections for neutron attenuation in the uranium samples were calculated using a Monte Carlo program. The corrected fission neutron spectra were fitted to Maxwellian temperature distributions. For 235U a temperature of 1.27 +- 0.01 MeV gives the best fit to the experimental data and for 238U the corresponding values are 1.29 +- 0.03 MeV at 1.35 MeV and 1.29 +- 0.02 MeV at 2.02 MeV
International Nuclear Information System (INIS)
Jaramillo, Alejandro; Sanchez, Luis A.
2011-01-01
Extensions of the standard model with gauge symmetry SU(3) c x SU(4) L x U(1) X (3-4-1 extensions) where anomaly cancellation takes place between the fermion families (three-family models) predict the existence of two new heavy neutral gauge bosons which transmit flavor changing neutral currents at tree level. In this work, in the context of a three-family 3-4-1 extension which does not contain particles with exotic electric charges, we study the constraints coming from neutral meson mixing on the parameters of the extension associated to tree-level flavor changing neutral current effects. Taking into account experimental measurements of observables related to K and B meson mixing and including new CP-violating phases, we study the resulting bounds for angles and phases in the mixing matrix for the down-quark sector, as well as the implications of these bounds for the modifications in the amplitudes of the clean rare decays K + →π + νν, K L →π 0 νν, K L →π 0 l + l - (l=e, μ) and B d/s →μ + μ - .
International Nuclear Information System (INIS)
Moon, M.W.; Hsi, R.S.P.
1992-01-01
(R)-5-(diallylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]quinolin-2(1H)-one (12b) was prepared in 9% overall yield from 3-aminoquinoline. Reaction of 12b in ethyl acetate with tritium gas in presence of a 5% platinum on carbon catalyst afforded a mixture of (R)-5-(di[2,3- 3 H 2 ]propylamino)-5,6-dihydro-4H-imidazo[4,5,1-ij]-quinolin-2(1H)-one ([ 3 H]U-86170, 69 Ci/mmol) and (R)-5-([2,3- 3 H 2 ]-propylamino)5,6-dihydro-4H-imidazo-[4,5,1-ij]quinolin-2(1H)-one ( [ 3 H]U-91356, 34 Ci/mmol) which was separated by preparative reverse-phase chromatography. U-86170 and U-91356 are potent dopamine D2 agonists. The labelled compounds are useful for drug disposition studies. [ 3 H]U-86170 is also useful as a dopamine D2 agonist radioligand for receptor binding studies. (author)
Thermodynamics of SU(2 quantum Yang-Mills theory and CMB anomalies
Directory of Open Access Journals (Sweden)
Hofmann Ralf
2014-04-01
Full Text Available A brief review of effective SU(2 Yang-Mills thermodynamics in the deconfining phase is given, including the construction of the thermal ground-state estimate in terms of an inert, adjoint scalar field φ, based on non-propagating (antiselfdual field configurations of topological charge unity. We also discuss kinematic constraints on interacting propagating gauge fields implied by the according spatial coarse-graining, and we explain why the screening physics of an SU(2 photon is subject to an electric-magnetically dual interpretation. This argument relies on the fact that only (anticalorons of scale parameter ρ ∼ |φ|−1 contribute to the coarse-graining required for thermal-ground-state emergence at temperature T. Thus, use of the effective gauge coupling e in the (anticaloron action is justified, yielding the value ħ for the latter at almost all temperatures. As a consequence, the indeterministic transition of initial to final plane waves caused by an effective, pointlike vertex is fundamentally mediated in Euclidean time by a single (anticaloron being part of the thermal ground state. Next, we elucidate how a low-frequency excess of line temperature in the Cosmic Microwave Background (CMB determines the value of the critical temperature of the deconfining-preconfining phase transition of an SU(2 Yang-Mills theory postulated to describe photon propagation, and we describe how, starting at a redshift of about unity, SU(2 photons collectively work 3D temperature depressions into the CMB. Upon projection along a line of sight, a given depression influences the present CMB sky in a cosmologically local way, possibly explaining the large-angle anomalies confirmed recently by the Planck collaboration. Finally, six relativistic polarisations residing in the SU(2 vector modes roughly match the number of degrees of freedom in cosmic neutrinos (Planck which would disqualify the latter as radiation. Indeed, if interpreted as single center
Thermodynamics of SU(2) quantum Yang-Mills theory and CMB anomalies
Hofmann, Ralf
2014-04-01
A brief review of effective SU(2) Yang-Mills thermodynamics in the deconfining phase is given, including the construction of the thermal ground-state estimate in terms of an inert, adjoint scalar field φ, based on non-propagating (anti)selfdual field configurations of topological charge unity. We also discuss kinematic constraints on interacting propagating gauge fields implied by the according spatial coarse-graining, and we explain why the screening physics of an SU(2) photon is subject to an electric-magnetically dual interpretation. This argument relies on the fact that only (anti)calorons of scale parameter ρ ˜ |φ|-1 contribute to the coarse-graining required for thermal-ground-state emergence at temperature T. Thus, use of the effective gauge coupling e in the (anti)caloron action is justified, yielding the value ħ for the latter at almost all temperatures. As a consequence, the indeterministic transition of initial to final plane waves caused by an effective, pointlike vertex is fundamentally mediated in Euclidean time by a single (anti)caloron being part of the thermal ground state. Next, we elucidate how a low-frequency excess of line temperature in the Cosmic Microwave Background (CMB) determines the value of the critical temperature of the deconfining-preconfining phase transition of an SU(2) Yang-Mills theory postulated to describe photon propagation, and we describe how, starting at a redshift of about unity, SU(2) photons collectively work 3D temperature depressions into the CMB. Upon projection along a line of sight, a given depression influences the present CMB sky in a cosmologically local way, possibly explaining the large-angle anomalies confirmed recently by the Planck collaboration. Finally, six relativistic polarisations residing in the SU(2) vector modes roughly match the number of degrees of freedom in cosmic neutrinos (Planck) which would disqualify the latter as radiation. Indeed, if interpreted as single center-vortex loops in
International Nuclear Information System (INIS)
Fradkin, E.S.; Linetsky, V.Ya.
1990-10-01
The irreducible Racah basis for SU(N + 1|N) is introduced. An analytic continuation with respect to N leads to infinite-dimensional superalgebras su(υ + 1|υ). Large υ limit su(∞ + 1|∞) is calculated. The higher spin Sugawara construction leading to generalizations of the Virasoro algebra with infinite tower of higher spin currents is proposed and related WZNW and Toda models as well as possible applications in string theory are discussed. (author). 32 refs
SU(6) symmetry and the quark forces
International Nuclear Information System (INIS)
Bartnik, E.A.; Namyslowski, J.M.
1984-01-01
The short distance forces between 3 valence quarks in the proton are investigated in perturbative QCD formulated on the light cone. These forces are the driving terms in the Brodsky-Lepage type evolution equation for the partially decomposed distribution amplitudes. The one-gluon exchange force, which is the lowest order force in the running coupling constant αsub(s) retains the SU(6) symmetry, while the αsub(s) 2 -order force, corresponding to one Coulomb gluon and one transverse gluon, breaks the SU(6) symmetry. The latter force contributes to the deviation from 1/2 of the d/u ratio for the proton, observed experimentally. In the kinematical domain of one fast quark, the αsub(s) 2 -order force gives the leading (1-x) 3 behaviour of the deep inelastic structure function F 2 (x), in contrast to the αsub(s)-order force, which gives (1-x) 5 , for xapprox.=1. (orig.)
Nuclear matter saturation in a U(1) circle-times chiral model
International Nuclear Information System (INIS)
Lin, Wei
1989-01-01
The mean-field approximation in the U(1) circle-times chiral model for nuclear matter maturation is reviewed. Results show that it cannot be the correct saturation mechanism. It is argued that in this chiral model, other than the fact the ω mass can depend on the density of nuclear matter, saturation is still quite like the Walecka picture. 16 refs., 3 figs
CKM and PMNS mixing matrices from discrete subgroups of SU(2)
International Nuclear Information System (INIS)
Potter, Franklin
2015-01-01
Remaining within the realm of the Standard Model(SM) local gauge group, this first principles derivation of both the PMNS and CKM matrices utilizes quaternion generators of the three discrete (i.e., finite) binary rotational subgroups of SU(2) called [3,3,2], [4,3,2], and [5,3,2] for three lepton families in R 3 and four related discrete binary rotational subgroups [3,3,3], [4,3,3], [3,4,3], and [5,3,3] represented by four quark families in R 4 . The traditional 3x3 CKM matrix is extracted as a submatrix of the 4x4 CKM4 matrix. If these two additional quarks b' and t' of a 4th quark family exist, there is the possibility that the SM lagrangian may apply all the way down to the Planck scale. There are then numerous other important consequences. The Weinberg angle is derived using these same quaternion generators, and the triangle anomaly cancellation is satisfied even though there is an obvious mismatch of three lepton families to four quark families. In a discrete space, one can also use these generators to derive a unique connection from the electroweak local gauge group SU(2) L x U(1) Y acting in R 4 to the discrete group Weyl E 8 in R 8 . By considering Lorentz transformations in discrete (3,1)-D spacetime, one obtains another Weyl E 8 discrete symmetry group in R 8 , so that the combined symmetry is Weyl E 8 x Weyl E 8 = 'discrete' SO(9,1) in 10-D spacetime. This unique connection is in direct contrast to the 10 500 possible connections for superstring theory! (paper)
Avoiding domain wall problem in SU(N) grand unified theories
International Nuclear Information System (INIS)
Fujimoto, Y.; Zhiyong, Z.
1982-08-01
We look for the possibility of embedding the discrete sub-group of U(1)-Pecci-Quinn symmetry into the continuous one to avoid the domain wall problem. We find, within some restricted context, among various SU(N) models only one-family SU(5) and SU(6). (author)
Kotoy, Sergei Anatolievich
This dissertation consists of two closely related analyses, both of which were performed using data collected with the CLEO II detector at the Cornell Electron Storage Ring. In the first analysis, using the world largest data sample of Υ(2 S) events, we have investigated the hadronic transitions between the Υ(2S) and the Υ(1S), i.e. decays of the Υ(2S) into the Υ(1S), plus a pair of pions ( p+p- or p0p0 ), a single η or a single p0 . The dipion transitions U(2S)-->U( 1S)pp were studied most closely, by using two different techniques: ``exclusive'' and ``inclusive''. In these measurements we determine the U(2S)-->U( 1S)pp branching ratios, and, by combining the exclusive and inclusive results, we derive the Υ(1S), leptonic branching ratios Bee and Bmm . Parameters of the ππ system in the dipion transitions (dipion invariant mass spectra, angular distributions) were analyzed and found to be consistent with current theoretical models. Lastly, we searched for the η and single π0 transitions and obtained upper limits on the branching ratios B(U(2S) -->U(1S)h ) and B(U(2S) -->U(1S)p 0) . In the second analysis, the data collected at the center of mass energies near the Υ(4S) were used to search for the dipion transition between pairs of Υ resonances. As a result of this search, we established upper limits on the branching ratios of the dipion transitions post='par'>p+p- and U(4S)-->U( 1S)p+p- , and measured the cross-sections for the radiative production of Υ(3 S) and Υ(2S) resonances e+e--->U(nS) g at the center of mass energies of Ecm = 10.58 GeV and Ecm = 10.52 GeV.
International Nuclear Information System (INIS)
Christensen, J.; Damgaard, P.H.
1991-01-01
The finite-temperature deconfinement phase transition of SU(2) lattice gauge theory in (2+1) dimensions is studied by Monte Carlo methods. Comparison is made with the expected form of correlation functions on both sides of the critical point. The critical behavior is compared with expectations based on universality arguments. Attempts are made to extract unbiased values of critical exponents on several lattices sizes. The behavior of Polyakov loops in higher representations of the gauge group is studied close to the phase transition. (orig.)
Choi, Hyun-Woo; Kim, Hye-Ran; Baek, Hee-Jo; Kook, Hoon; Cho, Duck; Shin, Jong-Hee; Suh, Soon-Pal; Ryang, Dong-Wook; Shin, Myung-Geun
2015-01-01
Recurrent somatic SET-binding protein 1 (SETBP1) and splicing pathway gene mutations have recently been found in atypical chronic myeloid leukemia and other hematologic malignancies. These mutations have been comprehensively analyzed in adult AML, but not in childhood AML. We investigated possible alteration of the SETBP1, splicing factor 3B subunit 1 (SF3B1), U2 small nuclear RNA auxiliary factor 1 (U2AF1), and serine/arginine-rich splicing factor 2 (SRSF2) genes in childhood AML. Cytogenetic and molecular analyses were performed to reveal chromosomal and genetic alterations. Sequence alterations in the SETBP1, SF3B1, U2AF1, and SRSF2 genes were examined by using direct sequencing in a cohort of 53 childhood AML patients. Childhood AML patients did not harbor any recurrent SETBP1 gene mutations, although our study did identify a synonymous mutation in one patient. None of the previously reported aberrations in the mutational hotspot of SF3B1, U2AF1, and SRSF2 were identified in any of the 53 patients. Alterations of the SETBP1 gene or SF3B1, U2AF1, and SRSF2 genes are not common genetic events in childhood AML, implying that the mutations are unlikely to exert a driver effect in myeloid leukemogenesis during childhood.
Metabolic impact of anti-angiogenic agents on U87 glioma cells.
Directory of Open Access Journals (Sweden)
Tanja Mesti
Full Text Available BACKGROUND: Glioma cells not only secrete high levels of vascular endothelial growth factor (VEGF but also express VEGF receptors (VEGFR, supporting the existence of an autocrine loop. The direct impact on glioma cells metabolism of drugs targeting the VEGF pathway, such as Bevacizumab (Bev or VEGFR Tyrosine Kinase Inhibitor (TKI, is poorly known. MATERIAL AND METHODS: U87 cells were treated with Bev or SU1498, a selective VEGFR2 TKI. VEGFR expression was checked with FACS flow cytometry and Quantitative Real-Time PCR. VEGF secretion into the medium was assessed with an ELISA kit. Metabolomic studies on cells were performed using High Resolution Magic Angle Spinning Spectroscopy (HR-MAS. RESULTS: U87 cells secreted VEGF and expressed low level of VEGFR2, but no detectable VEGFR1. Exposure to SU1498, but not Bev, significantly impacted cell proliferation and apoptosis. Metabolomic studies with HR MAS showed that Bev had no significant effect on cell metabolism, while SU1498 induced a marked increase in lipids and a decrease in glycerophosphocholine. Accordingly, accumulation of lipid droplets was seen in the cytoplasm of SU1498-treated U87 cells. CONCLUSION: Although both drugs target the VEGF pathway, only SU1498 showed a clear impact on cell proliferation, cell morphology and metabolism. Bevacizumab is thus less likely to modify glioma cells phenotype due to a direct therapeutic pressure on the VEGF autocrine loop. In patients treated with VEGFR TKI, monitoring lipids with magnetic resonance spectroscopic (MRS might be a valuable marker to assess drug cytotoxicity.
Phenomenology with supersymmetric flipped SU(6)
Energy Technology Data Exchange (ETDEWEB)
Shafi, Qaisar E-mail: shafi@bartol.udel.edu; Tavartkiladze, Zurab E-mail: tavzur@axpfe1.fe.infn.it
1999-07-12
The supersymmetric flipped SU(6) x U(1) gauge symmetry can arise through compactification of the ten-dimensional E{sub 8} x E{sub 8} superstring theory. We show how realistic phenomenology can emerge from this theory by supplementing it with the symmetry R x U(1), where R denotes a discrete 'R'-symmetry. The well-known doublet-triplet splitting problem is resolved to 'all orders' via the pseudo-Goldstone mechanism, and the GUT scale arises from an interplay of the Planck and supersymmetry breaking scales. The symmetry R x U(1) is also important for understanding the fermion mass hierarchies as well as the magnitudes of the CKM matrix elements. Furthermore, the well-known MSSM parameter tan {beta} is estimated to be of order unity, while the proton lifetime ({tau}{sub p} {approx} 10{sup 2}{tau}{sub pSU(5)}) is consistent with observations. Depending on some parameters, p {yields} K{mu}{sup +} can be the dominant decay mode. Finally, the observed solar and atmospheric neutrino 'anomalies' requir us to introduce a 'sterile' neutrino state. Remarkably, the R x U(1) symmetry protects it from becoming heavy, so that maximal angle {nu}{sub {mu}} oscillations into a sterile state can explain the atmospheric anomaly, while the solar neutrino puzzle is resolved via the small angle {nu}{sub e} - {nu}{sub {tau}} MSW oscillations. The existence of some ({approx} 15-20% of critical energy density) neutrino hot dark matter is also predicted.
Directory of Open Access Journals (Sweden)
Wei Cui
Full Text Available SU5416 was originally designed as a potent and selective inhibitor of vascular endothelial growth factor receptor-2 (VEGFR-2 for cancer therapy. In this study, we have found for the first time that SU5416 unexpectedly prevented 1-methyl-4-phenylpyridinium ion (MPP(+-induced neuronal apoptosis in cerebellar granule neurons, and decreased 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP-induced loss of dopaminergic neurons and impairment of swimming behavior in zebrafish in a concentration-dependent manner. However, VEGFR-2 kinase inhibitor II, another specific VEGFR-2 inhibitor, failed to reverse neurotoxicity at the concentration exhibiting anti-angiogenic activity, strongly suggesting that the neuroprotective effect of SU5416 is independent from its anti-angiogenic action. SU5416 potently reversed MPP(+-increased intracellular nitric oxide level with an efficacy similar to 7-nitroindazole, a specific neuronal nitric oxide synthase (nNOS inhibitor. Western blotting analysis showed that SU5416 reduced the elevation of nNOS protein expression induced by MPP(+. Furthermore, SU5416 directly inhibited the enzyme activity of rat cerebellum nNOS with an IC(50 value of 22.7 µM. In addition, knock-down of nNOS expression using short hairpin RNA (shRNA abolished the neuroprotective effects of SU5416 against MPP(+-induced neuronal loss. Our results strongly demonstrate that SU5416 might exert its unexpected neuroprotective effects by concurrently reducing nNOS protein expression and directly inhibiting nNOS enzyme activity. In view of the capability of SU5416 to cross the blood-brain barrier and the safety for human use, our findings further indicate that SU5416 might be a novel drug candidate for neurodegenerative disorders, particularly those associated with NO-mediated neurotoxicity.
Energy Technology Data Exchange (ETDEWEB)
Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)]. E-mail: jortega@dip.ulpgc.es; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)
2007-05-15
The experimental data of excess molar enthalpies H{sub m}{sup E} and excess molar volumes V{sub m}{sup E} are presented for a set of 25 binary mixtures comprised of the first five methyl esters C{sub u-1}H{sub 2u-1}COOCH{sub 3} (u=1 to 5) and five {alpha},{omega}-dichloroalkanes, ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl (v=2 to 6), obtained at a temperature of 298.15K and atmospheric pressure. Except for the mixtures with u=1 and v=2 to 6, which are all endothermic and with u=5 and v=2 to 6, which are all exothermic, the others present net endo/exothermic effects and these mixing effects evolve quasiregularly, from endothermic to exothermic, depending on the dichloroalkane present. However, the V{sub m}{sup E} are positive in most mixtures except for those corresponding to u=4,5 and v=5,6, which present contraction effects. These results indicate a set of specific interactions with simultaneous effects for V{sub m}{sup E} of expansion/contraction and for exothermic/endothermic H{sub m}{sup E} for this set of mixtures. The change in V{sub m}{sup E} with the chain length of the compounds is irregular. To achieve a good application of the UNIFAC model using the version of Dang and Tassios, parameters of the ester (G)/dichloride (G') interaction were calculated again, making a distinction, during its application, dependent on the acid part of the ester u. Hence, interaction parameters are presented as a function of u, and of the dichloroalkane chain length v. The most appropriate general expression was of the type:a{sub G/G{sup '}}={phi}(u,v)={sigma}sub(i=0)sup(n)a{sub i-1}u{sup i-1}+{sigma}sub(i=0= )sup(n)b{sub i-1}v{sup i-1}and with this proposal good estimations of enthalpies were obtained with the UNIFAC model.
7 CFR 51.2541 - U.S. Fancy, U.S. Extra No. 1, U.S. No. 1 And U.S. Select Grades.
2010-01-01
... PRODUCTS 1,2 (INSPECTION, CERTIFICATION, AND STANDARDS) United States Standards for Grades of Pistachio.... Fancy,” “U.S. Extra No. 1,” “U.S. No. 1,” and “U.S. Select” consists of pistachio nuts in the shell...
Electroweak radiative corrections in the SU(2) x U(1) standard model
International Nuclear Information System (INIS)
Hollik, W.
1986-01-01
This paper contains a discussion of the 1-loop renormalization of the standard model and applications of the radiative corrections to fermion processes. Thereby we restrict the discussion to leptonic processes since these allow the cleanest access to the more subtle parts of the theory avoiding theoretical uncertainties as far as possible. Actual measurements of the W +- ,Z masses and of sin 2 θ W already indicate the presence of higher order effects in electroweak processes between fermions. More accurate measurements in the near future colliders LEP and SLC will allow to test the standard model beyond the tree level. At the 1-loop level a big amount of work has already been done with a satisfactory agreement between the individual calculations for the standard processes: μ decays, ν-scattering, and e + e → μ + μ - . 38 refs
International Nuclear Information System (INIS)
Ekey, R C; Cordova, A E; Duan, W; Chartrand, A M; McCormack, E F
2013-01-01
Double-resonance laser spectroscopy via the E,F 1 Σ g + ,v ′ =6,J ′ state was used to probe the energy region below the third dissociation limit of molecular hydrogen. Resonantly enhanced multi-photon ionization spectra were recorded by detecting ion production as a function of energy using a time-of-flight mass spectrometer. Energies and line widths for the v = 14–17 levels of the D 1 Π u + state of H 2 are reported and compared to experimental data obtained by using VUV synchrotron light excitation (Dickenson et al 2010 J. Chem. Phys. 133 144317) and fully ab initio non-adiabatic calculations of D 1 Π u + state energies and line widths (Glass-Maujean et al 2012 Phys. Rev. A 86 052507). Several high vibrational levels of the B ′′ B-bar 1 Σ u + state were also observed in this region. Term energies and rotational constants for the v = 67–69 vibrational levels are reported and compared to highly accurate ro-vibrational energy level predictions from fully ab initio non-adiabatic calculations of the first six 1 Σ u + levels of H 2 (Wolniewicz et al 2006 J. Mol. Spectrosc. 238 118). While additional observed transitions can be assigned to other states, several unassigned features in the spectra highlight the need for a fully integrated theoretical treatment of dissociation and ionization to understand the complex pattern of highly vibrationally excited states expected in this region. (paper)
1-Bromoethene-1-sulfonyl fluoride (BESF) is another good connective hub for SuFEx click chemistry.
Smedley, Christopher J; Giel, Marie-Claire; Molino, Andrew; Barrow, Andrew S; Wilson, David J D; Moses, John E
2018-05-25
We demonstrate 1,2-dibromoethane-1-sulfonyl fluoride (DESF) as a bench-stable and readily accessible precursor to the robust SuFEx connector, 1-bromoethene-1-sulfonyl fluoride (BESF). The in situ generation of BESF from DESF opens up several new reaction profiles, including application in the syntheses of unprecedented 3-substituted isoxazole-5-sulfonyl fluorides, 1-substituted-1H-1,2,3-triazole-4-sulfonyl fluorides, 2-amino-1-bromoethane-1-sulfonyl fluorides and 4-bromo-β-sultams in good to excellent yields. These new modules comprise a pendant sulfonyl fluoride handle, which further undergoes facile and selective SuFEx reactions with a selection of aryl silyl ethers to generate stable and useful sulfonate connections.
Note on the two inequivalent spin 1/2 baryon field operators
International Nuclear Information System (INIS)
Christos, G.A.
1985-01-01
There are two inequivalent spin 1/2 local baryon field operators that can be constructed from 3 quarks. A priori the Jsup(P)=1/2 + baryons can couple to any linear combination of these operators. We show however that the coupling of the 1/2 + baryons to these operators is determined by the value of the SU(3) ratio of F to D type peudoscalar-baryon couplings. The experimental value of this ratio implies, for example, that the proton couples strongly to (usup(T)Cγ 5 d)u and weakly to (usup(T)Cd)γ 5 u. This is of interest in QCD sum rule applications. (orig.)
Z2 monopoles in the standard SU(2) lattice gauge theory model
International Nuclear Information System (INIS)
Mack, G.; Petkova, V.B.
1979-04-01
The standard SU(2) lattice gauge theory model without fermions may be considered as a Z 2 model with monopoles and fluctuating coupling constants. At low temperatures β -1 (= small bare coupling constant) the monopoles are confined. (orig.) [de
Mu ema must roos : [luuletused] / S{u00E1ndor Cso̤ri
Cso̤ri, S{u00E1ndor
2004-01-01
Sisu: Mu ema must roos ; Viinamägi, enne sõda ; Su lauba hämarusest ; Cantata profana ; Kolmandal päeval hakkas sadama lund ; Ema jutt ; Lume mälestus ; Lampide ja rusikate ette ; Kümnes õhtu ; Jutustab koit ; Oleksid kehv taevaelanik ; Päikesevalgus ja must öine põldmari ; Kiri põhjast ; Öösel koputab moon ; Keegi su sõber ; Rajan endale teed ; Ülestunnistus Linnale ; Lesknaised tantsivad ; Värvimata jäänud silmalaugude eleegia ; 1956. aasta novembri mälestuseks ; Vihane tund ; Sel ajal jaanuaris. Eluloolisi andmeid autori kohta lk. 389-391
Haghshenas, R.; Sheng, D. N.
2018-05-01
We develop an improved variant of U (1 ) -symmetric infinite projected entangled-pair states (iPEPS) ansatz to investigate the ground-state phase diagram of the spin-1 /2 square J1-J2 Heisenberg model. In order to improve the accuracy of the ansatz, we discuss a simple strategy to select automatically relevant symmetric sectors and also introduce an optimization method to treat second-neighbor interactions more efficiently. We show that variational ground-state energies of the model obtained by the U (1 ) -symmetric iPEPS ansatz (for a fixed bond dimension D ) set a better upper bound, improving previous tensor-network-based results. By studying the finite-D scaling of the magnetically order parameter, we find a Néel phase for J2/J1place at J2c2/J1=0.610 (2 ) to the conventional Stripe phase. We compare our results with earlier DMRG and PEPS studies and suggest future directions for resolving remaining issues.
International Nuclear Information System (INIS)
Espinosa P, G.; Estrada P, C.E.; Nunez C, A.; Amador G, R.
2001-01-01
The computer code ANESLI-1 developed by the CNSNS and UAM-I, has the main goal of making stability analysis of nuclear reactors of the BWR type, more specifically, the reactors of the U1 and U2 of the CNLV. However it can be used for another kind of applications. Its capacity of real time simulator, allows the prediction of operational transients, and conditions of dynamic steady states. ANESLI-1 was developed under a modular scheme, which allows to extend or/and to improve its scope. The lineal stability analysis predicts the instabilities produced by the wave density phenomenon. (Author)
Coordinates of the quantum plane as q-tensor operators in Uq (su(2) * su(2))
International Nuclear Information System (INIS)
Biedenharn, L.C.; Lohe, M.A.
1995-01-01
The relation between the set of transformations M q (2) of the quantum plane and the quantum universal enveloping algebra U q (u(2)) is investigated by constructing representations of the factor algebra U q (u(2) * u(2)). The non-commuting coordinates of M q (2), on which U q (2) * U q (2) acts, are realized as q-spinors with respect to each U q (u(2)) algebra. The representation matrices of U q (2) are constructed as polynomials in these spinor components. This construction allows a derivation of the commutation relations of the noncommuting coordinates of M q (2) directly from properties of U q (u(2)). The generalization of these results to U q (u(n)) and M q (n) is also discussed
SU(3) limit of the IBM as a 1/N expansion
International Nuclear Information System (INIS)
Kuyucak, S.; Morrison, I.
1990-01-01
The SU(3) limit of the interacting boson model is considered from the perspective of the 1/N expansion. It is shown that truncation of the E2 matrix elements in the spirit of the 1/N expansion and the Mikhailov plots greatly simplifies the complicated exact results and leads to some new insights. A list of E2 transitions among the ground, β and γ bands, both in the SU(3) limit and in more general cases, is given, and some errors in the previous literature are pointed out. 13 refs
International Nuclear Information System (INIS)
Teh, R.
1989-07-01
Vortex-like and string-like solutions of 2+1 Dim. SU(2) YM theory with the Chern-Simons term are discussed. Two ansatze are constructed which yield respectively analytic Bessel function solutions and elliptic function solutions. The Bessel function solutions are vortex-like and tend to the same vacuum state as the Ginzburg-Landau vortex solution at large ρ. The Jacobi elliptic function solutions are string-like, have finite energy and magnetic flux concentrated along a line in the x 1 - x 2 plane. (author). 18 refs
SU(N) lattice gauge theory with Villain's action
International Nuclear Information System (INIS)
Onofri, E.
1981-01-01
The pure gauge lattice theory with Villain's action exp[-A(U)] = GAMMAsub(j=1)sup(N) Σsub(n=-infinity)sup(+infinity) exp[-(N/lambda)(THETAsub(j) + 2nπ) 2 ], where THETA 1 ,..., THETAsub(N) are the invariant angles of U is an element of U(N) or SU(N) is considered. For the two-dimensional lattice the partition function Z(lambda,N) is calculated with the specific heat, the level density rhosub(N)(THETA) and Wilson's loops Wsub(n) = (1/N) (n = 1,2,3,...). The 1/N expansion of Z and Wsub(n) is convergent for sufficiently small |lambda/N| and its coefficients are analytic in lambda near the real axis (no ''Gross-Witten'' singularity to all orders in 1/N), but it is still not possible to commute the strong-coupling limit with the planar limit (lambda→infinity, N→infinity). The character expansion which is needed for strong-coupling calculations in four dimensions is also calculated. A comparison with Monte Carlo data (N=2) and a preliminary discussion of the large-N limit is given. (author)
SU(2) with fundamental fermions and scalars
Hansen, Martin; Janowski, Tadeusz; Pica, Claudio; Toniato, Arianna
2018-03-01
We present preliminary results on the lattice simulation of an SU(2) gauge theory with two fermion flavors and one strongly interacting scalar field, all in the fundamental representation of SU(2). The motivation for this study comes from the recent proposal of "fundamental" partial compositeness models featuring strongly interacting scalar fields in addition to fermions. Here we describe the lattice setup for our study of this class of models and a first exploration of the lattice phase diagram. In particular we then investigate how the presence of a strongly coupled scalar field affects the properties of light meson resonances previously obtained for the SU(2) model. Preprint: CP3-Origins-2017-047 DNRF90
Sari, Ajeng Arum; Tachibana, Sanro; Itoh, Kazutaka
2012-08-01
Trametes versicolor U97 isolated from nature degraded 73% of the 1,1,1-trichloro-2,2-bis(4-chlorophenyl) ethane (DDT) in a malt extract liquid medium after a 40-d incubation period. This paper presents a kinetic study of microbial growth using the Monod equation. T. versicolor U97 degraded DDT during an exponential growth phase, using glucose as a carbon source for growth. The growth of T. versicolor U97 was not affected by DDT. DDT was degraded by T. versicolor U97 only when the secondary metabolism coincided with the production of several enzymes. Furthermore, modeling of several inhibitors using the partial least squares function in Minitab 15, revealed lignin peroxidase (98.7 U/l) plays a role in the degradation of DDT. T. versicolor U97 produced several metabolites included a single-ring aromatic compound, 4-chlorobenzoic acid. Copyright © 2012 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Zero Action on Perfect Crystals for U_q(G_2^{(1}
Directory of Open Access Journals (Sweden)
Kailash C. Misra
2010-03-01
Full Text Available The actions of 0-Kashiwara operators on the U_q(G_2^{(1}-crystal B_l in [Yamane S., J. Algebra 210 (1998, 440-486] are made explicit by using a similarity technique from that of a U_q'(D_4^{(3}-crystal. It is shown that {B_l}_{l ≥ 1} forms a coherent family of perfect crystals.
Energy Technology Data Exchange (ETDEWEB)
Hadasz, Leszek [Krakow Univ. (Poland). Inst. of Physics; Pawelkiewicz, Michal; Schomerus, Volker [DESY Hamburg (Germany). Theory Group
2013-05-15
We determine the Clebsch-Gordan and Racah-Wigner coefficients for continuous series of representations of the quantum deformed algebras U{sub q}(sl(2)) and U{sub q}(osp(1 vertical stroke 2)). While our results for the former algebra reproduce formulas by Ponsot and Teschner, the expressions for the orthosymplectic algebra are new. Up to some normalization factors, the associated Racah-Wigner coefficients are shown to agree with the fusing matrix in the Neveu-Schwarz sector of N=1 supersymmetric Liouville field theory.
SU(N) gauge theories in 2+1 dimensions: glueball spectra and k-string tensions
Energy Technology Data Exchange (ETDEWEB)
Athenodorou, Andreas [Department of Physics, University of Cyprus,POB 20537, 1678 Nicosia (Cyprus); Computation-based Science and Technology Research Center, The Cyprus Institute,20 Kavafi Str., Nicosia 2121 (Cyprus); Teper, Michael [Rudolf Peierls Centre for Theoretical Physics, University of Oxford,1 Keble Road, Oxford OX1 3NP (United Kingdom)
2017-02-03
We calculate the low-lying glueball spectrum and various string tensions in SU(N) lattice gauge theories in 2+1 dimensions, and extrapolate the results to the continuum limit. We do so for for the range N∈[2,16] so as to control the N-dependence with a useful precision. We observe a number of striking near-degeneracies in the various J{sup PC} sectors of the glueball spectrum, in particular between C=+ and C=− states. We calculate the string tensions of flux tubes in a number of representations, and provide evidence that the leading correction to the N-dependence of the k-string tensions is ∝1/N rather than ∝1/N{sup 2}, and that the dominant binding of k fundamental flux tubes into a k-string is via pairwise interactions. We comment on the possible implications of our results for the dynamics of these gauge theories.
11 CFR 101.1 - Candidate designations (2 U.S.C. 432(e)(1)).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate designations (2 U.S.C. 432(e)(1)). 101.1 Section 101.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CANDIDATE STATUS AND... and address, party affiliation, and office sought, the District and State in which Federal office is...
Effective SU(2) theory for the pseudogap state
Montiel, X.; Kloss, T.; Pépin, C.
2017-03-01
This paper exposes in a detailed manner the recent findings about the SU(2) scenario for the underdoped phase of the cuprate superconductors. The SU(2) symmetry is formulated as a rotation between the d -wave superconducting (SC) phase and a d -wave charge order. We define the operators responsible for the SU(2) rotations and we derive the nonlinear σ model associated with it. In this framework, we demonstrate that SU(2) fluctuations are massless in finite portions of the Brillouin zone corresponding to the antinodal regions (0 ,π ) and (π ,0 ). We argue that the presence of SU(2) fluctuations in the antinodal region leads to the opening of Fermi arcs around the Fermi surface and to the formation of the pseudogap. Moreover, we show that SU(2) fluctuations lead, in turn, to the emergence of a finite momentum SC order—or pair density wave (PDW)—and more importantly to a new kind of excitonic particle-hole pairs liquid, the resonant excitonic state (RES), which is made of patches of preformed particle-hole pairs with multiple momenta. When the RES liquid becomes critical, we demonstrate that electronic scattering through the critical modes leads to anomalous transport properties. This new finding can account for the strange metal (SM) phase at finite temperature, on the right-hand side of the SC dome, shedding light on another notoriously mysterious part of the phase diagram of the cuprates.
Multiple multi-orbit fermionic and bosonic pairing and rotational SU(3) algebras
International Nuclear Information System (INIS)
Kota, V.K.B.
2017-01-01
In nuclei with valence nucleons that are identical nucleons and occupy r number of j-orbits, there will be 2 r-1 number of multiple pairing (quasi-spin) SU(2) algebras with the generalized pair creation operator S + being a sum of single-j pair creation operators with arbitrary phases. Also, for each set of phases there will be a corresponding Sp(2Ω) algebra in U(2Ω) ⊃ Sp(2Ω); Ω = ∑ (2j+1)/2. Using this correspondence, derived is the condition for a general one-body operator of angular momentum rank k to be a quasi-spin scalar or a vector vis-a-vis the phases in S + . These will give special seniority selection rules for electromagnetic transitions. We found that the phase choice advocated by Arvieu and Moszkowski gives pairing Hamiltonians having maximum correlation with well known effective interactions. All the results derived for identical fermion systems are shown to extend to identical boson systems such as sd, sp, sdg and sdpf interacting boson models (IBM's) with SU(2) → SU(1,1) and Sp(2/Omega) → SO(2Ω). Going beyond pairing, for a given set of oscillator orbits, there are multiple rotational SU(3) algebras both in shell model and IBM's. Different SU(3) algebras in IBM's are shown, using sdg IBM as an example, to give different geometric shapes.
A nonlinear deformed su(2) algebra with a two-color quasitriangular Hopf structure
International Nuclear Information System (INIS)
Bonatsos, D.; Daskaloyannis, C.; Kolokotronis, P.; Ludu, A.; Quesne, C.
1997-01-01
Nonlinear deformations of the enveloping algebra of su(2), involving two arbitrary functions of J 0 and generalizing the Witten algebra, were introduced some time ago by Delbecq and Quesne. In the present paper, the problem of endowing some of them with a Hopf algebraic structure is addressed by studying in detail a specific example, referred to as scr(A) q + (1). This algebra is shown to possess two series of (N+1)-dimensional unitary irreducible representations, where N=0,1,2,hor-ellipsis. To allow the coupling of any two such representations, a generalization of the standard Hopf axioms is proposed by proceeding in two steps. In the first one, a variant and extension of the deforming functional technique is introduced: variant because a map between two deformed algebras, su q (2) and scr(A) q + (1), is considered instead of a map between a Lie algebra and a deformed one, and extension because use is made of a two-valued functional, whose inverse is singular. As a result, the Hopf structure of su q (2) is carried over to scr(A) q + (1), thereby endowing the latter with a double Hopf structure. In the second step, the definition of the coproduct, counit, antipode, and scr(R)-matrix is extended so that the double Hopf algebra is enlarged into a new algebraic structure. The latter is referred to as a two-color quasitriangular Hopf algebra because the corresponding scr(R)-matrix is a solution of the colored Yang endash Baxter equation, where the open-quotes colorclose quotes parameters take two discrete values associated with the two series of finite-dimensional representations. copyright 1997 American Institute of Physics
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Bjelanovic, J; Minincic, Z; Komatina, R; Raicevic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1986-12-01
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. It was found that the maximum individual dose from external irradiation amounted to 20.5 mSV during past 10 months. Individual exposures for 7/10 of the personnel were less than 1/10 of the annual permissible exposure. Data are compared to radiation doses for last year and previous five years. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. The last part analyzes accidents occurred at the reactor during 1986. It was found that there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radiacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila 20,5 mSv, a da su pojadinacna izlaganja vise od 7/10 radnog osoblja bila manja od 1/10 godisnje granicne vrednosti. Dati su takodje uporedni podaci o
Metallographic analysis of irradiated U3Si2/Al fuel element plate of 2.96 gU/cm3 density
International Nuclear Information System (INIS)
Maman Kartaman Ajiriyanto; Aslina Br Ginting; Junaedi
2018-01-01
Metallographic analysis of U 3 Si 2 /Al fuel element plate has been performed in hot cell. The purpose of metallographic analysis is to study changes in PEB U 3 Si 2 /Al microstructure and AlMg 2 cladding thickness after irradiation in reactor until burn up of 56 %. The fuel element plate of irradiated U 3 Si 2 /Al was cut in top, middle and bottom positions with each size around 5 x 5 x 1.37 mm. Metallographic preparation starts from sample cutting using cutting machine with low speed and sample mounting, grinding and polishing in hot cell 104–105. Sample mounting was done by using resin for more than 10 hours followed by grinding with sand papers up to grit size of 2400 and polishing with diamond paste of size 3 to 1 micron at a rotational speed of 150 rpm for 5 minutes. Microstructure observation was performed with optical microscope in hot cell 107 at 200 times magnification. Microstructure examination reveals U 3 Si 2 particles with inverse forms and sizes, Al matrix and AlMg 2 cladding were spread along the U 3 Si 2 /Al side. Microstructure observation of irradiated U 3 Si 2 /Al has not shown good result because only topography observation of U 3 Si 2 /Al meat, Al matrix and AlMg 2 cladding can be done due to limited capability of the optical microscope in hot cell, where maximum magnification can be attained only at 200 times so that the phenomenon of interaction layer and small gas bubble can not be observed. However, U 3 Si 2 /Al microstructure of 56 % burnup, if compared to the microstructure of U 3 Si 2 /Al fuel element plate of 60 % burnup from previous researcher, shows interaction between U 3 Si 2 meat with Al matrix and the existence of layers with a thickness about 5 up to 20 microns. Meanwhile, the observed thickness of AlMg 2 cladding is greater than 0.25 mm, which indicates that irradiation does not significantly change the thickness of AlMg 2 cladding so that the overall irradiated U 3 Si 2 -Al still has good integrity and stability. (author)
Renormalization effects in the SU(16) maximally gauged theory
International Nuclear Information System (INIS)
Mahdavi-Hezaveh, E.
1981-03-01
In the context of a quark-lepton unified gauge theory, when fermionic degrees of freedom are maximally gauged, several intermediate mass scales filling the grand plateau, between 10 2 Gev. and the grand unifying mass scale, M, may exist. In particular, when renormalization effects are taken into account for the SU(16) ''maximal'' gauge symmetry, [in which lepton number is regarded as the fourth color quantum number], it turns out that two intermediate stages governed by the symmetries G 2 =SU(8)sub(I) S SU(8)sub(II) X U(1)sub(F) and G 3 =SU(2)sub(L) X XU(2)sub(R) X SU(4)sub(C) can naturally coexist if Sin 2 theta (Msub(W))>1/6+5/9(α(Msub(W)/αsub(S)(Msub(W)). It is shown that these symmetries break down at a mass scale of the order of Msub(X) approximately equal to 10 4 -10 5 Gev. If neutral current phenomenology (or any other experiment) predicts Sin 2 theta (Msub(W))>0.206, then quark-lepton unification and left-right symmetry simultaneously break down at M approximately equal to 10 4 Gev. (at which αsub(C)(Msub(X) approximately equal to 0.041). It is then argued that apart from proton decay, n-anti n oscillation and neutrinoless double β decay processes, an accurate experimental value of Sin 2 theta (Msub(W)), to α 10 -4 accuracy) plays a crucial role in determining the possible existence of such intermediate stages. (author)
Hidden supersymmetry and Berezin quantization of N=2, D=3 spinning superparticles
International Nuclear Information System (INIS)
Gorbunov, I.V.; Lyakhovich, S.L.
1998-09-01
The first quantized theory of N=2, D=3 massive superparticles with arbitrary fixed central charge and (half) integer or fractional superspin is constructed. The quantum states are realized on the fields carrying a finite dimensional, or a unitary infinite dimensional representation of the super groups OSp(2 vertical-bar 2) or SU(1, 1 vertical-bar 2). The construction originates from quantization of a classical model of the superparticle we suggest. The physical phase space of the classical superparticle is embedded in a symplectic superspace T*(R 1,2 ) x L 1 vertical-bar 2, where the inner Kaehler supermanifold L 1 vertical-bar 2 ≅ OSp(2 vertical-bar 2/[U(1) x U(1)] ≅ SU (1, 1 vertical-bar 2)/[U(2 vertical-bar 2 x U(1)] provides the particle with super-spin degrees of freedom. We find the relationship between Hamiltonian generators of the global Poincare supersymmetry and the 'internal' SU(1, 1 vertical-bar 2) one. Quantization of the superparticle Combines the Berezin quantization on L 1 vertical-bar 2 and the conventional Dirac quantization with respect to space-time degrees of freedom. Surprisingly, to retain the supersymmetry, quantum corrections are required for the classical N=2 supercharges as compared to the conventional Berezin method. These corrections are derived and the Berezin correspondence principle for L 1 vertical-bar 2 underlying their origin is verified. The model admits a smooth contraction to the N=1 supersymmetry in the BPS limit. (author)
Convergence of exterior solutions to radial Cauchy solutions for $\\partial_t^2U-c^2\\Delta U=0$
Directory of Open Access Journals (Sweden)
Helge Kristian Jenssen
2016-09-01
Full Text Available Consider the Cauchy problem for the 3-D linear wave equation $\\partial_t^2U-c^2\\Delta U=0$ with radial initial data $U(0,x=\\Phi(x=\\varphi(|x|$, $U_t(0,x=\\Psi(x=\\psi(|x|$. A standard result states that $U$ belongs to $C([0,T];H^s(\\mathbb{R}^3$ whenever $(\\Phi,\\Psi\\in H^s\\times H^{s-1}(\\mathbb{R}^3$. In this article we are interested in the question of how U can be realized as a limit of solutions to initial-boundary value problems on the exterior of vanishing balls $B_\\varepsilon$ about the origin. We note that, as the solutions we compare are defined on different domains, the answer is not an immediate consequence of $H^s$ well-posedness for the wave equation.
Evaluation of physical constants and operators in the SU(2) and SU(3) lattice gauge theory
International Nuclear Information System (INIS)
Tsuchida, R.H.
1987-01-01
Wilson loops and Wilson lines in the fundamental and the adjoint representations of SU(2) on the lattice are measured using the icosahedral subgroup and a noise reduction technique. The string tension was evaluated by fitting the expectation value of loops of all sizes to a 6-parameter curve. From the Wilson lines in the adjoint representation of SU(2), two kinds of gluon potentials were measured: the gluon-gluon interaction potential and the gluon-image interaction potential. The effective mass of the gluon was evaluated on each of those potentials and compared. In SU(3), the contribution of s anti σ/sub μnu/F/sub μnu/d operator to the correction of effective weak four-quark operator in the measurement of ΔI = 1/2 amplitude of kaon decay is examined. The renormalization of the critical hopping parameter is calculated perturbatively and compared with the Monte Carlo results. The VEV of psi anti psi operator is measured on the lattice. In the hopping parameter renormalization calculation and the psi anti psi measurements, the effects of expanding of Feynman diagrams in power of a, the lattice spacing, are examined
İki uçlu bozukluk 1 ve iki uçlu bozukluk 2 depresyon tedavisi arasındaki farklar
Sayar, Kemal
2013-01-01
İki uçlu bozukluk 1 ve 2 depresyonları, klinik açıdan farklılıklar gösterebilmektedir. İki uçlu bozukluk 2 ve iki uçlu bozukluk 1 depresyonların tedavisi arasındaki farklar ise tartışmalı bir alandır. Henüz İki uçlu bozukluk 2 depresyon tedavisi konusunda yeterince kanıt birikmemişse de ilk veriler her iki durumun tedavisinde farklar olması gerektiğini düşündürmektedir. Özellikle antidepresan kullanımı konusunda dikkatli olmak gerekmektedir.
Domain walls and perturbation theory in high-temperature gauge theory: SU(2) in 2+1 dimensions
International Nuclear Information System (INIS)
Korthals Altes, C.; Michels, A.; Teper, M.; Stephanov, M.
1997-01-01
We study the detailed properties of Z 2 domain walls in the deconfined high-temperature phase of the d=2+1 SU(2) gauge theory. These walls are studied both by computer simulations of the lattice theory and by one-loop perturbative calculations. The latter are carried out both in the continuum and on the lattice. We find that leading order perturbation theory reproduces the detailed properties of these domain walls remarkably accurately even at temperatures where the effective dimensionless expansion parameter g 2 /T is close to unity. The quantities studied include the surface tension, the action density profiles, roughening, and the electric screening mass. It is only for the last quantity that we find an exception to the precocious success of perturbation theory. All this shows that, despite the presence of infrared divergences at higher orders, high-T perturbation theory can be an accurate calculational tool. copyright 1997 The American Physical Society
Directory of Open Access Journals (Sweden)
Rafal Goraczniak
2013-01-01
Full Text Available U1 Adaptor is a recently discovered oligonucleotide-based gene-silencing technology with a unique mechanism of action that targets nuclear pre-mRNA processing. U1 Adaptors have two distinct functional domains, both of which must be present on the same oligonucleotide to exert their gene-silencing function. Here, we present the first in vivo use of U1 Adaptors by targeting two different human genes implicated in melanomagenesis, B-cell lymphoma 2 (BCL2 and metabotropic glutamate receptor 1 (GRM1, in a human melanoma cell xenograft mouse model system. Using a newly developed dendrimer delivery system, anti-BCL2 U1 Adaptors were very potent and suppressed tumor growth at doses as low as 34 µg/kg with twice weekly intravenous (iv administration. Anti-GRM1 U1 Adaptors suppressed tumor xenograft growth with similar potency. Mechanism of action was demonstrated by showing target gene suppression in tumors and by observing that negative control U1 Adaptors with just one functional domain show no tumor suppression activity. The anti-BCL2 and anti-GRM1 treatments were equally effective against cell lines harboring either wild-type or a mutant V600E B-RAF allele, the most common mutation in melanoma. Treatment of normal immune-competent mice (C57BL6 indicated no organ toxicity or immune stimulation. These proof-of-concept studies represent an in-depth (over 800 mice in ~108 treatment groups validation that U1 Adaptors are a highly potent gene-silencing therapeutic and open the way for their further development to treat other human diseases.
International Nuclear Information System (INIS)
Wiblin, R.T.; Edmonds, K.; Ellner, J.J.
1986-01-01
The human macrophage-like cell line U937 spontaneously produces a factor which blocks interleukin-1 (IL-1) activity for mouse thymocytes but not mitosis of T-lymphoblastoid cells. The authors examined the effects of U937 conditioned medium (CM) on other IL-1 activities and on interleukin-2 (IL-2) production. U937 was cultured at 5 x 10 6 /ml in RPMI-1640 at 37 0 C for 5 days. The resulting CM inhibited the mitogenic response of C3H/HeJ mouse thymocytes to an IL-1 standard, with an inhibitory of activity of 6.64 U/ml (1 U = reciprocal dilution producing 50% inhibition of maximal response). Similarly, CM inhibited (10.12 U/ml) the fibroblast stimulation promoter activity of IL-1. The effect of CM on IL-2 production was assessed in a direct assay in which IL-2 production by γ-irradiated (12,000 rads) MLA-144 lymphosarcoma cells was assayed as 3 H-thymidine incorporation in CTLL-20 cells. The suppressive activity of CM was 4.95 U/ml; CM did not interfere with the response of CTLL-20 to IL-2. These studies establish that U937 produces factors with multiple, related biological activities; U937 CM blocks IL-2 dependent (thymocyte mitogenesis) and IL-2 independent (fibroblast proliferation) IL-1 activities and interferes with production of, but not response to, IL-2. U937 is an excellent model to study growth inhibitory properties of mononuclear phagocytes
Electroweak phase transition in the economical 3-3-1 model
Energy Technology Data Exchange (ETDEWEB)
Phong, Vo Quoc; Van, Vo Thanh; Minh, Le Hoang [Ho Chi Minh City University of Science, Department of Theoretical Physics, Ho Chi Minh City (Viet Nam); Long, Hoang Ngoc [Vietnamese Academy of Science and Technology, Institute of Physics, Hanoi (Viet Nam)
2015-07-15
We consider the EWPT in the economical 3-3-1 (E331) model. Our analysis shows that the EWPT in the model is a sequence of two first-order phase transitions, SU(3) → SU(2) at the TeV scale and SU(2) → U(1) at the 100 GeV scale. The EWPT SU(3) → SU(2) is triggered by the new bosons and the exotic quarks; its strength is about 1-13 if the mass ranges of these new particles are 10{sup 2}-10{sup 3} GeV. The EWPT SU(2) → U(1) is strengthened by only the new bosons; its strength is about 1-1.15 if the mass parts of H{sub 1}{sup 0}, H{sub 2}{sup ±} and Y{sup ±} are in the ranges 10-10{sup 2} GeV. The contributions of H{sub 1}{sup 0} and H{sub 2}{sup ±} to the strengths of both EWPTs may make them sufficiently strong to provide large deviations from thermal equilibrium and B violation necessary for baryogenesis. (orig.)
Liu, Jun; Li, Shitao; Wei, Dong; Gao, Hong; Li, Fuli
2018-02-01
We theoretically explore the angular rotation measurement sensitivity of SU(1,1) interferometers with a coherent beam and a vacuum beam input by using orbital angular momentum (OAM). Compared with the OAM in an SU(2) interferometer, the SU(1,1) interferometer employing homodyne detection can further surpass the angular rotation shot noise limit \\tfrac{1}{2l\\sqrt{N}} and improve the resolution and sensitivity of angular rotation measurement. Two models are considered, one is that OAM is carried by a probe beam and the other one is a pump beam with the OAM. The sensitivity can be improved by higher OAM and nonlinear process with a large gain. The resolution can be enhanced in the case that the pump beam has OAM. Moreover, we present a brief discussion on the variation of resolution and sensitivity in the presence of photon loss.
Lifting scalar-quark and -lepton masses with sideways U(1)-II
International Nuclear Information System (INIS)
McCabe, J.F.; Wada, W.W.
1984-01-01
We investigate the phenomenological consequences of an SUSY model with a gauged O'Raifeartaigh sector on scalar partner masses. The model has the gauge symmetry SU(5) x U(1). We find that this form of spontaneous SUSY breaking leads to large scalar partner masses through one loop graphs without changing quark and lepton masses from tree values, and without breaking SU(5) symmetries by the scalar partner sector. To calculate the scalar partner masses we extend previous work on supergraph techniques to include cases when SUSY is broken at tree level. We are able to sum exactly the corrections to unbroken propagators with the aid of a supersymmetric version of tree-level Dyson equations. We show how the same ideas can be implemented in an SU(5) gauge model where the normal Higgs give large masses radiatively to the scalar-quarks and -leptons. 7 references
Qq(Q-bar)(q-bar)' states in chiral SU(3) quark model
International Nuclear Information System (INIS)
Zhang Haixia; Zhang Min; Zhang Zongye
2007-01-01
We study the masses of Qq(Q-bar)(q-bar)' states with J PC =0 ++ , 1 ++ , 1 +- and 2 ++ in the chiral SU(3) quark model, where Q is the heavy quark (c or b) and q(q') is the light quark (u,d or s). According to our numerical results, it is improbable to make the interpretation of [cn(c-bar)(n-bar)] 1 ++ and [cn(c-bar)(n-bar)] 2 ++ (n=u,d) states as X(3872) and Y(3940), respectively. However, it is interesting to find the tetraquarks in the bq(b-bar)(q-bar)' system. (authors)
SU-8 photoresist and SU-8 based nanocomposites for broadband acoustical matching at 1 GHz
Energy Technology Data Exchange (ETDEWEB)
Ndieguene, A; Campistron, P; Carlier, J; Wang, S; Callens-Debavelaere, D; Nongaillard, B, E-mail: Assane.Ndieguene@meletu.univ-valenciennes.f [Univ Lille Nord de France, F-59000 Lille (France)
2009-11-01
So as to integrate acoustic functions in BioMEMS using 1 GHz ZnO transducers deposited on silicon substrates, acoustic waves propagation through the silicon substrate and its transmission in water needs to be maximized (the insertion losses at the Si / water interface are about 6dB). In the context of integration, it is interesting for mechanical impedance matching to use photosensitive materials such as SU-8 so that patterns may be obtained. Nanocomposite materials based on SU-8 mixed with nanoparticles having adequate impedances were fabricated. These new materials are characterized in terms of their acoustic velocity, impedance and attenuation. For this, the nanocomposite layers are deposited on the substrate by spin coating to obtain a thickness of about 10 {mu}m, in order to separate acoustic echoes from the material (even if {lambda}/4 layer thickness is lower than 1 {mu}m). The insertion losses of the device immersed in water can be simulated as a function of frequency for a given reflection coefficient between the silicon substrate and the photoresist. The characteristics of some nanocomposites made with SU-8 and various concentrations of nanoparticles like Ti0{sub 2}, SrTiO{sub 3} or W have been determined.
Inelastic strong interactions at high energies. Annual progress report, June 1, 1979-May 1, 1980
International Nuclear Information System (INIS)
Suranyi, P.
1980-02-01
Investigations in the area of Grand Unified Field Theories were begun. Various ways of breaking the SU(5) symmetric theory of Georgi and Glashow were studied. As usual, an approx. 24 of Higgs breaks the symmetry from SU(5) to SU(3)/sub c/xSU(2)xU(1). It was found that an approx. 45 of Higgs is acceptable for breaking the symmetry from SU(3)/sub c/xSU(2)xU(1) to SU(3)/sub c/xU(1)/sub em/. In addition phenomenologically correct quark-lepton mass ratios are obtained by use of renormalization-group techniques if there are 6 generations of particles in the theory. Efforts directed at the development of approximate methods for extracting information from quantum field theories were continued. The quantum mechanics of polynomial potentials as a model for quantum field theories was investigated. A perturbation expansion for the energy levels and wave functions was constructed and has been proven to be convergent for arbitrary values of the coupling constants, in contrast to ordinary perturbation expansions that have a zero radius of convergence. The physical significance of the new perturbation expansions was explored both in the weak and strong coupling limits
Crystal structure of U2+xCo2Ga1-x
International Nuclear Information System (INIS)
Zelinskii, A.V.; Fedorchuk, A.A.
1995-01-01
In studies of phase equilibria in the U-Co-Ga system at 600 degrees C, the authors found a ternary compound close in composition to U 2 Co 2 Ga. A sample of composition U 42 Co 40 Ga 18 was prepared by arc-melting a mixture of high-purity U (99.4%), Co (99.99%), and Ga (99.99%) in a purified argon atmosphere. The sample was homogenized at 600 degrees C for 720 h in an evacuated quartz tube and then quenched in cold water. In structure determination, the authors used a DRON-4-07 powder X-ray diffractometer (CuK α radiation, 0.02 degrees 2θ scan step) and the CSD software package. The X-ray diffraction pattern showed tetragonal symmetry, with lattice parameters obtained from least-squares refinements a = 0.707729(5) and c = 0.34707(4) nm
Alparslan, Yunus; Baygar, Tuba; Baygar, Taçnur; Hasanhocaoglu, Hatice; Metin, Cansu
2014-01-01
U ovom je radu ispitan utjecaj filma od želatine, obogaćenog eteričnim uljem lovorovog lista, na kakvoću fileta kalifornijske pastrve (Onchorynchus mykiss) skladištene na (4±1) °C tijekom 26 dana. Fileti su ribe omotani u filmove od 8 %-tne želatine, koji su sadržavali 0; 0,1 ili 1 % (volumena po masi želatine) eteričnog ulja lovora, te pakirani u vakuumu. Tijekom skladištenja određivani su: senzorske značajke sirove i kuhane ribe, mikrobiološki parametri (ukupan broj živih stanica, te bro...
Timing characteristics of the VEhU-6 microchannel electron multipliers
International Nuclear Information System (INIS)
Bakhtizin, R.Z.; Yumaguzin, Yu.M.
1982-01-01
The VEhU-6 charnel electron multiplier timing characteristics are experimentally studied. Dependence of monoelectron pulse duration at the VEhU-6 output at different values of channel supply voltage is investigated. The VEhU-6 delay time is measured. Delay time increased from 10 to 30 ns with the increase of channel supply voltage from 2.8 to 3.2 kV (at approximately 10 5 pulse/s loading). Delay time increases with loading decrease
T expansion and SU(2) lattice gauge theory
International Nuclear Information System (INIS)
Horn, D.; Karliner, M.; Weinstein, M.
1985-01-01
This paper presents the results obtained by applying the t expansion to the case of an SU(2) lattice gauge theory in 3+1 space-time dimensions. We compute the vacuum energy density, specific heat, string tension sigma, mass M of the lowest-lying 0 ++ glueball, and the ratio R = M 2 /sigma. Our computations converge best for the energy density, specific heat, and R, and these quantities exhibit behavior which agrees with what we expect on general grounds and what is known from Euclidean Monte Carlo calculations. In particular we see a broad lump in the specific heat and determine √R to be √R = 3.5 +- 0.2, a value which lies in the ballpark of values obtained from Monte Carlo calculations. Our direct computations of the mass of the 0 ++ glueball and string tension cannot be easily compared to the results of Monte Carlo calculations, but appear to be consistent with what one would expect
International Nuclear Information System (INIS)
Damunir
2007-01-01
The reaction kinetics aspect of U 3 O 8 kernel with gas H 2 on the characteristics of activation energy, reaction rate constant and O/U ratio of UO 2 kernel had been studied. U 3 O 8 kernel was reacted with gas H 2 in a reduction furnace at varied reaction time and temperature. The reaction temperature was varied at 600, 700, 750 and 850 °C with a pressure of 50 mmHg for 3 hours in gas N 2 atmosphere. The reation time was varied at 1, 2, 3 and 4 hours at a temperature of 750 °C using similar conditions. The reaction product was UO 2 kernel. The reaction kinetic aspect between U 3 O 8 and gas H 2 comprised the minimum activation energy (ΔE), the reaction rate constant and the O/U ratio of UO 2 kernel. The minimum activation energy was determined from a straight line slope of equation ln [{D b . R o {(1 - (1 - X b ) ⅓ } / (b.t.Cg)] = -3.9406 x 10 3 / T + 4.044. By multiplying with the straight line slope -3.9406 x 10 3 , the ideal gas constant (R) 1.985 cal/mol and the molarity difference of reaction coefficient 2, a minimum activation energy of 15.644 kcal/mol was obtained. The reaction rate constant was determined from first-order chemical reaction control and Arrhenius equation. The O/U ratio of UO 2 kernel was obtained using gravimetric method. The analysis result of reaction rate constant with chemical reaction control equation yielded reaction rate constants of 0.745 - 1.671 s -1 and the Arrhenius equation at temperatures of 650 - 850 °C yielded reaction rate constants of 0.637 - 2.914 s -1 . The O/U ratios of UO 2 kernel at the respective reaction rate constants were 2.013 - 2.014 and the O/U ratios at reaction time 1 - 4 hours were 2.04 - 2.011. The experiment results indicated that the minimum activation energy influenced the rate constant of first-order reaction and the O/U ratio of UO 2 kernel. The optimum condition was obtained at reaction rate constant of 1.43 s -1 , O/U ratio of UO 2 kernel of 2.01 at temperature of 750 °C and reaction time of 3
Energy Technology Data Exchange (ETDEWEB)
Banuls, Mari Carmen; Cirac, J. Ignacio; Kuehn, Stefan [Max-Planck-Institut fuer Quantenoptik (MPQ), Garching (Germany); Cichy, Krzysztof [Frankfurt Univ. (Germany). Inst. fuer Theoretische Physik; Adam Mickiewicz Univ., Poznan (Poland). Faculty of Physics; Jansen, Karl [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC
2017-07-20
We propose an explicit formulation of the physical subspace for a 1+1 dimensional SU(2) lattice gauge theory, where the gauge degrees of freedom are integrated out. Our formulation is completely general, and might be potentially suited for the design of future quantum simulators. Additionally, it allows for addressing the theory numerically with matrix product states. We apply this technique to explore the spectral properties of the model and the effect of truncating the gauge degrees of freedom to a small finite dimension. In particular, we determine the scaling exponents for the vector mass. Furthermore, we also compute the entanglement entropy in the ground state and study its scaling towards the continuum limit.
Directory of Open Access Journals (Sweden)
Mari Carmen Bañuls
2017-11-01
Full Text Available We propose an explicit formulation of the physical subspace for a (1+1-dimensional SU(2 lattice gauge theory, where the gauge degrees of freedom are integrated out. Our formulation is completely general, and might be potentially suited for the design of future quantum simulators. Additionally, it allows for addressing the theory numerically with matrix product states. We apply this technique to explore the spectral properties of the model and the effect of truncating the gauge degrees of freedom to a small finite dimension. In particular, we determine the scaling exponents for the vector mass. Furthermore, we also compute the entanglement entropy in the ground state and study its scaling towards the continuum limit.
Bañuls, Mari Carmen; Cichy, Krzysztof; Cirac, J. Ignacio; Jansen, Karl; Kühn, Stefan
2017-10-01
We propose an explicit formulation of the physical subspace for a (1 +1 )-dimensional SU(2) lattice gauge theory, where the gauge degrees of freedom are integrated out. Our formulation is completely general, and might be potentially suited for the design of future quantum simulators. Additionally, it allows for addressing the theory numerically with matrix product states. We apply this technique to explore the spectral properties of the model and the effect of truncating the gauge degrees of freedom to a small finite dimension. In particular, we determine the scaling exponents for the vector mass. Furthermore, we also compute the entanglement entropy in the ground state and study its scaling towards the continuum limit.
International Nuclear Information System (INIS)
Banuls, Mari Carmen; Cirac, J. Ignacio; Kuehn, Stefan; Cichy, Krzysztof; Adam Mickiewicz Univ., Poznan; Jansen, Karl
2017-01-01
We propose an explicit formulation of the physical subspace for a 1+1 dimensional SU(2) lattice gauge theory, where the gauge degrees of freedom are integrated out. Our formulation is completely general, and might be potentially suited for the design of future quantum simulators. Additionally, it allows for addressing the theory numerically with matrix product states. We apply this technique to explore the spectral properties of the model and the effect of truncating the gauge degrees of freedom to a small finite dimension. In particular, we determine the scaling exponents for the vector mass. Furthermore, we also compute the entanglement entropy in the ground state and study its scaling towards the continuum limit.
SU(2)CMB at high redshifts and the value of H0
Hahn, Steffen; Hofmann, Ralf
2017-07-01
We investigate a high-z cosmological model to compute the comoving sound horizon rs at baryon-velocity freeze-out towards the end of hydrogen recombination. This model assumes a replacement of the conventional cosmic microwave background (CMB) photon gas by deconfining SU(2) Yang-Mills thermodynamics, three flavours of massless neutrinos (Nν = 3) and a purely baryonic matter sector [no cold dark-matter (CDM)]. The according SU(2) temperature-redshift relation of the CMB is contrasted with recent measurements appealing to the thermal Sunyaev-Zel'dovich effect and CMB-photon absorption by molecular rotation bands or atomic hyperfine levels. Relying on a realistic simulation of the ionization history throughout recombination, we obtain z* = 1693.55 ± 6.98 and zdrag = 1812.66 ± 7.01. Due to considerable widths of the visibility functions in the solutions to the associated Boltzmann hierarchy and Euler equation, we conclude that z* and zdrag overestimate the redshifts for the respective photon and baryon-velocity freeze-out. Realistic decoupling values turn out to be zlf,* = 1554.89 ± 5.18 and zlf, drag = 1659.30 ± 5.48. With rs(zlf, drag) = (137.19 ± 0.45) Mpc and the essentially model independent extraction of rsH0 = constant from low-z data in Bernal, Verde & Riess, we obtain a good match with the value H0 = (73.24 ± 1.74) km s-1 Mpc-1 extracted in Riess et al. by appealing to Cepheid-calibrated Type Ia supernovae, new parallax measurements, stronger constraints on the Hubble flow and a refined computation of distance to NGC 4258 from maser data. We briefly comment on a possible interpolation of our high-z model, invoking percolated and unpercolated U(1) topological solitons of a Planck-scale axion field, to the phenomenologically successful low-z ΛCDM cosmology.
Likelihood analysis of supersymmetric SU(5) GUTs
Energy Technology Data Exchange (ETDEWEB)
Bagnaschi, E.; Weiglein, G. [DESY, Hamburg (Germany); Costa, J.C.; Buchmueller, O.; Citron, M.; Richards, A.; De Vries, K.J. [Imperial College, High Energy Physics Group, Blackett Laboratory, London (United Kingdom); Sakurai, K. [University of Durham, Science Laboratories, Department of Physics, Institute for Particle Physics Phenomenology, Durham (United Kingdom); University of Warsaw, Faculty of Physics, Institute of Theoretical Physics, Warsaw (Poland); Borsato, M.; Chobanova, V.; Lucio, M.; Martinez Santos, D. [Universidade de Santiago de Compostela, Santiago de Compostela (Spain); Cavanaugh, R. [Fermi National Accelerator Laboratory, Batavia, IL (United States); University of Illinois at Chicago, Physics Department, Chicago, IL (United States); Roeck, A. de [CERN, Experimental Physics Department, Geneva (Switzerland); Antwerp University, Wilrijk (Belgium); Dolan, M.J. [University of Melbourne, ARC Centre of Excellence for Particle Physics at the Terascale, School of Physics, Parkville (Australia); Ellis, J.R. [King' s College London, Theoretical Particle Physics and Cosmology Group, Department of Physics, London (United Kingdom); Theoretical Physics Department, CERN, Geneva 23 (Switzerland); Flaecher, H. [University of Bristol, H.H. Wills Physics Laboratory, Bristol (United Kingdom); Heinemeyer, S. [Campus of International Excellence UAM+CSIC, Cantoblanco, Madrid (Spain); Instituto de Fisica Teorica UAM-CSIC, Madrid (Spain); Instituto de Fisica de Cantabria (CSIC-UC), Santander (Spain); Isidori, G. [Universitaet Zuerich, Physik-Institut, Zurich (Switzerland); Olive, K.A. [University of Minnesota, William I. Fine Theoretical Physics Institute, School of Physics and Astronomy, Minneapolis, MN (United States)
2017-02-15
We perform a likelihood analysis of the constraints from accelerator experiments and astrophysical observations on supersymmetric (SUSY) models with SU(5) boundary conditions on soft SUSY-breaking parameters at the GUT scale. The parameter space of the models studied has seven parameters: a universal gaugino mass m{sub 1/2}, distinct masses for the scalar partners of matter fermions in five- and ten-dimensional representations of SU(5), m{sub 5} and m{sub 10}, and for the 5 and anti 5 Higgs representations m{sub H{sub u}} and m{sub H{sub d}}, a universal trilinear soft SUSY-breaking parameter A{sub 0}, and the ratio of Higgs vevs tan β. In addition to previous constraints from direct sparticle searches, low-energy and flavour observables, we incorporate constraints based on preliminary results from 13 TeV LHC searches for jets + E{sub T} events and long-lived particles, as well as the latest PandaX-II and LUX searches for direct Dark Matter detection. In addition to previously identified mechanisms for bringing the supersymmetric relic density into the range allowed by cosmology, we identify a novel u{sub R}/c{sub R} - χ{sup 0}{sub 1} coannihilation mechanism that appears in the supersymmetric SU(5) GUT model and discuss the role of ν{sub τ} coannihilation. We find complementarity between the prospects for direct Dark Matter detection and SUSY searches at the LHC. (orig.)
Likelihood analysis of supersymmetric SU(5) GUTs
Energy Technology Data Exchange (ETDEWEB)
Bagnaschi, E. [DESY, Hamburg (Germany); Costa, J.C. [Imperial College, London (United Kingdom). Blackett Lab.; Sakurai, K. [Durham Univ. (United Kingdom). Inst. for Particle Physics Phenomonology; Warsaw Univ. (Poland). Inst. of Theoretical Physics; Collaboration: MasterCode Collaboration; and others
2016-10-15
We perform a likelihood analysis of the constraints from accelerator experiments and astrophysical observations on supersymmetric (SUSY) models with SU(5) boundary conditions on soft SUSY-breaking parameters at the GUT scale. The parameter space of the models studied has 7 parameters: a universal gaugino mass m{sub 1/2}, distinct masses for the scalar partners of matter fermions in five- and ten-dimensional representations of SU(5), m{sub 5} and m{sub 10}, and for the 5 and anti 5 Higgs representations m{sub H{sub u}} and m{sub H{sub d}}, a universal trilinear soft SUSY-breaking parameter A{sub 0}, and the ratio of Higgs vevs tan β. In addition to previous constraints from direct sparticle searches, low-energy and avour observables, we incorporate constraints based on preliminary results from 13 TeV LHC searches for jets+E{sub T} events and long-lived particles, as well as the latest PandaX-II and LUX searches for direct Dark Matter detection. In addition to previously-identified mechanisms for bringing the supersymmetric relic density into the range allowed by cosmology, we identify a novel u{sub R}/c{sub R}-χ{sup 0}{sub 1} coannihilation mechanism that appears in the supersymmetric SU(5) GUT model and discuss the role of ν{sub T} coannihilation. We find complementarity between the prospects for direct Dark Matter detection and SUSY searches at the LHC.
Frank, Mariana; Özdal, Özer
2018-01-01
We study the low scale predictions of the supersymmetric standard model extended by U (1 )B -L×U (1 )R symmetry, obtained from S O (10 ) breaking via a left-right supersymmetric model, imposing universal boundary conditions. Two singlet Higgs fields are responsible for the radiative U (1 )B -L×U (1 )R symmetry breaking, and a singlet fermion S is introduced to generate neutrino masses through an inverse seesaw mechanism. The lightest neutralino or sneutrino emerge as dark matter candidates, with different low scale implications. We find that the composition of the neutralino lightest supersymmetric particle (LSP) changes considerably depending on the neutralino LSP mass, from roughly half U (1 )R bino, half minimal supersymmetric model (MSSM) bino, to a singlet higgsino, or completely dominated by the MSSM higgsino. The sneutrino LSP is statistically much less likely, and when it occurs it is a 50-50 mixture of right-handed sneutrino and the scalar S ˜. Most of the solutions consistent with the relic density constraint survive the XENON 1T exclusion curve for both LSP cases. We compare the two scenarios and investigate parameter space points and find consistency with the muon anomalous magnetic moment only at the edge of a 2 σ deviation from the measured value. However, we find that the sneutrino LSP solutions could be ruled out completely by the strict reinforcement of the recent Z' mass bounds. We finally discuss collider prospects for testing the model.
Energy Technology Data Exchange (ETDEWEB)
Pavlovic, R; Kalinic, S [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1996-12-01
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. Previously initiated actions concerning future decision on the status of the RA reactor were continued during 1996. Actions in 1996 were focused to detailed analysis of the conditions of storing the spent fuel in the storage pools and preparing the documentation for decision making about the methods for the improvement of the mentioned conditions. It is stated that there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radijacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. U trecem delu izvestaja navedeni su osnovni podaci o ukupnim kolicinama sakupljenog radioaktivnog materijala, ukupnoj velicini kontaminiranih i dekontaminiranih povrsina i broju dekontaminiranih predmeta. U 1996. godini nastavljena je akcija zapoceta prethodne
Yeast endoribonuclease stimulated by Novikoff Hepatoma small nuclear RNAS U1 and U2
International Nuclear Information System (INIS)
Stevens, A.
1982-01-01
Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA
Gauge coupling running in minimal SU(3) x SU(2) x U(1) superstring unification
Ibáñez, L E; Ross, Graham G
1991-01-01
We study the evolution of the gauge coupling constants in string unification schemes in which the light spectrum below the compactification scale is exactly that of the minimal supersymmetric standard model. In the absence of string threshold corrections the predicted values $\\sin^2\\theta _W=0.218$ and $\\alpha _s=0.20$ are in gross conflict with experiment, but these corrections are generically important. One can express the string threshold corrections to $\\sin^2\\theta _W$ and $\\alpha_s$ in terms of certain $modular$ $weights$ of quark, lepton and Higgs superfields as well as the $moduli$ of the string model. We find that in order to get agreement with the experimental measurements within the context of this $minimal$ scheme, certain constraints on the $modular$ $weights$ of the quark, lepton and Higgs superfields should be obeyed. Our analysis indicates that this $minimal$ $string$ $unification$
Quantization of the Poisson SU(2) and its Poisson homogeneous space - the 2-sphere
International Nuclear Information System (INIS)
Sheu, A.J.L.
1991-01-01
We show that deformation quantizations of the Poisson structures on the Poisson Lie group SU(2) and its homogeneous space, the 2-sphere, are compatible with Woronowicz's deformation quantization of SU(2)'s group structure and Podles' deformation quantization of 2-sphere's homogeneous structure, respectively. So in a certain sense the multiplicativity of the Lie Poisson structure on SU(2) at the classical level is preserved under quantization. (orig.)
Dark matter contribution to b → sμ+μ- anomaly in local U(1) Lμ -Lτ model
Baek, Seungwon
2018-06-01
We propose a local U(1) Lμ -Lτ model to explain b → sμ+μ- anomaly observed at the LHCb and Belle experiments. The model also has a natural dark matter candidate N. We introduce SU(2)L-doublet colored scalar q ˜ to mediate b → s transition at one-loop level. The U(1) Lμ -Lτ gauge symmetry is broken spontaneously by the scalar S. All the new particles are charged under U(1) Lμ -Lτ. We can obtain C9μ , NP ∼ - 1 to solve the b → sμ+μ- anomaly and can explain the correct dark matter relic density of the universe, ΩDMh2 ≈ 0.12, simultaneously, while evading constraints from electroweak precision tests, neutrino trident experiments and other quark flavor-changing loop processes such as b → sγ and Bs -B‾s mixing. Our model can be tested by searching for Z‧ and new colored scalar at the LHC and B →K* ν ν ‾ process at Belle-II.
International Nuclear Information System (INIS)
Ellis, J.; Enqvist, K.; Nanopoulos, D.V.; Olive, K.A.; Srednicki, M.
1985-01-01
We present a simple model for primordial inflation in the context of SU(N, 1) no-scale n=1 supergravity. Because the model at zero temperature very closely resembles global supersymmetry, minima with negative cosmological constants do not exist, and it is easy to have a long inflationary epoch while keeping density perturbations of the right magnitude and satisfying other cosmological constraints. We pay specific attention to satisfying the thermal constraint for inflation, i.e. the existence of a high temperature minimum at the origin. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Campos, Francisco Antonio Pena
1995-12-31
The present work consists in a 1/N expansion of extended version of the SU(3) Nambu-Jona-Lasinio model in the context of the Functional Integral. The gap equations, meson propagators, triangle diagram, etc, appear quite naturally as different orders in the expansion. The new features of this approach is the inclusion of high order corrections in the 1/N leading orders, which have never included in the previous one. The method also allows for the construction of a chiral Lagrangian of interacting mesons based on the SU(3) NJL model, here obtained for the first time. (author) 32 refs., 11 figs., 5 tabs.
Konstruktivistički pristup obrazovnom postignuću učenika
Gutvajn, Nikoleta
2009-01-01
U savremenoj pedagoškoj literaturi, razlike u obrazovnom postignuću učenika se, veomaretko, proučavaju iz perspektive učenika što je, verovatno, jedan od bitnih razloga zakontinuiranu egzistenciju kategorije „neuspešan učenik”. Cilj našeg istraživanja bio je dase problem školskog neuspeha razmotri iz perspektive učenika koji su pozicionirani kaoneuspešni. Umesto mnogobrojnih pretpostavki istraživača o tome zašto su neki učenicineusp...
Theory of weak interactions and related topics. Progress report, January 1-December 31, 1980
International Nuclear Information System (INIS)
Marshak, R.E.
1985-08-01
The work reported included an effort to understand the physical meaning of the U(1) hypercharge group in the accepted electroweak SU/sub L/(2) x U(1) group, as well as other facets of the electroweak structure (e.g., the persistence of the V-A charged current despite the finite masses of the quarks and leptons, the meaning of quark-lepton symmetry for all three generations). It was shown that, unlike the case of the SU(2)/sub L/ x U(1) model, the vector U(1) generator in the SU(2)/sub L/ x SU(2)/sub R/ x U(1) model can be identified with (B-L) symmetry. Consequences were explored of the idea that the breakdown of parity is related to the non-conservation of global B-L. One consequence is that two Majorana neutrinos, one light and one extremely heavy, are predicted for each generation. Also examined were the questions of the magnitudes of various B-violating amplitudes and the kinds of selection rules governing these processes. 18 refs
Topological charge and cooling scales in pure SU(2) lattice gauge theory
Berg, Bernd A.; Clarke, David A.
2018-01-01
Using Monte Carlo simulations with overrelaxation, we have equilibrated lattices up to β=2.928, size 604, for pure SU(2) lattice gauge theory with the Wilson action. We calculate topological charges with the standard cooling method and find that they become more reliable with increasing β values and lattice sizes. Continuum limit estimates of the topological susceptibility χ are obtained of which we favor χ1/4/Tc=0.643(12), where Tc is the SU(2) deconfinement temperature. Differences between ...
Difuzijski modeli u marketingu: kako modelirati efekt egzogenih varijabli?
Radas, Sonja
2006-01-01
U marketingu se difuzijski modeli tradicionalno koriste za modeliranje dinamike životnog ciklusa proizvoda, za predviđanje potražnje za novim proizvodom te kao pomoć pri donošenju odluka u vezi s uvođenjem proizvoda na tržište. Od kada su se počeli koristiti u marketingu, difuzijski su modeli postali vrlo kompleksni. Ta je složenost posljedica potrebe da se poveća prognostička sposobnost modela i da se oni što više prilagode potrebama menadžera. Vezano s time, jedan od izazova u difuzijskom m...
Comparison of lattice gauge theories with gauge groups Z2 and SU(2)
International Nuclear Information System (INIS)
Mack, G.; Petkova, B.
1978-11-01
We study a model of a pure Yang Mills theory with gauge group SU(2) on a lattice in Euclidean space. We compare it with the model obtained by restricting varibales to 2 . An inequality relating expectation values of the Wilson loop integral in the two theories is established. It shows that confinement of static quarks is true in our SU(2) model whenever it holds for the corresponding 2 -model. The SU(2) model is shown to have high and low temperature phases that are distinguished by a qualitatively different behavior of the t'Hooft disorder parameter. (orig.) [de
Hadronic bound states in SU(2) from Dyson-Schwinger equations
Energy Technology Data Exchange (ETDEWEB)
Vujinovic, Milan [Karl-Franzens-Universitaet Graz, Institut fuer Physik, Graz (Austria); Williams, Richard [Justus-Liebig-Universitaet Giessen, Institut fuer Theoretische Physik, Giessen (Germany)
2015-03-01
By using the Dyson-Schwinger/Bethe-Salpeter formalism in Euclidean spacetime, we calculate the ground state spectrum of J ≤ 1 hadrons in an SU(2) gauge theory with two fundamental fermions. We show that the rainbow-ladder truncation, commonly employed in QCD studies, is unsuitable for a description of an SU(2) theory. This we remedy by truncating at the level of the quark-gluon vertex Dyson-Schwinger equation in a diagrammatic expansion. Results obtained within this novel approach show good agreement with lattice studies. These findings emphasize the need to use techniques more sophisticated than rainbow-ladder when investigating generic strongly interacting gauge theories. (orig.)
New grand unified models with intersecting D6-branes, neutrino masses, and flipped SU(5)
Energy Technology Data Exchange (ETDEWEB)
Cvetic, Mirjam [Department of Physics and Astronomy, University of Pennsylvania, Philadelphia, PA 19104-6396 (United States)]. E-mail: cvetic@cvetic.hep.upenn.edu; Langacker, Paul [Department of Physics and Astronomy, University of Pennsylvania, Philadelphia, PA 19104-6396 (United States); School of Natural Sciences, Institute for Advanced Study, Einstein Drive, Princeton, NJ 08540 (United States)
2007-07-30
We construct new supersymmetric SU(5) grand unified models based on Z{sub 4}xZ{sub 2} orientifolds with intersecting D6-branes. Unlike constructions based on Z{sub 2}xZ{sub 2} orientifolds, the orbifold images of the three-cycles wrapped by D6-branes correspond to new configurations and thus allow for models in which, in addition to the chiral sector in 10 and 5-bar representations of SU(5), only, there can be new sectors with (15+15-bar) and (10+10-bar) vector-pairs. We construct an example of such a globally consistent, supersymmetric model with four-families, two Standard Model Higgs pair-candidates and the gauge symmetry U(5)xU(1)xSp(4). In an N=2 sector, there are 5x(15+15-bar) and 1x(10+10-bar) vector-pairs, while another N=1 sector contains one vector-pair of 15-plets. The N=2 vector-pairs can obtain a large mass dynamically by parallel D6-brane splitting in a particular two-torus. The 15-vector-pairs provide, after symmetry breaking to the Standard Model (via parallel D-brane splitting), triplet pair candidates which can in principle play a role in generating Majorana-type masses for left-handed neutrinos, though the necessary Yukawa couplings are absent in the specific construction. This model can also be interpreted as a flipped SU(5)xU(1){sub X} grand unified model where the 10-vector-pairs can play the role of Higgs fields, though again there are phenomenological difficulties for the specific construction.
Experimental consequences of SU(3) symmetry in an sdg boson model
International Nuclear Information System (INIS)
Akiyama, Y.; Brentano, P. von; Gelberg, A.
1987-01-01
Energies of collective levels in 178 Hf and 234 U are compared wth predictions of the SU(3) limiz of the sdg interacting boson model. All known positive parity states of 178 Hf below 1.8 MeV (with the expection of a 0 + band) have been satisfactorily reproduced. Most of the bands in 234 U are also described by the model. However, a few predicted states have no experimental counterpart. The introduction of the g-basons strongly reduces the previously observed discrepancies between experimental B(E2)'s in 238 U and the sd-IBM calculation. (orig.)
Charbonneau, M; Strasser, J; Lock, E A; Turner, M J; Swenberg, J A
1989-06-01
Similarly to unleaded gasoline, 1,4-dichlorobenzene (1,4-DCB) administered for 2 years caused a dose-related increase in the incidence of renal tumors in male but not in female rats or in either sex of mice. Unleaded gasoline and 2,2,4-trimethylpentane (TMP), a component of unleaded gasoline, increased protein droplet formation and cell proliferation in male but not in female rat kidneys. These protein droplets contained, alpha 2u-globulin, a male rat-specific low-molecular-weight protein and 2,4,4-trimethyl-2-pentanol, a metabolite of TMP that was reversibly bound to this protein. Studies were undertaken to determine if 1,4-DCB produced similar effects; 1,2-DCB was used for comparison since it did not produce renal carcinogenesis in male rats. Gel filtration chromatography of a 116,000g supernatant prepared from kidneys of 1,4-[14C]DCB-treated rats showed that radiolabel coeluted with alpha 2u-globulin as one sharp peak as opposed to a multipeak pattern observed for 1,2-[14C]DCB; the maximal quantity of radiolabel for 1,4-DCB was twice that for 1,2-DCB. Equilibrium dialysis of kidney cytosol in the presence or absence of sodium dodecyl sulfate demonstrated that the radiolabel was reversibly bound to alpha 2u-globulin; the amount for 1,4-[14C]DCB-treated rats was almost twice as much as that for 1,2-[14C]DCB-treated rats. 1,2-DCB was also shown to be covalently bound to renal alpha 2u-globulin, and covalently bound to liver and plasma high-molecular-weight proteins. 1,4-DCB and, to a minor extent, 2,5-dichlorophenol, the major metabolite of 1,4-DCB, were reversibly bound to renal alpha 2u-globulin from 1,4-DCB-treated rats. 1,4-DCB increased protein droplet formation in male but not in female rat kidneys, whereas equimolar doses of 1,2-DCB showed no effect in either sex. Renal cell proliferation, measured by [3H]thymidine incorporation into renal DNA, was increased after 1,4-DCB but not after 1,2-DCB treatment. Nephrotoxicity and biochemical alterations induced by
Thermophysical and anion diffusion properties of (U x ,Th1-x )O2.
Cooper, Michael W D; Murphy, Samuel T; Fossati, Paul C M; Rushton, Michael J D; Grimes, Robin W
2014-11-08
Using molecular dynamics, the thermophysical properties of the (U x ,Th 1- x )O 2 system have been investigated between 300 and 3600 K. The thermal dependence of lattice parameter, linear thermal expansion coefficient, enthalpy and specific heat at constant pressure is explained in terms of defect formation and diffusivity on the oxygen sublattice. Vegard's law is approximately observed for solid solution thermal expansion below 2000 K. Different deviations from Vegard's law above this temperature occur owing to the different temperatures at which the solid solutions undergo the superionic transition (2500-3300 K). Similarly, a spike in the specific heat, associated with the superionic transition, occurs at lower temperatures in solid solutions that have a high U content. Correspondingly, oxygen diffusivity is higher in pure UO 2 than in pure ThO 2 . Furthermore, at temperatures below the superionic transition, oxygen mobility is notably higher in solid solutions than in the end members. Enhanced diffusivity is promoted by lower oxygen-defect enthalpies in (U x ,Th 1- x )O 2 solid solutions. Unlike in UO 2 and ThO 2 , there is considerable variety of oxygen vacancy and oxygen interstitial sites in solid solutions generating a wide range of property values. Trends in the defect enthalpies are discussed in terms of composition and the lattice parameter of (U x ,Th 1- x )O 2 .
The effect of losses on the quantum-noise cancellation in the SU(1,1) interferometer
International Nuclear Information System (INIS)
Xin, Jun; Wang, Hailong; Jing, Jietai
2016-01-01
Quantum-noise cancellation (QNC) is an effective method to control the noise of the quantum system, which reduces or even eliminates the noise of the quantum systems by utilizing destructive interference in the quantum system. However, QNC can be extremely dependent on the losses inside the system. In this letter, we experimentally and theoretically study how the losses can affect the QNC in the SU(1,1) interferometer. We find that losses in the different arms inside the SU(1,1) interferometer can have different effects on the QNC in the output fields from the SU(1,1) interferometer. And the QNC in the SU(1,1) interferometer can almost be insensitive to the losses in some cases. Our findings may find its potential applications in the quantum noise control.
The effect of losses on the quantum-noise cancellation in the SU(1,1) interferometer
Energy Technology Data Exchange (ETDEWEB)
Xin, Jun; Wang, Hailong [State Key Laboratory of Precision Spectroscopy, School of Physics and Materials Science, East China Normal University, Shanghai 200062 (China); Jing, Jietai, E-mail: jtjing@phy.ecnu.edu.cn [State Key Laboratory of Precision Spectroscopy, School of Physics and Materials Science, East China Normal University, Shanghai 200062 (China); Collaborative Innovation Center of Extreme Optics, Shanxi University, Taiyuan, Shanxi 030006 (China)
2016-08-01
Quantum-noise cancellation (QNC) is an effective method to control the noise of the quantum system, which reduces or even eliminates the noise of the quantum systems by utilizing destructive interference in the quantum system. However, QNC can be extremely dependent on the losses inside the system. In this letter, we experimentally and theoretically study how the losses can affect the QNC in the SU(1,1) interferometer. We find that losses in the different arms inside the SU(1,1) interferometer can have different effects on the QNC in the output fields from the SU(1,1) interferometer. And the QNC in the SU(1,1) interferometer can almost be insensitive to the losses in some cases. Our findings may find its potential applications in the quantum noise control.
Kozić, Ružica; Meštrić, Lucija
2013-01-01
Projekt studentske radionice bio je kontrola DOF-a u mjerilu 1:2000 na području općine Đurđevac. Proveden je terenski dio kontrole točnosti DMR-a, DOF-a, izvedene signalizacije te načina signalizacije. Mjerenja su obavljena 19.travnja 2013. godine. Obavljena je ponovna izmjera GPS točaka homogenog polja Đurđevac RTK metodom u sustavu CROPOS s ciljem kontrole tih točaka, čije su koordinate već određene u sklopu izrade DOF2. Uz trajno stabilizirane točke homogenog polja, RTK metodom snimane su ...
Plaquette-plaquette correlations in the SU(2) lattice gauge theory
International Nuclear Information System (INIS)
Berg, B.
1980-09-01
Monte Carlo measurements of plaquette-plaquette correlations in the 4-dimensional SU(2) lattice gauge theory are reported. For low temperatures the glue ball mass (= inverse correlation length) is estimated to be msub(g) = (3.7 +- 1.2) √K, where K is the string tension. (orig.)
Beyatlı, Yavuz; Tulumoğlu, Şener
1991-01-01
Peyniraltı suyu tozundan altı farklı sentetik besi ortamı hazırlanmıştır. Bu besi ortamlarında 12 adet L. bulgaricus suşunun oluşturduğu laktik asit miktarları tespit edilmiştir. Katkılı besi ortamlarında oluşan laktik asit miktarları, katkısız besi ortamları ile kıyaslandığında daha fazla bulunmuştur. 12 adet L. bulgaricus suşu arasında en fazla laktik asit üretenlerin L. bulgaricus B1, L. bulgaricus B4 ve L. bulgaricus B11 suşları olduğu görülmüştür.
Onset of chaos in the classical SU(2) Yang-Mills theory
Energy Technology Data Exchange (ETDEWEB)
Furusawa, Toyoaki
1988-12-28
Chaotic behaviors of color electric and magnetic fields are numerically demonstrated in the classical SU(2) Yang-Mills system in the case that the field configuration depends only on one spatial coordinate and time. We show that the homogeneous color fields evolve into the disordered one as time passes. Power spectra of the color fields are investigated and the maximum Lyapunov exponent is evaluated.
Različitosti u demografskom razvoju Imotskog i okolnih ruralnih naselja
Directory of Open Access Journals (Sweden)
Ana Rimanić
2005-01-01
Full Text Available Grad Imotski od 1991. čini zasebnu administrativnu jedinicu u čijem je sastavu pet ruralnih naselja (Vinjani Donji, Vinjani Gornji, Glavina Donja, Glavina Gornja i Medvidovića Draga i jedno urbano naselje (Imotski. Usporedbom demografskih obilježja Imotskog u odnosu na spomenuta ruralna naselja dolazi se do sljedećih zaključaka: procesi emigracije, deruralizacije te smanjenja broja stanovnika utjecali su na sva naselja, s time da su procesi u manjoj mjeri izraženi u Imotskom, a u puno većoj u ruralnim naseljima iako i među njima postoje određene razlike.
Directory of Open Access Journals (Sweden)
Marlene Lariza Andrade-Guel
2011-01-01
Full Text Available Las naftoquinonas son compuestos de origen natural o sintético que han mostrado importantes actividades biológicas, resaltando como agentes antibacterianos, antifúngicos, antimaláricos y anticancerígenos. En el presente trabajo se reportan los resultados de la síntesis utilizando diferentes métodos como la síntesis a temperatura ambiente (STA, síntesis por calentamiento convencional (SCC y síntesis asistida por ultrasonido (SAU de los derivados 2-(amino-1,4-naftoquinona. Se realizó su caracterización por espectroscopía de infrarrojo. Además se determinó su capacidad como agentes antibacterianos frente a las cepas Proteus sp. y Enterococcus faecalis. La mayor actividad lo mostró el derivado 2-bencilamino 1,4-naftoquinona.
International Nuclear Information System (INIS)
1986-02-01
The paper reviews the progress on the development of a computer model TIME2, for modelling the long term evolution of shallow burial site environments for low- and intermediate-level radioactive waste disposal. The subject is discussed under the five topic headings: 1) background studies, including geomorphology, climate, human-induced effects, and seismicity, 2) development of the TIME2 code, 3) verification and testing, 4) documentation, and, 5) role of TIME2 in radiological risk assessment. (U.K.)
Directory of Open Access Journals (Sweden)
Chunliu Li
Full Text Available Glioblastoma has highly invasive potential, which might result in poor prognosis and therapeutic failure. Hence, the key we study is to find effective therapies to repress migration and invasion. Sulforaphane (SFN was demonstrated to inhibit cell growth in a variety of tumors. Here, we will further investigate whether SFN inhibits migration and invasion and find the possible mechanisms in human glioblastoma U87MG and U373MG cells.First, the optimal time and dose of SFN for migration and invasion study were determined via cell viability and cell morphological assay. Further, scratch assay and transwell invasion assay were employed to investigate the effect of SFN on migration and invasion. Meanwhile, Western blots were used to detect the molecular linkage among invasion related proteins phosphorylated ERK1/2, matrix metalloproteinase-2 (MMP-2 and CD44v6. Furthermore, Gelatin zymography was performed to detect the inhibition of MMP-2 activation. In addition, ERK1/2 blocker PD98059 (25 µM was integrated to find the link between activated ERK1/2 and invasion, MMP-2 and CD44v6.The results showed that SFN (20 µM remarkably reduced the formation of cell pseudopodia, indicating that SFN might inhibit cell motility. As expected, scratch assay and transwell invasion assay showed that SFN inhibited glioblastoma cell migration and invasion. Western blot and Gelatin zymography showed that SFN phosphorylated ERK1/2 in a sustained way, which contributed to the downregulated MMP-2 expression and activity, and the upregulated CD44v6 expression. These molecular interactions resulted in the inhibition of cell invasion.SFN inhibited migration and invasion processes. Furthermore, SFN inhibited invasion via activating ERK1/2 in a sustained way. The accumulated ERK1/2 activation downregulated MMP-2 expression and decreased its activity and upregulated CD44v6. SFN might be a potential therapeutic agent by activating ERK1/2 signaling against human glioblastoma.
Z(2) vortices and the SU(2) string tension
International Nuclear Information System (INIS)
Goepfert, M.
1981-01-01
Topologically determined Z(2) variables in pure SU(2) lattice gauge theory are discussed. They count the number of 'vortex souls'. The high temperature expansion for the corresponding Z(2) loops is examined. They obey an area law. The coefficient of the area is shown to be equal to the string tension to all orders of the high temperature expansion. This shows that the string tension is determined by the probability distribution of the vortex souls, at least in the high temperature region. The dependence of the string tension α(β,h) on an external field h that is coupled to the Z(2) field strength is calculated to lowest order of the high temperature expansion. In this approximation, α(β,h) is determined by the free energy of a 2-dimensional Ising model in an external magnetic field 1/2log(β/4tanhh) at an inverse temperature 1/2log3/4π = 0.429. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Bjelanovic, J; Minincic, Z; Glodic, S; Raicevic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1988-12-15
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. It was found that the maximum individual dose from external irradiation amounted was less than 0.5 mSv during past 10 months. Individual exposures for 9/10 of the personnel were less than 1/10 of the annual permissible exposure. Data are compared to radiation doses for last year and previous five years. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. During 1988 there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radijacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila 0,5 mSv, a da su pojedinacna izlaganja vise od 9/10 radnog osoblja bila manja od 1/10 godisnje granicne vrednosti. Dati su takodje uporedni podaci o ozracivanju osoblja u prethodnoj, kao i u pet proteklih godina, iz
Yasui, Manabu; Kazawa, Elito; Kaneko, Satoru; Takahashi, Ryo; Kurouchi, Masahito; Ozawa, Takeshi; Arai, Masahiro
2014-11-01
SU-8 is a photoresist imaged using UV rays. However, we investigated the characteristics of an SU-8 nanopattern obtained by electron beam lithography (EBL). In particular, we studied the relationship between post-exposure bake (PEB) temperature and exposure time on an SU-8 nanopattern with a focus on phase transition temperature. SU-8 residue was formed by increasing both PEB temperature and exposure time. To prevent the formation of this, Monte Carlo simulation was performed; the results of such simulation showed that decreasing the thickness of SU-8 can reduce the amount of residue from the SU-8 nanopattern. We confirmed that decreasing the thickness of SU-8 can also prevent the formation of residue from the SU-8 nanopattern with EBL.
Critical acceleration of finite temperature SU(2) gauge simulations
International Nuclear Information System (INIS)
Ben-Av, R.; Marcu, M.; Hamburg Univ.; Solomon, S.
1991-04-01
We present a cluster algorithm that strongly reduces critical slowing down for the SU(2) gauge theory on one time slice. The idea that underlies the new algorithm is to perform efficient flips for the signs of Polyakov loops. Ergodicity is ensured by combining it with a standard local algorithm. We show how to quantify critical slowing down for such a mixed algorithm. At the finite temperature transition, the dynamical critical exponent z is ≅0.5, whereas for the purely local algoirthm z ≅ 2. (orig.)
Residual Z{sub 2} symmetries and leptonic mixing patterns from finite discrete subgroups of U(3)
Energy Technology Data Exchange (ETDEWEB)
Joshipura, Anjan S. [Physical Research Laboratory,Navarangpura, Ahmedabad 380 009 (India); Patel, Ketan M. [Indian Institute of Science Education and Research, Mohali,Knowledge City, Sector 81, S A S Nagar, Manauli 140 306 (India)
2017-01-30
We study embedding of non-commuting Z{sub 2} and Z{sub m}, m≥3 symmetries in discrete subgroups (DSG) of U(3) and analytically work out the mixing patterns implied by the assumption that Z{sub 2} and Z{sub m} describe the residual symmetries of the neutrino and the charged lepton mass matrices respectively. Both Z{sub 2} and Z{sub m} are assumed to be subgroups of a larger discrete symmetry group G{sub f} possessing three dimensional faithful irreducible representation. The residual symmetries predict the magnitude of a column of the leptonic mixing matrix U{sub PMNS} which are studied here assuming G{sub f} as the DSG of SU(3) designated as type C and D and large number of DSG of U(3) which are not in SU(3). These include the known group series Σ(3n{sup 3}), T{sub n}(m), Δ(3n{sup 2},m), Δ(6n{sup 2},m) and Δ{sup ′}(6n{sup 2},j,k). It is shown that the predictions for a column of |U{sub PMNS}| in these group series and the C and D types of groups are all contained in the predictions of the Δ(6N{sup 2}) groups for some integer N. The Δ(6N{sup 2}) groups therefore represent a sufficient set of G{sub f} to obtain predictions of the residual symmetries Z{sub 2} and Z{sub m}.
SP(6) X SU(2) and SO(8) X SU(2) - symmetric fermion-dynamic model of multinucleon systems
International Nuclear Information System (INIS)
Baktybaev, K.
2007-01-01
In last years a new approach describing collective states of multinucleon system on the base of their fermion dynamic symmetry was developed. Such fermion model is broad and logical one in comparison with the phenomenological model of interacting bosons. In cut fermion S- and D- pair spaces complicated nucleons interactions are approximating in that way so multinucleon system Hamiltonian becomes a simple function of fermion generators forming corresponding Lie algebra. Correlation fermion pairs are structured in such form so its operators of birth and destruction together with a set multiband operators are formed Sp(6) and SO(8) algebra of these pairs and SU(2)-algebra for so named anomalous pairs. For convenience at the model practical application to concrete systems the dynamical-symmetric Hamiltonian is writing by means of independent Casimir operators of subgroup are reductions of a large group. It is revealed, that observed Hamiltonians besides the known SU 3 , and SO 6 asymptotic borders have also more complicated 'vibration-like' borders SO 7 , SO 5 XSU 2 and SU 2 XSO 3 . In the paper both advantages and disadvantages of these borders and some its applications to specific nuclear systems are discussing
Flipped SU(5) from D-branes with type IIB fluxes
Energy Technology Data Exchange (ETDEWEB)
Chen Chingming [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: cchen@physics.tamu.edu; Mayes, V.E. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: eric@physics.tamu.edu; Nanopoulos, D.V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States) and Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States) and Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)]. E-mail: dimitri@physics.tamu.edu
2006-02-16
We construct flipped SU(5) GUT models as type IIB flux vacua on Z{sub 2}xZ{sub 2} orientifolds. Turning on supergravity self-dual NSNS and RR three-form fluxes fixes the toroidal complex structure moduli and the dilaton. We give a specific example of a three-generation flipped SU(5) model with a complete Higgs sector where supersymmetry is softly broken by the supergravity fluxes in the closed string sector. All of the required Yukawa couplings are present if global U(1) factors resulting from a generalized Green-Schwarz mechanism are broken spontaneously or by world-sheet instantons. In addition, the model contains extra chiral and vector-like matter, potentially of mass O(M{sub string}) via trilinear superpotential couplings.
Collective modes of the Nambu--Jona-Lasinio model with an external U(1) gauge field
International Nuclear Information System (INIS)
Klevansky, S.P.; Jaenicke, J.; Lemmer, R.H.
1991-01-01
The effect of external color fields on the collective modes of the SU L (2)xSU R (2) chiral flavor version of the Nambu--Jona-Lasinio model is studied analytically in a U(1) approximation to the gauge fields. We show that the scalar and pseudoscalar modes respond differently to external chromomagnetic and -electric fields. In the former case, in which chiral asymmetry is enhanced, the modes remain well separated and vary slowly with the field, while in the latter case the scalar mode drops rapidly to become degenerate with the pseudoscalar mode in the chiral limit. In this regime, both modes are weakly coupled to quark matter, and the pseudoscalar pion mode in particular survives as a well-defined excitation as it enters the pair continuum. The Goldberger-Treiman relation, which is shown to hold in the presence of external fields, is responsible for this behavior. Chromoelectric and -magnetic polarizabilities are seen to be equal and opposite with absolute values β σ =2.0α s and β π =0.03α s for the scalar and pseudoscalar modes respectively
A yeast endoribonuclease stimulated by Novikoff hepatoma small nuclear RNAs U1 and U2
International Nuclear Information System (INIS)
Stevens, A.
1982-01-01
Using [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) from yeast as a substrate, an endoribonuclease has been detected in enzyme fractions derived from a high salt wash of ribonucleoprotein particles of Saccharomyces cerevisiae. The [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) seems to be a preferred substrate since other polyribonucleotides are hydrolyzed more slowly, if at all. The enzyme is inhibited by ethidium bromide, but fully double-stranded polyribonucleotides are not hydrolyzed. The hydrolysis of [ 3 H]m 7 Gppp[ 14 C]RNA-poly(A) is stimulated about 2.5-fold by the addition of small nuclear RNAs U1 and U2 of Novikoff hepatoma cells. Results show that the stimulation involves an interaction of the labeled RNA with the small nuclear RNA
Energy Technology Data Exchange (ETDEWEB)
Martinc, R [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1961-12-15
Among other applications, the VISA-1 loop is to be used for thermal load testing of materials. For this type of testing one should know the maximum power generated in the loop. This power is determined from the maximum thermal neutron flux in the VK-5 channel and mean flux depression in the fissile component of the loop. Thermal neutron flux depression is caused by neutron absorption in the components of the loop, shape of the components and neutron leaking through gaps as well as properties of the surrounding medium of the core. All these parameters were taken into account for calculating the depression of thermal neutron flux in the VISA-1 loop. Two group diffusion theory was used. Fast neutron from the fission in the loop and slowed down were taken into account. Depression of the thermal neutron flux is expressed by depression factor which represents the ratio of the mean thermal neutron flux in the fissile loop component and the thermal neutron flux in the VK-5 without the loop. Calculation error was estimated and it was recommended to determine the depression factor experimentally as well. [Serbo-Croat] Petlja VISA-1 namenjena je izmedju ostalog ispitivanju materiajala na termicka naprezanja. Za ova ispitivanja potrebno je poznavati maksimalnu snagu koja se razvija u petlji, a ona se odredjuje na osnovu maksimalnog fluksa termalnih neutrona u kanalu VK-5 i srednje depresije fluksa u fisibilnoj komponenti petlje. Depresija fluksa termalnih neutrona uzrokovana je apsorpcijom neutrona u komponentama petlje, geometrijom komponeni i isticanjem neutrona preko supljina u petlji kao i osobinama reaktorske sredine koja okruzuje petlju. Svi ovi faktori uzeti su u obzir pri proracunu depresije fluksa termalnih neutrona u petlji VISA-1. Primenjena je difuziona dvo grupna teorija. Uzeti su u obzir brzi neutroni nastali fisijom u petlji i usporeni u aktivnoj zoni RA. Depresija neutronskog fluksa izrazena je depresionim faktorom, koji predstavlja odnos srednjeg fluksa
A comment on the quark mixing in the supersymmetric SU(4)xO(4) GUT model
International Nuclear Information System (INIS)
Ranfone, S.
1992-08-01
The SU(4) x O(4) and the ''flipped'' SU(5) x U(1) models seem to be the only possible Grand Universal Theories (GUT's) derivable from string theories with Kac-Moody level K=1. Naively, the SU(4) x O(4) model, at least in its minimal GUT version, is characterized by the lack of any mixing in the quark sector. In this ''Comment'' we show that, although some mixing may be generated as a consequence of large vacuum-expectation-values for the scalar partners of the right-handed neutrinos, it turns out to be too small by several orders of magnitude, in net contrast with our experimental information concerning the Cabibbo mixing. Our result, which therefore rules out the minimal SU(4) x O(4) GUT model, also applies to ''flipped'' SU(5) x U(1) in the case of the embedding in SO(10). (Author)
The Environmental Technology Verification report discusses the technology and performance of the Plug Power SU1 Fuel Cell System manufactured by Plug Power. The SU1 is a proton exchange membrane fuel cell that requires hydrogen (H2) as fuel. H2 is generally not available, so the ...
Harmonic superspaces of extended supersymmetry
International Nuclear Information System (INIS)
Ivanov, E.; Kalitzin, S.; Nguyen Ai Viet; Ogievetsky, V.
1984-01-01
The main technical apparatus of the harmonic superspace approach to extended SUSY, the calculus of harmonic variables on homogeneous spaces of the SUSY automorphism groups, is presented in detail for N=2, 3, 4. The basic harmonics for the coset manifolds G/H with G=SU(2), H=U(1); G=SU(3), H=SU(2)xU(1) and H=U(1)xU(1); G=SU(4), H=SU(3)xU(1), H=SU(2)xSU(2)xU(1), H=SU(2)xU(1)xU(1) and H=U(1)xU(1)xU(1); G=USp(2), H=SU(2)xSU(2), H=SU(2)xU(1) and H=U(1)xU(1) are tabulated a number of useful relations among them
DEFF Research Database (Denmark)
Rabna, Paulo; Andersen, Andreas; Wejse, Christian
2010-01-01
-suPAR was measured using a commercial ELISA (suPARnostic®). We found that U-suPAR carried significant prognostic information on mortality for HIV-infected subjects with an area under the ROC curve of 0.75. For HIV-negative individuals, little or no prognostic effect was observed. However, in both HIV positives...... and negatives, the predictive effect of U-suPAR was found to be inferior to that of P-suPAR....
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Place of filing; House candidates and their authorized committees (2 U.S.C. 432(g)(1)). 105.1 Section 105.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL DOCUMENT FILING (2 U.S.C. 432(g)) § 105.1 Place of filing; House candidates and their authorized...
N=2, 4 supersymmetric gauge field theory in two-time physics
International Nuclear Information System (INIS)
Bars, Itzhak; Kuo, Y.-C.
2009-01-01
In the context of two-time physics in 4+2 dimensions we construct the most general N=2, 4 supersymmetric Yang-Mills gauge theories for any gauge group G. This builds on our previous work for N=1 supersymmetry (SUSY). The action, the conserved SUSY currents, and the SU(N) covariant SUSY transformation laws are presented for both N=2 and N=4. When the equations of motion are used the SUSY transformations close to the supergroup SU(2,2|N) with N=1, 2, 4. The SU(2,2)=SO(4,2) subsymmetry is realized linearly on 4+2 dimensional flat spacetime. All fields, including vectors and spinors, are in 4+2 dimensions. The extra gauge symmetries in 2T field theory, together with the kinematic constraints that follow from the action, remove all the ghosts to give a unitary theory. By choosing gauges and solving the kinematic equations, the 2T field theory in 4+2 flat spacetime can be reduced to various shadows in various 3+1 dimensional (generally curved) spacetimes. These shadows are related to each other by dualities. The conformal shadows of our theories in flat 3+1 dimensions coincide with the well known counterpart N=1, 2, 4 supersymmetric massless renormalizable field theories in 3+1 dimensions. It is expected that our more symmetric new structures in 4+2 spacetime may be useful for nonperturbative or exact solutions of these theories.
F-theory and all things rational: surveying U(1) symmetries with rational sections
International Nuclear Information System (INIS)
Lawrie, Craig; Schäfer-Nameki, Sakura; Wong, Jin-Mann
2015-01-01
We study elliptic fibrations for F-theory compactifications realizing 4d and 6d supersymmetric gauge theories with abelian gauge factors. In the fibration these U(1) symmetries are realized in terms of additional rational section. We obtain a universal characterization of all the possible U(1) charges of matter fields by determining the corresponding codimension two fibers with rational sections. In view of modelling supersymmetric Grand Unified Theories, one of the main examples that we analyze are U(1) symmetries for SU(5) gauge theories with 5̄ and 10 matter. We use a combination of constraints on the normal bundle of rational curves in Calabi-Yau three- and four-folds, as well as the splitting of rational curves in the fibers in codimension two, to determine the possible configurations of smooth rational sections. This analysis straightforwardly generalizes to multiple U(1)s. We study the flops of such fibers, as well as some of the Yukawa couplings in codimension three. Furthermore, we carry out a universal study of the U(1)-charged GUT singlets, including their KK-charges, and determine all realizations of singlet fibers. By giving vacuum expectation values to these singlets, we propose a systematic way to analyze the Higgsing of U(1)s to discrete gauge symmetries in F-theory.
Uranium magnetism in UGa2 and U(Gasub(1-x)Alsub(x))2 compounds
International Nuclear Information System (INIS)
Ballou, R.
1983-01-01
Magnetism of intermetallic compounds of uranium is studied. A monocrystal of the highly anisotropic ferromagnetic material UGa 2 is studied by polarized neutron diffraction. Localisation of 5f electrons is evidenced. Magnetic structure of uranium in UGa 2 is determined. The pseudobinary compound U(Gasub(1-x)Alsub(x)) 2 is studied for crystal structure, ferromagnetism, paramagnetism, specific heat and resistivity [fr
Hidden U$_{q}$(sl(2)) x U$_{q}$(sl(2)) quantum group symmetry in two dimensional gravity
Cremmer, E; Schnittger, J
1997-01-01
In a previous paper, we proposed a construction of U_q(sl(2)) quantum group symmetry generators for 2d gravity, where we took the chiral vertex operators of the theory to be the quantum group covariant ones established in earlier works. The basic idea was that the covariant fields in the spin 1/2 representation themselves can be viewed as generators, as they act, by braiding, on the other fields exactly in the required way. Here we transform this construction to the more conventional description of 2d gravity in terms of Bloch wave/Coulomb gas vertex operators, thereby establishing for the first time its quantum group symmetry properties. A U_q(sl(2))\\otimes U_q(sl(2)) symmetry of a novel type emerges: The two Cartan-generator eigenvalues are specified by the choice of matrix element (bra/ket Verma-modules); the two Casimir eigenvalues are equal and specified by the Virasoro weight of the vertex operator considered; the co-product is defined with a matching condition dictated by the Hilbert space structure of...
Energy Technology Data Exchange (ETDEWEB)
Pavlovic, R; Kalinic, S [Vinca Institute of Nuclear Sciences, Beograd (Serbia and Montenegro)
1997-12-01
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. Previously initiated actions concerning future decision on the status of the RA reactor were continued during 1997. Actions in 1997 were focused to detailed analysis of the conditions of storing the spent fuel in the storage pools and preparing the documentation for decision making about the methods for the improvement of the mentioned conditions. After adopting the procedures, detailed preparations, and purchasing the needed equipment, the first phase of remedial action, the removal of the sludge from the bottom of the spent fuel storage pool was started in September 1997. It is stated that there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su i analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radiacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. U trecem delu izvestaja navedeni
Energy Technology Data Exchange (ETDEWEB)
Sotic, O; Cupac, S; Sulem, B; Zivotic, Z; Majstorovic, D; Tanaskovic, M [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1992-12-01
During 1992 Ra reactor was not in operation. All the activities were fulfilled according to the previously adopted plan. Basic activities were concerned with revitalisation of the RA reactor and maintenance of reactor components. All the reactor personnel was busy with reconstruction and renewal of the existing reactor systems and building of the new systems, maintenance of the reactor devices. Part of the staff was trained for relevant tasks and maintenance of reactor systems. [Serbo-Croat] U toku 1992 godine poslovi u okviru projekta 'Istrazivacki nuklearni reaktor RA' obavljani su u skladu sa programom i planom rada. Osnovne aktivnosti na kojima je radjeno odnosile su se na revitalizaciju reaktora RA, kao i na odrzavanje opreme. U ovom periodu reaktor nije bio u pogonu. Svo osoblje je bilo angazovano na poslovima rekonstrukcije i modernizacije postojecih i dogradnje novih reaktorskih sistema, na odrzavanju opreme a deo tehnickog osoblja je bio obucavan za vrsenje odgovarajucih poslova u pogonu i odrzavanju opreme.
Real-Time Dynamics in U(1 Lattice Gauge Theories with Tensor Networks
Directory of Open Access Journals (Sweden)
T. Pichler
2016-03-01
Full Text Available Tensor network algorithms provide a suitable route for tackling real-time-dependent problems in lattice gauge theories, enabling the investigation of out-of-equilibrium dynamics. We analyze a U(1 lattice gauge theory in (1+1 dimensions in the presence of dynamical matter for different mass and electric-field couplings, a theory akin to quantum electrodynamics in one dimension, which displays string breaking: The confining string between charges can spontaneously break during quench experiments, giving rise to charge-anticharge pairs according to the Schwinger mechanism. We study the real-time spreading of excitations in the system by means of electric-field and particle fluctuations. We determine a dynamical state diagram for string breaking and quantitatively evaluate the time scales for mass production. We also show that the time evolution of the quantum correlations can be detected via bipartite von Neumann entropies, thus demonstrating that the Schwinger mechanism is tightly linked to entanglement spreading. To present a variety of possible applications of this simulation platform, we show how one could follow the real-time scattering processes between mesons and the creation of entanglement during scattering processes. Finally, we test the quality of quantum simulations of these dynamics, quantifying the role of possible imperfections in cold atoms, trapped ions, and superconducting circuit systems. Our results demonstrate how entanglement properties can be used to deepen our understanding of basic phenomena in the real-time dynamics of gauge theories such as string breaking and collisions.
Quantum mechanics on space with SU(2) fuzziness
Energy Technology Data Exchange (ETDEWEB)
Fatollahi, Amir H.; Shariati, Ahmad; Khorrami, Mohammad [Alzahra University, Department of Physics, Tehran (Iran)
2009-04-15
Quantum mechanics of models is considered which are constructed in spaces with Lie algebra type commutation relations between spatial coordinates. The case is specialized to that of the group SU(2), for which the formulation of the problem via the Euler parameterization is also presented. SU(2)-invariant systems are discussed, and the corresponding eigenvalue problem for the Hamiltonian is reduced to an ordinary differential equation, as is the case with such models on commutative spaces. (orig.)
Quantum mechanics on space with SU(2) fuzziness
International Nuclear Information System (INIS)
Fatollahi, Amir H.; Shariati, Ahmad; Khorrami, Mohammad
2009-01-01
Quantum mechanics of models is considered which are constructed in spaces with Lie algebra type commutation relations between spatial coordinates. The case is specialized to that of the group SU(2), for which the formulation of the problem via the Euler parameterization is also presented. SU(2)-invariant systems are discussed, and the corresponding eigenvalue problem for the Hamiltonian is reduced to an ordinary differential equation, as is the case with such models on commutative spaces. (orig.)
Effect of simvastatin and ezetimibe on suPAR levels and outcomes
DEFF Research Database (Denmark)
Hodges, Gethin W; Bang, Casper N; Forman, Julie L
2018-01-01
-lowering therapy also lowers suPAR levels is unknown. METHODS: We investigated whether treatment with Simvastatin 40 mg and Ezetimibe 10 mg lowered plasma suPAR levels in 1838 patients with mild-moderate, asymptomatic aortic stenosis, included in the Simvastatin and Ezetimibe in Aortic Stenosis (SEAS) study, using...... and Ezetimibe treatment impeded the progression of the time-related increase in plasma suPAR levels. Year-1 suPAR was associated with all-cause mortality, MCE, and AVE irrespective of baseline levels (SEAS study: NCT00092677)....... cardiovascular events (MCE) composed of ischemic cardiovascular events (ICE) and aortic valve related events (AVE). RESULTS: After 4.3 years of follow-up, suPAR levels had increased by 9.2% (95% confidence interval [CI]: 7.0%-11.5%) in the placebo group, but only by 4.1% (1.9%-6.2%) in the group with lipid...
Potentials in N=2 supergravity
International Nuclear Information System (INIS)
Zinov'ev, Yu.M.
1985-01-01
The potentials and Yukava interactions, that arise while introducing a gauge interaction of vector and scalar multiplets in N=2 supergravity are presented, in this the gauge group may be either compact or noncompact. The scalar multiplets geometry corresponds to nonlinear σ, models of the form Sp(2,2n)/Sp(2)xSp(2n), SU(2,n)/SU(2)SU(n)xU(1) and O(4,n)/O(4)xO(n)
Absolute M1 and E2 Transition Probabilities in 2{sup 33}U
Energy Technology Data Exchange (ETDEWEB)
Malmskog, S G; Hoejeberg, M
1967-08-15
Using the delayed coincidence technique, the following half lives have been determined for different excited states in {sup 233}U: T{sub 1/2} (311.9 keV level) = (1.20 {+-} 0.15) x 10{sup -10} sec, T{sub 1/2} (340.5 keV level) = (5.2 {+-} 1.0) x 10{sup -11} sec, T{sub 1/2} (398.6 keV level) = (5.5 {+-} 2.0) x 10{sup -11} sec and T{sub 1/2} (415.8 keV level) < 3 x 10{sup -11}sec. From these half life determinations, together with earlier known electron intensities and conversion coefficients, 22 reduced B(Ml) and B(E2) transition probabilities (including 9 limits) have been deduced. The rotational transitions give information on the parameters {delta} and (g{sub K} - g{sub R}) . The experimental M1 and E2 transition rates between members of different bands have been analysed in terms of the predictions of the Nilsson model, taking also pairing correlations and Coriolis coupling effects into account.
International Nuclear Information System (INIS)
Grimes, R.M.
1986-11-01
To further understanding of gas phase collision dynamics involving electronically-excited molecules, a fully quantum mechanical study of He + H 2 (B 1 Σ/sub u/ + ) was undertaken. Iterative natural orbital configuration interaction (CI) calculations were performed to obtain the interaction potential between He and H 2 (B 1 Σ/sub u/ + ). The potential energy surface (PES) is highly anisotropic and has a van der Waals well of about 0.03 eV for C/sub 2v/ approach. Avoided PES crossings occur with He + H 2 (E,F 1 Σ/sub g/ + ) and with He + H 2 (X 1 Σ/sub g/ + ) and cause a local maximum and a deep minimum in the He + H 2 (B 1 Σ/sub u/ + ) PES, respectively. The crossing with He + H 2 (X 1 Σ/sub g/ + ) provides a mechanism for fluorescence quenching. The computed CI energies were combined with previous multi-reference double excitation CI calculations and fit with analytic functions for convenience in scattering calculations. Accurate dipole polarizabilities and quadrupole moment of H 2 (B 1 Σ/sub u/ + ) were computed for use in the multipole expansion, which is the analytic form of the long-range PES. 129 refs., 28 figs., 35 tabs
Solvability in D1,2(Ω) of the equation -Δu+c=Keu
International Nuclear Information System (INIS)
Duong Minh Duc.
1989-06-01
We establish the Sobolev inequality for a limiting case. Using this result, the Ekeland variational principle and our generalized critical values results we get the existence, nonexistence and nonuniqueness of solutions in D 1,2 (Ω) of the equation -Δu+c=Ke u . (author). 18 refs
Experimental consequences of SU(3) symmetry in an sdg boson model
Energy Technology Data Exchange (ETDEWEB)
Akiyama, Y.; Brentano, P. von; Gelberg, A.
1987-05-01
Energies of collective levels in /sup 178/Hf and /sup 234/U are compared wth predictions of the SU(3) limiz of the sdg interacting boson model. All known positive parity states of /sup 178/Hf below 1.8 MeV (with the expection of a 0/sup +/ band) have been satisfactorily reproduced. Most of the bands in /sup 234/U are also described by the model. However, a few predicted states have no experimental counterpart. The introduction of the g-basons strongly reduces the previously observed discrepancies between experimental B(E2)'s in /sup 238/U and the sd-IBM calculation.
Local U(2,2) Symmetry in Relativistic Quantum Mechanics
Finster, Felix
1997-01-01
Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.
Local U(2,2) symmetry in relativistic quantum mechanics
Finster, Felix
1998-12-01
Local gauge freedom in relativistic quantum mechanics is derived from a measurement principle for space and time. For the Dirac equation, one obtains local U(2,2) gauge transformations acting on the spinor index of the wave functions. This local U(2,2) symmetry allows a unified description of electrodynamics and general relativity as a classical gauge theory.
Lactococcus lactis Subsp. Lactis Suşlarında Yüksek Sıklıkta Konjugal Transfer Sistemlerinin Analizi
Directory of Open Access Journals (Sweden)
Çağla Tükel
2015-02-01
Full Text Available Bu çalışmada L. lactis subsp. lactis suşlarında laktoz fermentasyonu özelliğini kodlayan altı farklı plazmidin yüksek sıklıkta konjugal aktarım yeteneği araştırıldı. Bu plazmidlerin konjugal transfer sıklıkları; iki seks faktörünün interaksiyonuna bağlı olarak (Clu ve Agg, Clu-/Agg-, Agg+ x Clu-/Agg+, Agg- ya da Clu+/Agg- x Clu-/Agg- konjugasyon eşleri için 1.5x10-5–1.0x10-7 ve Clu+/Agg- x Clu-/Agg+ konjugasyon eşleri için 7.1x10-2-2.7x10-3 oranlarında değişim gösterdi. Laktoz plazmidlerinin stabiliteleri ise; doğal suşlarda %82-96, MG1390 alıcı suşu için tanımlanan konjugantlarda %77-98 ve MCL8060 alıcı suşu için tanımlanan konjugantlarda ise %44-67 arasında saptandı.
Algebraic Bethe ansatz for U(1) invariant integrable models: Compact and non-compact applications
International Nuclear Information System (INIS)
Martins, M.J.; Melo, C.S.
2009-01-01
We apply the algebraic Bethe ansatz developed in our previous paper [C.S. Melo, M.J. Martins, Nucl. Phys. B 806 (2009) 567] to three different families of U(1) integrable vertex models with arbitrary N bond states. These statistical mechanics systems are based on the higher spin representations of the quantum group U q [SU(2)] for both generic and non-generic values of q as well as on the non-compact discrete representation of the SL(2,R) algebra. We present for all these models the explicit expressions for both the on-shell and the off-shell properties associated to the respective transfer matrices eigenvalue problems. The amplitudes governing the vectors not parallel to the Bethe states are shown to factorize in terms of elementary building blocks functions. The results for the non-compact SL(2,R) model are argued to be derived from those obtained for the compact systems by taking suitable N→∞ limits. This permits us to study the properties of the non-compact SL(2,R) model starting from systems with finite degrees of freedom.
Algebraic Bethe ansatz for U(1) invariant integrable models: Compact and non-compact applications
Martins, M. J.; Melo, C. S.
2009-10-01
We apply the algebraic Bethe ansatz developed in our previous paper [C.S. Melo, M.J. Martins, Nucl. Phys. B 806 (2009) 567] to three different families of U(1) integrable vertex models with arbitrary N bond states. These statistical mechanics systems are based on the higher spin representations of the quantum group U[SU(2)] for both generic and non-generic values of q as well as on the non-compact discrete representation of the SL(2,R) algebra. We present for all these models the explicit expressions for both the on-shell and the off-shell properties associated to the respective transfer matrices eigenvalue problems. The amplitudes governing the vectors not parallel to the Bethe states are shown to factorize in terms of elementary building blocks functions. The results for the non-compact SL(2,R) model are argued to be derived from those obtained for the compact systems by taking suitable N→∞ limits. This permits us to study the properties of the non-compact SL(2,R) model starting from systems with finite degrees of freedom.
Directory of Open Access Journals (Sweden)
Renata Pepaś
2010-03-01
Full Text Available Wprowadzenie: Najważniejszą obiektywną metodą oceny zaburzeń układu równowagi jest badanie oczopląsu. Badanie kaloryczne jako jedyny test obrazuje pobudliwość poszczególnych błędników, umożliwiając ocenę każdego z nich osobno. Cel pracy: Celem pracy jest analiza porównawcza wyników badania oczopląsu kalorycznego uzyskanych przy użyciu metody ENG i VNG u osób zdrowych. Materiał i metody: Badaniami objęto grupę 20 osób zdrowych, w tym 10 kobiet i 10 mężczyzn w wieku 22-26 lat. U wszystkich chorych przeprowadzono badanie podmiotowe oraz badanie przedmiotowe otoneurologiczne, badanie ENG i w odstępie 7-dniowym badanie VNG z kalibracją, oceną oczopląsu samoistnego oraz próbami kalorycznymi wg Hallpike’a. Test kaloryczny wykonano kalorymetrem powietrznym firmy HOMOTH, używając temperatury powietrza 30°C oraz 44°C, podawanych przez 40 s do ucha. Wyniki: W teście kalorycznym u żadnej osoby nie stwierdzono deficytu kanałowego wykraczającego poza granice przyjętych norm. Zaobserwowano niższe wartości średnie maksymalnej prędkości wolnej fazy oczopląsów w badaniu ENG niż VNG. Ponadto badanie VNG dodatkowo umożliwiło wyznaczenie wartości przewagi kierunkowej bezwzględnej oraz średniej pobudliwości błędników. Wnioski: Uzyskane wyniki wskazują, iż badanie VNG w stosunku do badania ENG jest bardziej precyzyjne i umożliwia dokładniejsze opisanie próby kalorycznej wg Hallpike’a. W badaniu VNG analiza parametru przewagi kierunkowej bezwzględnej znacznie podnosi wartość próby kalorycznej wg Hallpike’a.
The [U{sub 2}F{sub 12}]{sup 2-} anion of Sr[U{sub 2}F{sub 12}
Energy Technology Data Exchange (ETDEWEB)
Scheibe, Benjamin; Pietzonka, Clemens; Conrad, Matthias; Kraus, Florian [Fachbereich Chemie, Philipps-Universitaet Marburg (Germany); Mustonen, Otto; Karppinen, Maarit; Karttunen, Antti J. [Department of Chemistry, Aalto University (Finland); Atanasov, Mihail; Neese, Frank [Max-Planck Institute for Chemical Energy Conversion, Muelheim an der Ruhr (Germany)
2018-03-05
The D{sub 2h}-symmetric dinuclear complex anion [U{sub 2}F{sub 12}]{sup 2-} of pastel green Sr[U{sub 2}F{sub 12}] shows a hitherto unknown structural feature: The coordination polyhedra around the U atoms are edge-linked monocapped trigonal prisms, the U{sup V} atoms are therefore seven-coordinated. This leads to a U-U distance of 3.8913(6) Aa. A weak U{sup V}-U{sup V} interaction is observed for the dinuclear [U{sub 2}F{sub 12}]{sup 2-} complex and described by the antiferromagnetic exchange J{sub exp} of circa -29.9 cm{sup -1}. The crystalline compound can be easily prepared from SrF{sub 2} and β-UF{sub 5} in anhydrous hydrogen fluoride (aHF) at room temperature. It was studied by means of single crystal X-ray diffraction, IR, Raman and UV/VIS spectroscopy, magnetic measurements, and by molecular as well as by solid-state quantum chemical calculations. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Local structure of Th1-xMO2 solid solutions (M = U, Pu)
International Nuclear Information System (INIS)
Hubert, S.; Heisbourg, G.; Moisy, Ph.; Dacheux, N.; Purans, J.E.
2004-01-01
X-ray absorption spectroscopy of Th 1-x U x O 2 and Th 1-x Pu x O 2 solid solutions was carried out on the Th, U L 3 -edges, and Pu L 3 edge to study the local structure environment of actinide mixed oxides. Various compositions of Th 1-x M x O 2 solid solutions have been prepared through the coprecipitation of the mixed oxalates from chloride or nitrate solutions: x = 0.11, 0.24, 0.37, 0.53, 0.67, 0.81, 0.91 and 1 for Th 1-x U x O 2 , and x = 0.13, 0.32, 0.66 and 1 for Th 1-x Pu x O 2 . They were characterized using X- ray diffraction. XRD analysis allowed to confirm that the variation of the lattice parameters varies linearly with the composition between the end members, suggesting that the atomic volume was conserved regardless of the details of the local distortions of the lattice, following the Vegard's law. Extending X-ray absorption fine structure (EXAFS) provides a direct characterization of the local distortions present in solid solutions. We found that opposite to the lattice parameter obtained by XRD, the interatomic distances given by EXAFS do not follow completely to neither the Vegard's law nor the virtual crystal approximation (VCA). However, the average lattice parameter obtained from EXAFS data for the first and the second shells agrees well with the one calculated from XRD data. (authors)
Family symmetries in F-theory GUTs
King, S F; Ross, G G
2010-01-01
We discuss F-theory SU(5) GUTs in which some or all of the quark and lepton families are assigned to different curves and family symmetry enforces a leading order rank one structure of the Yukawa matrices. We consider two possibilities for the suppression of baryon and lepton number violation. The first is based on Flipped SU(5) with gauge group SU(5)\\times U(1)_\\chi \\times SU(4)_{\\perp} in which U(1)_{\\chi} plays the role of a generalised matter parity. We present an example which, after imposing a Z_2 monodromy, has a U(1)_{\\perp}^2 family symmetry. Even in the absence of flux, spontaneous breaking of the family symmetry leads to viable quark, charged lepton and neutrino masses and mixing. The second possibility has an R-parity associated with the symmetry of the underlying compactification manifold and the flux. We construct an example of a model with viable masses and mixing angles based on the gauge group SU(5)\\times SU(5)_{\\perp} with a U(1)_{\\perp}^3 family symmetry after imposing a Z_2 monodromy.
Wave Function and Emergent SU(2) Symmetry in the ν_{T}=1 Quantum Hall Bilayer.
Lian, Biao; Zhang, Shou-Cheng
2018-02-16
We propose a trial wave function for the quantum Hall bilayer system of total filling factor ν_{T}=1 at a layer distance d to magnetic length ℓ ratio d/ℓ=κ_{c1}≈1.1, where the lowest charged excitation is known to have a level crossing. The wave function has two-particle correlations, which fit well with those in previous numerical studies, and can be viewed as a Bose-Einstein condensate of free excitons formed by composite bosons and anticomposite bosons in different layers. We show the free nature of these excitons indicating an emergent SU(2) symmetry for the composite bosons at d/ℓ=κ_{c1}, which leads to the level crossing in low-lying charged excitations. We further show the overlap between the trial wave function, and the ground state of a small size exact diagonalization is peaked near d/ℓ=κ_{c1}, which supports our theory.
Moral u Hrvatskoj u sociologijskoj perspektivi
ČRPIĆ, Gordan; VALKOVIĆ, Marijan
2000-01-01
U radu se obrađuje stanje morala u Republici Hrvatskoj na temelju empirijskih socioreligijskih istraživanja provedenih na općoj populaciji građana koncem 1997. i početkom 1998. godine na uzorku od 1245 ispitanika, te na populaciji studenata hrvatskih sveučilišta 1999. godine na uzorku od 692 ispitanika. Rezultati su prikazani kroz sedam poglavlja rada i pokazuju da su mladi općenito permisivniji s obzirom na sve promatrane dimenzije morala. Religioznost se pokazala kao jasan kriterij zauziman...
Study of electrical transport properties of (U 1- xY x)RuP 2Si 2
Radha, S.; Park, J.-G.; Roy, S. B.; Coles, B. R.; Nigam, A. K.; McEwen, K. A.
1996-02-01
Electrical resistivity and magnetoresistance ( {δϱ}/{ϱ}) measurements on a series of (U 1- xY x)Ru 2Si 2 (0 ⩽ x ⩽ 0.9) compounds in the temperature range 4.2-300 K and in magnetic fields up to 45 kOe are reported. The resistivity measurements do not show any signature of antiferromagnetism for x > 0.5. The compound URu 2Si 2 exhibits a large, positive ( {δϱ}/{ϱ}) presumably due to destruction of Kondo coherence as well as due to antiferromagnetism. The presence of even 5% Y at U-site weakens the Kondo coherence and reduces the magnetoresistance considerably.
Directory of Open Access Journals (Sweden)
J. Buitrago
Full Text Available In a new classical Weyl 2-spinor approach to non abelian gauge theories, starting with the U(1 gauge group in a previous work, we study now the SU(3 case corresponding to quarks (antiquarks interacting with color fields. The principal difference with the conventional approach is that particle-field interactions are not described by means of potentials but by the field strength magnitudes. Some analytical expressions showing similarities with electrodynamics are obtained. Classical equations that describe the behavior of quarks under gluon fields might be in principle applied to the quark–gluon plasma phase existing during the first instants of the Universe.
Compactifications of IIA supergravity on SU(2)-structure manifolds
Energy Technology Data Exchange (ETDEWEB)
Spanjaard, B.
2008-07-15
In this thesis, we study compactifications of type IIA supergravity on six-dimensional manifolds with an SU(2)-structure. A general study of six-dimensional manifolds with SU(2)-structure shows that IIA supergravity compactified on such a manifold should yield a four-dimensional gauged N=4 supergravity. We explicitly derive the bosonic spectrum, gauge transformations and action for IIA supergravity compactified on two different manifolds with SU(2)-structure, one of which also has an H{sup (3)}{sub 10}-flux, and confirm that the resulting four-dimensional theories are indeed N=4 gauged supergravities. In the second chapter, we study an explicit construction of a set of SU(2)-structure manifolds. This construction involves a Scherk-Schwarz duality twist reduction of the half-maximal six-dimensional supergravity obtained by compactifying IIA supergravity on a K3. This reduction results in a gauged N=4 four-dimensional supergravity, where the gaugings can be divided into three classes of parameters. We relate two of the classes to parameters we found before, and argue that the third class of parameters could be interpreted as a mirror flux. (orig.)
Nonthermal leptogenesis via direct inflaton decay without SU(2)L triplets
International Nuclear Information System (INIS)
Dent, Thomas; Lazarides, George; Ruiz de Austri, Roberto
2005-01-01
We present a nonthermal leptogenesis scenario following standard supersymmetric hybrid inflation, in the case where light neutrinos acquire mass via the usual seesaw mechanism and inflaton decay to heavy right-handed neutrino superfields is kinematically disallowed, or the right-handed neutrinos which can be decay products of the inflaton are unable to generate sufficient baryon asymmetry via their subsequent decay. The primordial lepton asymmetry is generated through the decay of the inflaton into light particles by the interference of one-loop diagrams with exchange of different right-handed neutrinos. The mechanism requires superpotential couplings explicitly violating a U(1) R-symmetry and R-parity. We take into account the constraints from neutrino masses and mixing and the preservation of the primordial asymmetry. We consider two models, one without and one with SU(2) R gauge symmetry. We show that the former is viable, whereas the latter is ruled out. Although the broken R-parity need not have currently observable low-energy signatures, some R-parity-violating slepton decays may be detectable in the future colliders
Phosphorylation of SU(VAR3-9 by the chromosomal kinase JIL-1.
Directory of Open Access Journals (Sweden)
Joern Boeke
2010-04-01
Full Text Available The histone methyltransferase SU(VAR3-9 plays an important role in the formation of heterochromatin within the eukaryotic nucleus. Several studies have shown that the formation of condensed chromatin is highly regulated during development, suggesting that SU(VAR3-9's activity is regulated as well. However, no mechanism by which this may be achieved has been reported so far. As we and others had shown previously that the N-terminus of SU(VAR3-9 plays an important role for its activity, we purified interaction partners from Drosophila embryo nuclear extract using as bait a GST fusion protein containing the SU(VAR3-9 N-terminus. Among several other proteins known to bind Su(VAR3-9 we isolated the chromosomal kinase JIL-1 as a strong interactor. We show that SU(VAR3-9 is a substrate for JIL-1 in vitro as well as in vivo and map the site of phosphorylation. These findings may provide a molecular explanation for the observed genetic interaction between SU(VAR3-9 and JIL-1.
Theory of weak interactions and related topics. Progress report, January 1-December 31, 1981
International Nuclear Information System (INIS)
Marshak, R.E.
1985-08-01
The research program demonstrated that the acceptance of B-L local symmetry as the weak hypercharge, whose spontaneous breakdown was connected to the spontaneous breakdown of parity, predicted a light electron neutrino (Majorana) and a related heavy neutrino. The prediction of neutron oscillations following from the PUT group SU(4)/sub C/ x SU(2)/sub L/ x SU(2)/sub R/ was scrutinized. A relation was derived between the mixing time for free neutron oscillations and the lifetime for nuclear stability with respect to ΔB = 2 transitions, and a study was conducted of the effect of time-varying or spatial-varying magnetic fields on the mixing time of neutron oscillations. Reasons are given for continuing work with the left-right symmetry (LRS) and partial unification theory (PUT) groups to their grand unification realization. It was shown that, without assuming a simple GUT group, that the color group has to be SU(3) and that the only possible GUT groups are SU(5) and SU(10). The gauge boson mass relation was derived for arbitrary Higgs structure associated either with the standard SU(2)/sub L/ x U(1) electroweak group or the LRS group. Also examined was the Pati-Salam type of grand unification. 31 refs
Directory of Open Access Journals (Sweden)
Lemieux Bruno
2010-12-01
Full Text Available Abstract Background In cancer cells the three-dimensional (3D telomere organization of interphase nuclei into a telomeric disk is heavily distorted and aggregates are found. In Hodgkin's lymphoma quantitative FISH (3D Q-FISH reveals a major impact of nuclear telomere dynamics during the transition form mononuclear Hodgkin (H to diagnostic multinuclear Reed-Sternberg (RS cells. In vitro and in vivo formation of RS-cells is associated with the increase of very short telomeres including "t-stumps", telomere loss, telomeric aggregate formation and the generation of "ghost nuclei". Results Here we analyze the 3D telomere dynamics by Q-FISH in the novel Hodgkin cell line U-HO1 and its non-receptor protein-tyrosine phosphatase N1 (PTPN1 stable transfectant U-HO1-PTPN1, derived from a primary refractory Hodgkin's lymphoma. Both cell lines show equally high telomerase activity but U-HO1-PTPN differs from U-HO1 by a three times longer doubling time, low STAT5A expression, accumulation of RS-cells (p As expected, multinuclear U-HO1-RS-cells and multinuclear U-HO1-PTPN1-RS-cells differ from their mononuclear H-precursors by their nuclear volume (p Conclusion Abundant RS-cells without additional very short telomeres including "t-stumps", high rate of apoptosis, but low STAT5A expression, are hallmarks of the U-HO1-PTPN1 cell line. These characteristics are independent of telomerase activity. Thus, PTPN1 induced dephosphorylation of STAT5 with consecutive lack of Akt/PKB activation and cellular arrest in G2, promoting induction of apoptosis, appears as a possible pathogenetic mechanism deserving further experimental investigation.
Neutrino masses in flipped SU(5)
Energy Technology Data Exchange (ETDEWEB)
Abel, S.A. (Bristol Univ. (UK). H.H. Wills Physics Lab.)
1990-01-04
It is demonstrated that the, recently proposed, SU(5)xU(1) unification scheme is one of only a small number of the current candidates that allows, in its parameter space, the possibility of heavy neutrinos. This is due to the fact that the usual GIM suppression mechanism does not operate, leading to fast decays of heavy tau neutrinos of the form {nu}{yields}{nu}{gamma}, with an estimated lifetime of O(1 yr) for a tau neutrino mass of 1 MeV. Using well known cosmological arguments, based on the observed 3 K background radiation, the mass of the electron neutrino is constrained to be either greater than O(1 eV), or less than the usual limit of O(10{sup -2} eV). (orig.).
Transition Probabilities in the 1/2+(631) Band in {sup 235}U
Energy Technology Data Exchange (ETDEWEB)
Hoejeberg, M; Malmskog, S G
1969-09-15
Measurements of absolute transition probabilities in the rotational band built on the 1/2{sup +}(631) single particle state in {sup 235}U have been performed using delayed coincidence technique. The following half-lives were obtained: T{sub 1/2} (13.0 keV level) = (0.50 {+-} 0.03) nsec. T{sub 1/2} (51.7 k e V level) = (0.20 {+-} 0.02) nsec. From the deduced B(E2) and B(M1) values magnetic and electric parameters were determined which could be compared with predictions from the Nilsson model.
Energy Technology Data Exchange (ETDEWEB)
Stanic, A [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1976-01-15
RA reactor was operating according to the plan for 1975 adopted in December of the previous year. It was planned for reactor to be operated at nominal power first 10-20 days each month, three following days were reserved for different power levels according to the users' demand. Four fuel exchanges were planned and fulfilled with minor delay. Data concerning planned and real operation, as well as delays from the plan and shorter interruptions are presented in tables of this Annex. It is shown that all the delays and interruptions which amounted to 104 hours were compensated. [Serbo-Croat] Reaktor RA je radio prema planu rada za 1975. godinu, nacinjenom u decembru prethodne godine. Planirano je da reaktor radi neprekidno prvih 10-20 dana u mesecu na nominalnoj snazi, tri sledeca dana je rezervisano za rad na drugim snagama zavisno od potreba korisnuka. Planirane su i 4 izmene goriva. Podaci o planiranom i ostvarenom radu kao i odstupanjima od plana i kracim prekidima u radu reaktora dati su u tabelama ovog priloga. Vidi se da su sva odstupanja i prekidi u ukupnom trajanju od 104 sata u celini nadoknadjeni.
The U-tube sampling methodology and real-time analysis of geofluids
International Nuclear Information System (INIS)
Freifeld, Barry; Perkins, Ernie; Underschultz, James; Boreham, Chris
2009-01-01
The U-tube geochemical sampling methodology, an extension of the porous cup technique proposed by Wood (1973), provides minimally contaminated aliquots of multiphase fluids from deep reservoirs and allows for accurate determination of dissolved gas composition. The initial deployment of the U-tube during the Frio Brine Pilot CO 2 storage experiment, Liberty County, Texas, obtained representative samples of brine and supercritical CO 2 from a depth of 1.5 km. A quadrupole mass spectrometer provided real-time analysis of dissolved gas composition. Since the initial demonstration, the U-tube has been deployed for (1) sampling of fluids down gradient of the proposed Yucca Mountain High-Level Waste Repository, Armagosa Valley, Nevada (2) acquiring fluid samples beneath permafrost in Nunuvut Territory, Canada, and (3) at a CO 2 storage demonstration project within a depleted gas reservoir, Otway Basin, Victoria, Australia. The addition of in-line high-pressure pH and EC sensors allows for continuous monitoring of fluid during sample collection. Difficulties have arisen during U-tube sampling, such as blockage of sample lines from naturally occurring waxes or from freezing conditions; however, workarounds such as solvent flushing or heating have been used to address these problems. The U-tube methodology has proven to be robust, and with careful consideration of the constraints and limitations, can provide high quality geochemical samples.
Alteration of RNA splicing by small molecule inhibitors of the interaction between NHP2L1 and U4
Diouf, Barthelemy; Lin, Wenwei; Goktug, Asli; Grace, Christy R. R.; Waddell, Michael Brett; Bao, Ju; Shao, Youming; Heath, Richard J.; Zheng, Jie J.; Shelat, Anang A.; Relling, Mary V.; Chen, Taosheng; Evans, William E.
2018-01-01
Splicing is an important eukaryotic mechanism for expanding the transcriptome and proteome, influencing a number of biological processes. Understanding its regulation and identifying small molecules that modulate this process remains a challenge. We developed an assay based on time-resolved FRET (TR-FRET) to detect the interaction between the protein NHP2L1 and U4 RNA, which are two key components of the spliceosome. We used this assay to identify small molecules that interfere with this interaction in a high-throughput screening (HTS) campaign. Topotecan and other camptothecin derivatives were among the top hits. We confirmed that topotecan disrupts the interaction between NHP2L1 and U4 by binding to U4 and inhibits RNA splicing. Our data reveal new functions of known drugs which could facilitate the development of therapeutic strategies to modify splicing and alter gene function. PMID:28985478
Thermodynamics of SU(N) Yang-Mills theories in 2+1 dimensions II. The Deconfined phase
Caselle, Michele; Feo, Alessandra; Gliozzi, Ferdinando; Gursoy, Umut; Panero, Marco; Schafer, Andreas
2012-01-01
We present a non-perturbative study of the equation of state in the deconfined phase of Yang-Mills theories in D=2+1 dimensions. We introduce a holographic model, based on the improved holographic QCD model, from which we derive a non-trivial relation between the order of the deconfinement phase transition and the behavior of the trace of the energy-momentum tensor as a function of the temperature T. We compare the theoretical predictions of this holographic model with a new set of high-precision numerical results from lattice simulations of SU(N) theories with N=2, 3, 4, 5 and 6 colors. The latter reveal that, similarly to the D=3+1 case, the bulk equilibrium thermodynamic quantities (pressure, trace of the energy-momentum tensor, energy density and entropy density) exhibit nearly perfect proportionality to the number of gluons, and can be successfully compared with the holographic predictions in a broad range of temperatures. Finally, we also show that, again similarly to the D=3+1 case, the trace of the en...
Directory of Open Access Journals (Sweden)
Dženita Ljuca
2007-05-01
protocol suPAR was better prognostic marker for monitoring of chemotherapy successfulness (Pearson coefficient 0,9 do 1,0; p<0,00l than uPA (Pearson coefficient between 0,86 and 0,92; p<0,02 and CEA (Pearson coefficient 0,5 do 0,89; p<0,04.
Energy Technology Data Exchange (ETDEWEB)
Bès, R., E-mail: rene.bes@aalto.fi [Department of Applied Physics, Aalto University, P.O. Box 14100, FI-00076 Aalto (Finland); Pakarinen, J.; Baena, A. [Belgian Nuclear Research Centre (SCK-CEN), Institute for Nuclear Materials Science, Boeretang 200, B-2400 Mol (Belgium); Conradson, S. [Synchrotron SOLEIL, Ligne de Lumière MARS, L' Orme des Merisiers, Saint Aubin, BP 48, F-91192 Gif-sur-Yvette Cedex (France); Verwerft, M. [Belgian Nuclear Research Centre (SCK-CEN), Institute for Nuclear Materials Science, Boeretang 200, B-2400 Mol (Belgium); Tuomisto, F. [Department of Applied Physics, Aalto University, P.O. Box 14100, FI-00076 Aalto (Finland)
2017-06-15
The charge compensation mechanisms in U{sub 1-x}Gd{sub x}O{sub 2} and Th{sub 1-x}Gd{sub x}O{sub 2-x/2} have been systematically studied using X-ray Absorption Spectroscopy (XAS) upon gradually increasing the Gd content. Gd doped nuclear fuels are widely used for optimizing the fresh core neutronics, yet when Gd{sup 3+} is substituted into U{sup 4+} or Th{sup 4+} lattice position in UO{sub 2} or ThO{sub 2}, respectively, charge must be compensated for charge neutrality. In U{sub 1-x}Gd{sub x}O{sub 2} the general hypothesis has been that the U{sup 4+} will oxidise to U{sup 5+}/U{sup 6+} while in Th{sub 1-x}Gd{sub x}O{sub 2-x/2} the fixed Th{sup 4+} valence requires generation of O vacancies. Our XAS results for a series of technologically relevant Gd contents (x = 0.04 to 0.14) in U{sub 1-x}Gd{sub x}O{sub 2} clearly demonstrate that upon increasing the Gd content U{sup 5+} is formed inducing slight increase in the U coordination number and contraction for the U-O distances while the Gd local environment remains virtually unchanged. For the Th{sub 1-x}Gd{sub x}O{sub 2-x/2} larger Gd fractions were applied (x = 0.10 to 0.34). Nonetheless, both Gd and Th local environments show changes upon increasing the Gd content; the average Gd-O and Th-O distances decrease gradually and the Gd and Th coordination numbers follow the expected trend considering the O vacancy formation to obtain charge neutrality. Finally, comparison to Gd{sub 2}O{sub 3} allowed us to propose that one of the Gd L{sub 3}-edge XANES resonance features is directly connected to the generation of O vacancies.
The su(2)α Hahn oscillator and a discrete Fourier-Hahn transform
International Nuclear Information System (INIS)
Jafarov, E I; Stoilova, N I; Van der Jeugt, J
2011-01-01
We define the quadratic algebra su(2) α which is a one-parameter deformation of the Lie algebra su(2) extended by a parity operator. The odd-dimensional representations of su(2) (with representation label j, a positive integer) can be extended to representations of su(2) α . We investigate a model of the finite one-dimensional harmonic oscillator based upon this algebra su(2) α . It turns out that in this model the spectrum of the position and momentum operator can be computed explicitly, and that the corresponding (discrete) wavefunctions can be determined in terms of Hahn polynomials. The operation mapping position wavefunctions into momentum wavefunctions is studied, and this so-called discrete Fourier-Hahn transform is computed explicitly. The matrix of this discrete Fourier-Hahn transform has many interesting properties, similar to those of the traditional discrete Fourier transform. (paper)
Quantum tunneling in the driven SU(2) model
International Nuclear Information System (INIS)
Kaminski, P.; Ploszajczak, M.; Arvieu, R.
1992-01-01
The tunneling rate is investigated in the quantum and classical limits using an exactly soluble driven SU(2) model. The tunneling rate is obtained by solving the time-dependent Schroedinger equation and projecting the exact wave-function on the space of coherent states using the Husimi distribution. The presence of the classical chaotic structures leads to the enormous growth in the tunneling rate. The results suggest the existence of a new mechanism of quantum tunneling, involving transport of the wave-function between stable regions of the classical phase-space due to a coupling with 'chaotic' levels. (author) 17 refs., 13 figs
Flipped and unflipped SU(5) as type IIA flux vacua
Energy Technology Data Exchange (ETDEWEB)
Chen Chingming [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Li Tianjun [Department of Physics and Astronomy, Rutgers University, Piscataway, NJ 08854 (United States) and Institute of Theoretical Physics, Chinese Academy of Sciences, Beijing 100080 (China)]. E-mail: tjli@physics.rutgers.edu; Nanopoulos, Dimitri V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States); Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States); Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)
2006-09-04
On type IIA orientifolds with flux compactifications in supersymmetric AdS vacua, we for the first time construct SU(5) models with three anti-symmetric 10 representations and without symmetric 15 representations. We show that all the pairs of the anti-fundamental 5-bar and fundamental 5 representations can obtain GUT/string-scale vector-like masses after the additional gauge symmetry breaking via supersymmetry preserving Higgs mechanism. Then we have exact three 5-bar , and no other chiral exotic particles that are charged under SU(5) due to the non-Abelian anomaly free condition. Moreover, we can break the SU(5) gauge symmetry down to the SM gauge symmetry via D6-brane splitting, and solve the doublet-triplet splitting problem. Assuming that the extra one (or several) pair(s) of Higgs doublets and adjoint particles obtain GUT/string-scale masses via high-dimensional operators, we only have the MSSM in the observable sector below the GUT scale. Then the observed low energy gauge couplings can be generated via RGE running if we choose the suitable grand unified gauge coupling by adjusting the string scale. Furthermore, we construct the first flipped SU(5) model with exact three 10, and the first flipped SU(5) model in which all the Yukawa couplings are allowed by the global U(1) symmetries.
Remarks on mass and angular momenta for U(1){sup 2}-invariant initial data
Energy Technology Data Exchange (ETDEWEB)
Alaee, Aghil, E-mail: aak818@mun.ca; Kunduri, Hari K., E-mail: hkkunduri@mun.ca [Department of Mathematics and Statistics, Memorial University of Newfoundland, St John’s, Newfoundland and Labrador NL A1C 4P5 (Canada)
2016-03-15
We extend Brill’s positive mass theorem to a large class of asymptotically flat, maximal, U(1){sup 2}-invariant initial data sets on simply connected four dimensional manifolds Σ. Moreover, we extend the local mass angular momenta inequality result [A. Alaee and H. K. Kunduri, Classical Quantum Gravity 32(16), 165020 (2015)] for U(1){sup 2} invariant black holes to the case with nonzero stress energy tensor with positive matter density and energy-momentum current invariant under the above symmetries.
Absolute M1 and E2 Transition Probabilities in 233U
International Nuclear Information System (INIS)
Malmskog, S.G.; Hoejeberg, M.
1967-08-01
Using the delayed coincidence technique, the following half lives have been determined for different excited states in 233 U: T 1/2 (311.9 keV level) = (1.20 ± 0.15) x 10 -10 sec, T 1/2 (340.5 keV level) = (5.2 ± 1.0) x 10 -11 sec, T 1/2 (398.6 keV level) = (5.5 ± 2.0) x 10 -11 sec and T 1/2 (415.8 keV level) -11 sec. From these half life determinations, together with earlier known electron intensities and conversion coefficients, 22 reduced B(Ml) and B(E2) transition probabilities (including 9 limits) have been deduced. The rotational transitions give information on the parameters δ and (g K - g R ) . The experimental M1 and E2 transition rates between members of different bands have been analysed in terms of the predictions of the Nilsson model, taking also pairing correlations and Coriolis coupling effects into account
Strong U{sub A}(1) breaking in radiative {eta} decays
Energy Technology Data Exchange (ETDEWEB)
Takizawa, M.; Nemoto, Y.; Oka, M.
1996-08-01
We study the {eta} {yields} {gamma}{gamma}, {eta} {yields} {gamma}{mu}{sup -}{mu}{sup +} and {eta} {yields} {pi}{sup 0}{gamma}{gamma} decays using an extended three-flavor Nambu-Jona-Lasinio model that includes the `t Hooft instanton induced interaction. We find that the {eta}-meson mass, the {eta} {yields} {gamma}{gamma}, {eta} {yields} {gamma}{mu}{sup -}{mu}{sup +} and {eta} {yields} {pi}{sup 0}{gamma}{gamma} decay widths are in good agreement with the experimental values when the U{sub A}(1) breaking is strong and the flavor SU(3) singlet-octet mixing angle {theta} is about zero. The calculated {eta}{gamma}{gamma}{sup *} transition form factor has somewhat weaker dependence on the squared four-momentum of the virtual photon. The effects of the U{sub A}(1) anomaly on the scalar quark contents in the nucleon, the {Sigma}{sub {pi}N} and {Sigma}{sub KN} terms and the baryon number one and two systems are also studied. (author)
Mohamed, Abdel-Baset A.
2018-05-01
Analytical description for a Su(2)-quantum system interacting with a damped Su(1, 1)-cavity, which is filled with a non-linear Kerr medium, is presented. The dynamics of non-classicality of Su(1, 1)-state is investigated via the negative part of the Wigner function. We show that the negative part depends on the unitary interaction and the Kerr-like medium and it can be disappeared by increasing the dissipation rate and the detuning parameter. The phase space information of the Husimi function and its Wehrl density is very sensitive not only to the coupling to the environment and the unitary interaction but also to the detuning as well as to the Kerr-like medium. The phase space information may be completely erased by increasing the coupling to the environment. The coherence loss of the Su(2)-state is investigated via the Husimi Wehrl entropy. If the effects of the detuning parameter or/and of the Kerr-like medium are combined with the damping effect, the damping effect of the coupling to the environment may be weaken, and the Wehrl entropy is delayed to reach its steady-state value. At the steady-state value, the phase space information and the coherence are quickly lost.
Underground storage tank 291-D1U1: Closure plan
Energy Technology Data Exchange (ETDEWEB)
Mancieri, S.; Giuntoli, N.
1993-09-01
The 291-D1U1 tank system was installed in 1983 on the north side of Building 291. It supplies diesel fuel to the Building 291 emergency generator and air compressor. The emergency generator and air compressor are located southwest and southeast, respectively, of the tank (see Appendix B, Figure 2). The tank system consists of a single-walled, 2,000- gallon, fiberglass tank and a fuel pump system, fill pipe, vent pipe, electrical conduit, and fuel supply and return piping. The area to be excavated is paved with asphalt and concrete. It is not known whether a concrete anchor pad is associated with this tank. Additionally, this closure plan assumes that the diesel tank is below the fill pad. The emergency generator and air compressor for Building 291 and its associated UST, 291-D1U1, are currently in use. The generator and air compressor will be supplied by a temporary above-ground fuel tank prior to the removal of 291-D1U1. An above-ground fuel tank will be installed as a permanent replacement for 291-D1U1. The system was registered with the State Water Resources Control Board on June 27, 1984, as 291-41D and has subsequently been renamed 291-D1U1. Figure 1 (see Appendix B) shows the location of the 291-D1U1 tank system in relation to the Lawrence Livermore National Laboratory (LLNL). Figure 2 (see Appendix B) shows the 291-D1U1 tank system in relation to Building 291. Figure 3 (see Appendix B) shows a plan view of the 291-D1U1 tank system.
Dicty_cDB: Contig-U16093-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q
SU(5)c color model constraints from UA2
International Nuclear Information System (INIS)
Foot, R.; Hernandez, O.F.; Rizzo, T.G.; Ames Lab., IA; Iowa State Univ. of Science and Technology, Ames
1991-01-01
We investigate the possibility that the color gauge group SU(3) may arise as a consequence of the spontaneous symmetry breaking of SU(5) c . In an earlier paper we examine the constraints imposed on the SU(5) c color model by recent measurements of the dijet mass distribution at CDF. We found that the CDF data did not exclude any region of parameter space in the model. Here we consider similar data from UA2 and find that it leads to the constraint Msub(Z') > or approx. 280 GeV. (orig.)
Poincare group, SU(3) and V-A in leptonic decay
International Nuclear Information System (INIS)
Boehm, A.
1975-07-01
From as few assumptions as possible about the relations between the Poincare group, the particle classifying SU(3) and V-A we derive properties of the K/sub l 3 / and K/sub L 2 / decays. From the assumed relation between SU(3) and the Poincare group and the first class condition it follows that the formfactor ratio Xi of K/sub l 3 / decay is Xi = --0.57, and that a value of Xi = 0 is in disagreement with very general and well accepted theoretical assumptions. Assuming universality of V-A, the Cabibbo suppression is derived from the relations between SU(3) and V-A as a consequence of the brokenness of SU(3). (U.S.)
Interpolating Lagrangians and SU(2) gauge theory on the lattice
International Nuclear Information System (INIS)
Buckley, I.R.C.; Jones, H.F.
1992-01-01
We apply the linear δ expansion to non-Abelian gauge theory on the lattice, with SU(2) as the gauge group. We establish an appropriate parametrization and evaluate the average plaquette energy E P to O(δ). As a check on our results, we recover the large-β expansion up to O(1/β 2 ), which involves some O(δ 2 ) contributions. Using these contributions we construct a variant of the 1/β expansion which gives a good fit to the data down to the transition region
Bosonization of the generalized SU(3) Nambu-Jona-Lasinio model in the 1/N expansion
International Nuclear Information System (INIS)
Campos, Francisco Antonio Pena
1995-01-01
The present work consists in a 1/N expansion of extended version of the SU(3) Nambu-Jona-Lasinio model in the context of the Functional Integral. The gap equations, meson propagators, triangle diagram, etc, appear quite naturally as different orders in the expansion. The new features of this approach is the inclusion of high order corrections in the 1/N leading orders, which have never included in the previous one. The method also allows for the construction of a chiral Lagrangian of interacting mesons based on the SU(3) NJL model, here obtained for the first time. (author)
The SU(1, 1) Perelomov number coherent states and the non-degenerate parametric amplifier
Energy Technology Data Exchange (ETDEWEB)
Ojeda-Guillén, D., E-mail: dojedag@ipn.mx; Granados, V. D. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, C.P. 07738 México D. F. (Mexico); Mota, R. D. [Escuela Superior de Ingeniería Mecánica y Eléctrica, Unidad Culhuacán, Instituto Politécnico Nacional, Av. Santa Ana No. 1000, Col. San Francisco Culhuacán, Delegación Coyoacán, C.P. 04430, México D. F. (Mexico)
2014-04-15
We construct the Perelomov number coherent states for an arbitrary su(1, 1) group operation and study some of their properties. We introduce three operators which act on Perelomov number coherent states and close the su(1, 1) Lie algebra. By using the tilting transformation we apply our results to obtain the energy spectrum and eigenfunctions of the non-degenerate parametric amplifier. We show that these eigenfunctions are the Perelomov number coherent states of the two-dimensional harmonic oscillator.
Energy Technology Data Exchange (ETDEWEB)
Ninkovic, M; Bjelanovic, J; Minincic, Z; Komatina, R; Raicevic, J [Institute of Nuclear Sciences Boris Kidric, Vinca, Laboratory for radiation and environmental proetecion, Beograd (Serbia and Montenegro)
1987-12-15
This report contains data and analysis of the of measured sample results collected during radiation protection control in the working environment of the RA reactor. First part contains basic exposure values and statistical review of the the total number of radiation measurements. It includes contents of radioactive gasses and effluents in the air, as well as the level of surface contamination of clothes and uncovered parts of the personnel bodies. Second part deals with the analysis of personnel doses. It was found that the maximum individual dose from external irradiation amounted was less than 6.0 mSv during past 10 months. Individual exposures for 9/10 of the personnel were less than 1/10 of the annual permissible exposure. Data are compared to radiation doses for last year and previous five years. Third part of this annex contains basic data about the quantity of collected radioactive waste, total quantity of contaminated and decontaminated surfaces. During 1987 there have been no accidents that could cause significant contamination of working surfaces and components nor radiation exposure of the personnel. [Serbo-Croat] U ovom izvestaju prikazani su analizirani reprezentativni rezultati sakupljeni u okviru kontrole radne sredine i tehnicke zastite od zracenja reaktora RA. U prvom delu izvestaja izlozeni su podaci o osnovnim vidovima izlaganja zracenju i statisticki pregled ukupnog broja radiacionih merenja. Dati su takodje rezultati merenja sadrzaja radioktivnih gasova i aerosola u vazduhu, kao i stepena kontaminacije povrsina, odece i otkrivenih delova tela osoblja. U drugom delu izvestaja izlozeni su rezultati analize ozracivanja radnog osoblja. Utvrdjeno je da je maksimalna individualna doza spoljasnjeg izlaganja u proteklih 10 meseci bila 6,0 mSv, a da su pojadinacna izlaganja vise od 9/10 radnog osoblja bila manja od 1/10 godisnje granicne vrednosti. Dati su takodje uporedni podaci o ozracivanju osoblja u prethodnoj, kao i u pet proteklih godina, iz kojih
The moduli space of two U(1) instantons on noncommutative $R^4$ and $R^3\\times S^1$
Lee, Kimyeong; Tong, David; Yi, Sangheon
2000-01-01
We employ the ADHM method to derive the moduli space of two instantons in U(1) gauge theory on a noncommutative space. We show by an explicit hyperK\\"ahler quotient construction that the relative metric of the moduli space of two instantons on $R^4$ is the Eguchi-Hanson metric and find a unique threshold bound state. For two instantons on $R^3\\times S^1$, otherwise known as calorons, we give the asymptotic metric and conjecture a completion. We further discuss the relationship of caloron modu...
RIZIČNI ČIMBENICI ZA NASTANAK OŠTEĆENJA DNA ZDJELICE I MOKRAĆNE INKONTINENCIJE U ŽENA
Dijaković, Aleksandar; Orešković, Slavko; Ivanišević, Marina; Juras, Josip; Đelmiš, Josip
2009-01-01
Prolaps zdjeličnih organa i inkontinencija mokraće su stanja koja se dijagnosticiraju u više od 20% žena u perimenopauzi. Inkontinencija mokraće je prema definiciji svako nevoljno mokrenje.1 Prolaps je spuštanje genitalnih organa u rodnicu odnosno izvan rodnice.1 Stresna, urgentna i miješana inkontinencija su najčešći oblici inkontinencije mokraće. Istraživanja su pokazala da se učestalost mokraćne inkontinencije povećava starenjem. Pretilost se također ubraja u rizične čimbenike za nastanak ...
Dicty_cDB: Contig-U13455-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE
U(1) x U(1) x U(1) symmetry of the Kimura 3ST model and phylogenetic branching processes
International Nuclear Information System (INIS)
Bashford, J D; Jarvis, P D; Sumner, J G; Steel, M A
2004-01-01
An analysis of the Kimura 3ST model of DNA sequence evolution is given on the basis of its continuous Lie symmetries. The rate matrix commutes with a U(1) x U(1) x U(1) phase subgroup of the group GL(4) of 4 x 4 invertible complex matrices acting on a linear space spanned by the four nucleic acid base letters. The diagonal 'branching operator' representing speciation is defined, and shown to intertwine the U(1) x U(1) x U(1) action. Using the intertwining property, a general formula for the probability density on the leaves of a binary tree under the Kimura model is derived, which is shown to be equivalent to established phylogenetic spectral transform methods. (letter to the editor)
Exact solutions of sl-boson system in U(2l + 1) reversible O(2l + 2) transitional region
Zhang Xin
2002-01-01
Exact eigen-energies and the corresponding wavefunctions of the interacting sl-boson system in U(2l + 1) reversible O(2l +2) transitional region are obtained by using an algebraic Bethe Ansatz with the infinite dimensional Lie algebraic technique. Numerical algorithm for solving the Bethe Ansatz equations by using mathematical package is also outlined
Cosmological time in (2+1)-gravity
International Nuclear Information System (INIS)
Benedetti, Riccardo; Guadagnini, Enore
2001-01-01
We consider maximal globally hyperbolic flat (2+1)-spacetimes with compact space S of genus g>1. For any spacetime M of this type, the length of time that the events have been in existence is M defines a global time, called the cosmological time CT of M, which reveals deep intrinsic properties of spacetime. In particular, the past/future asymptotic states of the cosmological time recover and decouple the linear and the translational parts of the ISO(2,1)-valued holonomy of the flat spacetime. The initial singularity can be interpreted as an isometric action of the fundamental group of S on a suitable real tree. The initial singularity faithfully manifests itself as a lack of smoothness of the embedding of the CT level surfaces into the spacetime M. The cosmological time determines a real analytic curve in the Teichmueller space of Riemann surfaces of genus g, which connects an interior point (associated to the linear part of the holonomy) with a point on Thurston's natural boundary (associated to the initial singularity)
Cosmological time in /(2+1)-gravity
Benedetti, Riccardo; Guadagnini, Enore
2001-10-01
We consider maximal globally hyperbolic flat (2+1)-spacetimes with compact space S of genus g>1. For any spacetime M of this type, the length of time that the events have been in existence is M defines a global time, called the cosmological time CT of M, which reveals deep intrinsic properties of spacetime. In particular, the past/future asymptotic states of the cosmological time recover and decouple the linear and the translational parts of the ISO(2,1)-valued holonomy of the flat spacetime. The initial singularity can be interpreted as an isometric action of the fundamental group of S on a suitable real tree. The initial singularity faithfully manifests itself as a lack of smoothness of the embedding of the CT level surfaces into the spacetime M. The cosmological time determines a real analytic curve in the Teichmüller space of Riemann surfaces of genus g, which connects an interior point (associated to the linear part of the holonomy) with a point on Thurston's natural boundary (associated to the initial singularity).
Higgs phenomenology in the minimal S U (3 )L×U (1 )X model
Okada, Hiroshi; Okada, Nobuchika; Orikasa, Yuta; Yagyu, Kei
2016-07-01
We investigate the phenomenology of a model based on the S U (3 )c×S U (3 )L×U (1 )X gauge theory, the so-called 331 model. In particular, we focus on the Higgs sector of the model which is composed of three S U (3 )L triplet Higgs fields and is the minimal form for realizing a phenomenologically acceptable scenario. After the spontaneous symmetry breaking S U (3 )L×U (1 )X→S U (2 )L×U (1 )Y , our Higgs sector effectively becomes that with two S U (2 )L doublet scalar fields, in which the first- and the second-generation quarks couple to a different Higgs doublet from that which couples to the third-generation quarks. This structure causes the flavor-changing neutral current mediated by Higgs bosons at the tree level. By taking an alignment limit of the mass matrix for the C P -even Higgs bosons, which is naturally realized in the case with the breaking scale of S U (3 )L×U (1 )X much larger than that of S U (2 )L×U (1 )Y, we can avoid current constraints from flavor experiments such as the B0-B¯ 0 mixing even for the Higgs bosons masses that are O (100 ) GeV . In this allowed parameter space, we clarify that a characteristic deviation in quark Yukawa couplings of the Standard Model-like Higgs boson is predicted, which has a different pattern from that seen in two Higgs doublet models with a softly broken Z2 symmetry. We also find that the flavor-violating decay modes of the extra Higgs boson, e.g., H /A →t c and H±→t s , can be dominant, and they yield the important signature to distinguish our model from the two Higgs doublet models.
The search for a realistic flipped SU(5) string model
Energy Technology Data Exchange (ETDEWEB)
Lopez, J.L. (Center for Theoretical Physics, Texas A and M Univ., College Station, TX (United States) Astroparticle Physics Group, Houston Advanced Research Center (HARC), The Woodlands, TX (United States)); Nanopoulos, D.V. (Center for Theoretical Physics, Texas A and M Univ., College Station, TX (United States) Astroparticle Physics Group, Houston Advanced Research Center (HARC), The Woodlands, TX (United States)); Yuan, K. (Department of Physics and Astronomy, University of Alabama, Tuscaloosa, AL (United States))
1993-07-05
We present an extensive search for a class of flipped SU(5) models built within the free fermionic formulation of the heterotic string. We describe a set of algorithms which constitute the basis for a computer program capable of generating systematically the massless spectrum and the superpotential of all possible models within the class we consider. Our search through the huge parameter space to be explored is simplified considerably by the constraint of N=1 spacetime supersymmetry and the need for extra Q, anti Q representations beyond the standard ones in order to possibly achieve string gauge coupling unification at scales of O(10[sup 18] GeV). Our results are remarkably simple and evidence the large degree of redundancy in this kind of constructions. We find one model with gauge group SU(5)xU(1)sub(Y tilde)xSO(10)[sub h]xSU(4)[sub h]xU(1)[sup 5] and fairly acceptable phenomenological properties. We study the D- and F-flatness constraints and the symmetry breaking pattern in this model and conclude that string gauge coupling unification is quite possible. (orig.)
International Nuclear Information System (INIS)
Ginter, D.S.; Ginter, M.L.
1988-01-01
We show that a minimal parameter coupled channel model based on eigenquantum defect theory can reproduce quantitatively the known Rydberg structures associated with six channels of nsσ,ndλ( 3 Σ + /sub u/, 3 Σ + /sub u/, 3 Pi/sub u/, 3 Δ/sub u/) v = 0 ancestry in He 2 . Except for a few levels affected by accidental perturbations, these extensive level structures can be reproduced to within average experimental uncertainties. Previously unreported spectral analyses for transitions to the b 3 Pi/sub g/ state from rotational levels in the nl channel segments with n = 12--18 are included in this work. These spectral transitions were predicted and observed in the early stages of this investigation and were used to determine a number of new energy levels for the n = 3--18 data base used in subsequent calculations. The model uses a U matrix modified slightly from a Hund's case (b) to case (d) transformation and energy dependent eigenquantum defects μ/sub α/. Discussed in detail is a specific 14 parameter representation for ∼500 energy levels in which 2 parameters modify U to include interactions between ns and nd and 12 parameters describe the variation of the μ/sub α/'s with energy
Fermion unification model based on the intrinsic SU(8 symmetry of a generalized Dirac equation
Directory of Open Access Journals (Sweden)
Eckart eMarsch
2015-10-01
Full Text Available A natural generalization of the original Dirac spinor into a multi-component spinor is achieved, which corresponds to the single lepton and the three quarks of the first family of the standard model of elementary particle physics. Different fermions result from similarity transformations of the Dirac equation, but apparently there can be no more fermions according to the maximal multiplicity revealed in this study. Rotations in the fermion state space are achieved by the unitary generators of the U(1 and the SU(3 groups, corresponding to quantum electrodynamics (QED based on electric charge and chromodynamics (QCD based on colour charge. In addition to hypercharge the dual degree of freedom of hyperspin emerges, which occurs due to the duplicity implied by the two related (Weyl and Dirac representations of the Dirac equation. This yields the SU(2 symmetry of the weak interaction, which can be married to U(1 to generate the unified electroweak interaction as in the standard model. Therefore, the symmetry group encompassing all the three groups mentioned above is SU(8, which can accommodate and unify the observed eight basic stable fermions.
Dicty_cDB: Contig-U06384-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063
Paauglių delinkventinio elgesio sąsajos su saviverte ir empatija
Kiškionytė, Ingrida
2014-01-01
Tyrimo objektas: paauglių delinkventinio elgesio sąsajos su saviverte ir empatija. Tyrimo tikslas: nustatyti paauglių delinkventinio elgesio, savivertės ir empatijos sąsajas. Tyrimo uždaviniai: 1. Ištirti paauglių delinkventinio elgesio ypatumus. 2. Nustatyti paauglių savivertės rodiklius. 3. Ištirti paauglių empatijos rodiklius. 4. Palyginti merginų ir vaikinų delinkventiško elgesio, savivertės, empatijos rodiklius. Hipotezės. 1. Tikėtina, kad kuo didesni delin...
Crnić, Kristina
2017-01-01
Bruksizam se definira kao parafunkcijsko škripanje ili stiskanje zubima. Etiologija je nejasna, ali se danas smatra da postoji više uzročnih faktora. Među primarnim faktorima smatra se psihološki stres djeteta. Postoji manjak informacija o bruksizmu u djece zbog komplikacija provođenja istraživanja jer su ispitanici maloljetnici. Razne su metode koje se koriste u dijagnozi bruksizma. Uključuju stručno konstruirane upitnike i intervjue namijenjene i djeci i roditeljima te klinički pregled ...
Dicty_cDB: Contig-U11195-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN
Dicty_cDB: Contig-U11141-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI
SU(2) Gauge Theory with Two Fundamental Flavours
DEFF Research Database (Denmark)
Arthur, Rudy; Drach, Vincent; Hansen, Martin
2016-01-01
We investigate the continuum spectrum of the SU(2) gauge theory with $N_f=2$ flavours of fermions in the fundamental representation. This model provides a minimal template which is ideal for a wide class of Standard Model extensions featuring novel strong dynamics that range from composite...... (Goldstone) Higgs theories to several intriguing types of dark matter candidates, such as the SIMPs. We improve our previous lattice analysis [1] by adding more data at light quark masses, at two additional lattice spacings, by determining the lattice cutoff via a Wilson flow measure of the $w_0$ parameter...
N = 1 SU(2) supersymmetric Yang-Mills theory on the lattice with light dynamical Wilson gluinos
International Nuclear Information System (INIS)
Demmouche, Kamel
2009-01-01
The supersymmetric Yang-Mills (SYM) theory with one supercharge (N=1) and one additional Majorana matter-field represents the simplest model of supersymmetric gauge theory. Similarly to QCD, this model includes gauge fields, gluons, with color gauge group SU(N c ) and fermion fields, describing the gluinos. The non-perturbative dynamical features of strongly coupled supersymmetric theories are of great physical interest. For this reason, many efforts are dedicated to their formulation on the lattice. The lattice regularization provides a powerful tool to investigate non-perturbatively the phenomena occurring in SYM such as confinement and chiral symmetry breaking. In this work we perform numerical simulations of the pure SU(2) SYM theory on large lattices with small Majorana gluino masses down to about m g approx 115 MeV with lattice spacing up to a ≅0.1 fm. The gluino dynamics is simulated by the Two-Step Multi-Boson (TSMB) and the Two-Step Polynomial Hybrid Monte Carlo (TS-PHMC) algorithms. Supersymmetry (SUSY) is broken explicitly by the lattice and the Wilson term and softly by the presence of a non-vanishing gluino mass m g ≠0. However, the recovery of SUSY is expected in the infinite volume continuum limit by tuning the bare parameters to the SUSY point in the parameter space. This scenario is studied by the determination of the low-energy mass spectrum and by means of lattice SUSY Ward-Identities (WIs). (orig.)
On the unitarity of string propagation on SU(1,1)
International Nuclear Information System (INIS)
Mohammedi, N.
1989-12-01
We discuss the consistency (unitarity) of string propagation on the non-compact group SU(1,1) x G c and find the restrictions on the level of the Kac-Moody algebra for this propagation to be unitary. We also suggest some modifications to the Virasoro generators and obtain a manifestly unitary string theory. (author). 10 refs
Likelihood Analysis of Supersymmetric SU(5) GUTs
Bagnaschi, E.
2017-01-01
We perform a likelihood analysis of the constraints from accelerator experiments and astrophysical observations on supersymmetric (SUSY) models with SU(5) boundary conditions on soft SUSY-breaking parameters at the GUT scale. The parameter space of the models studied has 7 parameters: a universal gaugino mass $m_{1/2}$, distinct masses for the scalar partners of matter fermions in five- and ten-dimensional representations of SU(5), $m_5$ and $m_{10}$, and for the $\\mathbf{5}$ and $\\mathbf{\\bar 5}$ Higgs representations $m_{H_u}$ and $m_{H_d}$, a universal trilinear soft SUSY-breaking parameter $A_0$, and the ratio of Higgs vevs $\\tan \\beta$. In addition to previous constraints from direct sparticle searches, low-energy and flavour observables, we incorporate constraints based on preliminary results from 13 TeV LHC searches for jets + MET events and long-lived particles, as well as the latest PandaX-II and LUX searches for direct Dark Matter detection. In addition to previously-identified mechanisms for bringi...
Dicty_cDB: Contig-U01204-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN
Vibrationally resolved photoionization of the 1σg and 1σu shells of N2 molecule
International Nuclear Information System (INIS)
Semenov, S K; Cherepkov, N A; Matsumoto, M; Fujiwara, K; Ueda, K; Kukk, E; Tahara, F; Sunami, T; Yoshida, H; Tanaka, T; Nakagawa, K; Kitajima, M; Tanaka, H; De Fanis, A
2006-01-01
Theoretical and experimental study of vibrationally resolved partial photoionization cross sections and angular asymmetry parameter β for the 1σ g and 1σ u shells of N 2 molecule in the region of the σ* shape resonance is reported. The measurements were made at the synchrotron radiation facility SPring-8 in Japan. The calculations in the random phase approximation have been performed using the relaxed core Hartree-Fock wavefunctions with the fractional charge of the ion core equal to 0.7. With its help, the role of interchannel coupling between the closely spaced 1σ g and 1σ u shells was studied. The experiment demonstrates the existence of a correlational maximum in the 1σ u shell photoionization cross section induced by the σ* shape resonance in the 1σ g shell. This maximum reveals itself even more clearly in the angular asymmetry parameter β for the v' = 0 and v' = 1 vibrational states of the ion. The calculation in the random phase approximation gives a consistent interpretation of the experimental data
Dicty_cDB: Contig-U12073-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig
MENADŽMENT LJUDSKIH POTENCIJALA U VELIKIM HRVATSKIM PODUZEĆIMA
Pološki Vokić, Nina
2004-01-01
Budući da je menadžment ljudskih potencijala osnovica za ostvarivanje konkurentskih prednosti uz pomoć ljudi i zato što je značajno povezan s uspješnošću organizacija, u radu se nastojala istražiti važnost i razvijenost te funkcije u velikim hrvatskim poduzećima. U radu su postavljene dvije hipoteze: (1) da hrvatska poduzeća nemaju razvijenu praksu MLJP (menadžment ljudskih potencijala) i (2) da postoje aktivnosti MLJP, provođenje kojih je značajno povezano s općom uspješnošću poduzeća; obje ...
Zimmerman, Christina
2011-11-01
(1) In Canadian office practices, physicians spent 2.2 hours per week interacting with payers, nurses spent 2.5 hours, and clerical staff spent 15.9 hours. In U.S. practices, physicians spent 3.4 hours per week interacting with payers, nurses spent 20.6 hours, and clerical staff spent 53.1 hours. (2) Canadian physician practices spent $22,205 per physician per year on interactions with health plans. U.S. physician practices spent $82,975 per physician per year. (3) U.S. physician practices spend $60,770 per physician per year more (approximately four times as much) than their Canadian counterparts.
International Nuclear Information System (INIS)
Yahiaoui, Sid-Ahmed; Bentaiba, Mustapha
2014-01-01
A new SU(1,1) position-dependent effective mass coherent states (PDEM CS) related to the shifted harmonic oscillator (SHO) are deduced. This is accomplished by applying a similarity transformation to the generally deformed oscillator algebra (GDOA) generators for PDEM systems and a new set of operators that close the su(1,1) Lie algebra are constructed, being the PDEM CS of the basis for its unitary irreducible representation. From the Lie algebra generators, we evaluate the uncertainty relationship for a position and momentum-like operators in the PDEM CS and show that it is minimized in the sense of Barut–Girardello CS. We prove that the deduced PDEM CS preserve the same analytical form than those of Glauber states. As an illustration of our procedure, we depicted the 2D-probability density in the PDEM CS for SHO with the explicit form of the mass distribution with no singularities. (paper)
Dicty_cDB: Contig-U15323-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK
Directory of Open Access Journals (Sweden)
Bojan Goja
2014-12-01
izradi dekorativnog okvira i inicijala, u prvom redu omogućuje prikaz Sv. Aurelija Augustina te likovi dvaju anđela grbonoša karakterističnih tipologija koje pronalazimo u brojnim majstorovim radovima. Istovjetni likovi anđela pojavljuju se u donjoj margini djela Il Tesoro Brunetta Latinija (Gerardus de Lisa, Treviso, 1474.; Cambridge, Mass, Harvard, Houghton Library, Inc. 6459, c. 7. Lik Sv. Aurelija Augustina pokazuje izrazite sličnosti sa likom dominikanskog redovnika, umetnutog unutar inicijala „O“ na način littera historiata u djelu Supplementum Nicolausa de Auximo (Franciscus Renner et Nicolaus de Frankofordia, Venecija, 1474.; Biblioteka Marciana, Inc. Ven. 494, c.2. Istovjetni se anđeli i putti mogu pronaći i u donjim marginama Strabonove Geografije (Minneapolis, Univ. of Minnesotta Library, Ms. 1460/f St., c.1, te u dvije Plinijeve Historije Naturalis (Venecija, N. Jenson, 1472., Pariz, Bibliothèque Nationale, Vèlins 498 i Venecija, N. Jenson, 1472., San Marino, CA, Huntington Library, n. 2289. Lijep primjer za usporedbu je i Biblia Latina (Franciscus Renner & Nicolaus de Frankfordia, 1475., Dallas, Texas, Southern Methodist University, Bridwell Library jer ima naslovnu stranicu oblikovanu na sličan način kao inkunabula iz Kraja. U liku Sv. Jeronima koji je prikazan unutar littera historiata pronalazimo sve one brojne i karakteristične morellijanske detalje bitne za atribuciju oslika inkunabule iz Kraja Maestru di Pico. Izrazite sličnosti u oblikovanju svetačkih likova, fitomorfnih inicijala i dekorativnih okvira nalazimo i u iluminacijama dvaju Psaltira (Venecija, Biblioteca Querini Stampaglia, Inc. 6 i Siena, Biblioteca S. Bernardino del Convento dell'Osservanza i naslovnicu Psaltira iz jednog Brevijara (Pariz, Bibliothèque Ste-Geneviève, OE XV 147 Rés. Svecima i anđelima karakterističnih tipologija ukrašena su i tri primjerka iz serije Commissioni rađena za dužda Agostina Barbariga (Commissione del doge Agostino Barbarigo a
A K-theory anomaly free supersymmetric flipped SU(5) model from intersecting branes
Energy Technology Data Exchange (ETDEWEB)
Chen, C.-M. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: cchen@physics.tamu.edu; Kraniotis, G.V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: kraniotis@physics.tamu.edu; Mayes, V.E. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: eric@physics.tamu.edu; Nanopoulos, D.V. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States) and Astroparticle Physics Group, Houston Advanced Research Center (HARC), Mitchell Campus, Woodlands, TX 77381 (United States) and Academy of Athens, Division of Natural Sciences, 28 Panepistimiou Avenue, Athens 10679 (Greece)]. E-mail: dimitri@physics.tamu.edu; Walker, J.W. [George P. and Cynthia W. Mitchell Institute for Fundamental Physics, Texas A and M University, College Station, TX 77843 (United States)]. E-mail: jwalker@physics.tamu.edu
2005-10-06
We construct an N=1 supersymmetric three-family flipped SU(5) model from type IIA orientifolds on T{sup 6}/(Z{sub 2}xZ{sub 2}) with D6-branes intersecting at general angles. The model is constrained by the requirement that Ramond-Ramond tadpoles cancel, the supersymmetry conditions, and that the gauge boson coupled to the U(1){sub X} factor does not get a string-scale mass via a generalised Green-Schwarz mechanism. The model is further constrained by requiring cancellation of K-theory charges. The spectrum contains a complete grand unified and electroweak Higgs sector, however the latter in a non-minimal number of copies. In addition, it contains extra matter both in bi-fundamental and vector-like representations as well as two copies of matter in the symmetric representation of SU(5)
All unitary ray representations of the conformal group SU(2,2) with positive energy
International Nuclear Information System (INIS)
Mack, G.
1975-12-01
We find all those unitary irreducible representations of the infinitely - sheeted covering group G tilde of the conformal group SU(2,2)/Z 4 which have positive energy P 0 >= O. They are all finite component field representations and are labelled by dimension d and a finite dimensional irreducible representation (j 1 , j 2 ) of the Lorentz group SL(2C). They all decompose into a finite number of unitary irreducible representations of the Poincare subgroup with dilations. (orig.) [de
Dicty_cDB: Contig-U10291-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10291-1 no gap 932 4 3203354 3204286 PLUS 2 2 U10291 0 0 1 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10291-1 Contig ID Contig-U10291-1 Contig update 2002. 9.13 Contig sequence >Contig-U10291-1 (Contig...-U10291-1Q) /CSM_Contig/Contig-U10291-1Q.Seq.d GTAAAGGTTTTATGTGTATATTTTTTAATGACCTTTTCGAATTAGTTTCA ...CAAAATAGATTAAATCTTAGTTACTCTCATGC TAATCAATATGTTGAGAGTTTTCCATCACAAATGTTATCAACAATTGCAA AATTCATTAGTTTCTTATTTGGTT...SLMYSL FNYIFDENGIIKSEFQDPTQRKRLSRGLSRRFMTIGILGLFTTPFIFFFLLINFFFEYAE ELKNRPGSLFSREWSPLARWEFRELNELPHYFQNRLNLSY
Lusztig symmetries and Poincare-Birkhoff-Witt basis for wU{sub r,s}{sup d}(osp(1|2n))
Energy Technology Data Exchange (ETDEWEB)
Liu, Junli [Mathematics and Information College, Langfang Teachers' College, Langfang 065000 (China); College of Applied Sciences, Beijing University of Technology, Beijing 100124 (China); Yang, Shilin [College of Applied Sciences, Beijing University of Technology, Beijing 100124 (China)
2013-12-15
We investigate a new kind of two-parameter weak quantized superalgebra wU{sub r,s}{sup d}(osp(1|2n)), which is a weak Hopf superalgebra. It has a homomorphic image which is isomorphic to the usual two-parameter quantum superalgebra U{sub r,s}(osp(1|2n)) of osp(1|2n). We also discuss the basis of wU{sub r,s}{sup d}(osp(1|2n)) by Lusztig's symmetries.
Energy Technology Data Exchange (ETDEWEB)
Markovic, H [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1962-07-15
The objective of the measurements was determining the neutron flux in the RA reactor core. Since the number of fuel channels is increased from 56 to 68 within the VISA-2 project, it was necessary to attain criticality of the RA reactor and measure the neutron flux properties. The 'program of RA reactor start-up' has been prepared separately and it is included in this report. Measurements were divided in two phases. First phase was measuring of the neutron flux after the criticality was achieved but at zero power. During phase two measurements were repeated at several power levels, at equilibrium xenon poisoning. This report includes experimental data of flux distributions and absolute values of the thermal and fast neutron flux in the RA reactor experimental channels and values of cadmium ratio for determining the neutron epithermal flux. Data related to calibration of regulatory rods for cold un poisoned core are included. [Serbo-Croat] Svrha merenja je odredjivanje neutronskog fluksa u reaktoru RA. S obzirom na uvecani broj tehnoloskih kanala of 56 na 68 u vezi projekta VISA-2, bilo je potrebno ponovo dovesti reaktora RA do kriticnosti i izvrsiti merenja karakteristika fluksa neutrona. Posebno je pripremljen 'program pustanja u pogon reaktora RA', koji je sadrzan u ovom dokumentu. Program merenja bio je podeljen na dve faze. Prva faza je merenje fluksa pre podizanju reaktora na nominalnu snagu. Slicna merenja vrsena su i na vecim snagama u drugoj fazi, pod uslovima ravnoteznog zatrovanja reaktora ksenonom, jer se tada pokazuju izvesne promene u odgovarajucim karakteristikama fluksa neutrona. Ovaj izvestaj sadrzi merene vrednosti raspodele fluksa i apsolutne vrednosti termalnih i brzih neutrona kao i kadmijumskih odnosa koji su korisceni za odredjivanje fluksa epitermalnih neutrona. Opisana je kalibracija regulacionih sipki za hladan nezatrovan reaktor.
Real-Time Speciation of Uranium During Active Bioremediation and U(IV) Reoxidation
International Nuclear Information System (INIS)
Komlos, J.; Mishra, B.; Lanzirotti, A.; Myneni, S.; Jaffe, P.
2008-01-01
The biological reduction of uranium from soluble U(VI) to insoluble U(IV) has shown potential to prevent uranium migration in groundwater. To gain insight into the extent of uranium reduction that can occur during biostimulation and to what degree U(IV) reoxidation will occur under field relevant conditions after biostimulation is terminated, X-ray absorption near edge structure (XANES) spectroscopy was used to monitor: (1) uranium speciation in situ in a flowing column while active reduction was occurring; and (2) in situ postbiostimulation uranium stability and speciation when exposed to incoming oxic water. Results show that after 70 days of bioreduction in a high (30 mM) bicarbonate solution, the majority (>90%) of the uranium in the column was immobilized as U(IV). After acetate addition was terminated and oxic water entered the column, in situ real-time XANES analysis showed that U(IV) reoxidation to U(VI) (and subsequent remobilization) occurred rapidly (on the order of minutes) within the reach of the oxygen front and the spatial and temporal XANES spectra captured during reoxidation allowed for real-time uranium reoxidation rates to be calculated.
Dicty_cDB: Contig-U15462-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig
Masses and mixing angles in SU(5) gauge model
International Nuclear Information System (INIS)
Nandi, S.; Tanaka, K.
1979-01-01
Georgi and Jarlskog mass relations m/sub μ/m/sub e/ = 9m/sub s//m/sub d/, m/sub b/ = m/sub tau/ are obtained above the grand unification mass M = 10 15 GeV with two approx. 5's and one approx. 45 Higgs representations of SU(5) and a discrete symmetry. In the lowest order, the Kobayashi-Maskawa angles are found to be s 2 = -(m/sub c//m/sub t/) /sup 1/2/ and s 3 = -(m/sub u//m/sub t/) /sup 1/2//s 1 , where s 1 is the sine of the Cabibbo angle. The CP violation is considered, and the b quark decays predominantly into c quarks with lifetime of tau/sub b/ approx. equal to 10 -13 s for m/sub t/ = 25 GeV
Dicty_cDB: Contig-U13680-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie
Deng, Huai; Cai, Weili; Wang, Chao; Lerach, Stephanie; Delattre, Marion; Girton, Jack; Johansen, Jørgen; Johansen, Kristen M.
2010-01-01
The essential JIL-1 histone H3S10 kinase is a key regulator of chromatin structure that functions to maintain euchromatic domains while counteracting heterochromatization and gene silencing. In the absence of the JIL-1 kinase, two of the major heterochromatin markers H3K9me2 and HP1a spread in tandem to ectopic locations on the chromosome arms. Here we address the role of the third major heterochromatin component, the zinc-finger protein Su(var)3-7. We show that the lethality but not the chromosome morphology defects associated with the null JIL-1 phenotype to a large degree can be rescued by reducing the dose of the Su(var)3-7 gene and that Su(var)3-7 and JIL-1 loss-of-function mutations have an antagonistic and counterbalancing effect on position-effect variegation (PEV). Furthermore, we show that in the absence of JIL-1 kinase activity, Su(var)3-7 gets redistributed and upregulated on the chromosome arms. Reducing the dose of the Su(var)3-7 gene dramatically decreases this redistribution; however, the spreading of H3K9me2 to the chromosome arms was unaffected, strongly indicating that ectopic Su(var)3-9 activity is not a direct cause of lethality. These observations suggest a model where Su(var)3-7 functions as an effector downstream of Su(var)3-9 and H3K9 dimethylation in heterochromatic spreading and gene silencing that is normally counteracted by JIL-1 kinase activity. PMID:20457875
Dicty_cDB: Contig-U09640-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig
Dicty_cDB: Contig-U11342-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN
Special operations in the heavy water system, III-2; III-2 Posebne operacije u sistemu teske vode
Energy Technology Data Exchange (ETDEWEB)
NONE
1989-07-01
Special operations in the heavy water system described in this chapter are as follows: treatment, drainage and pouring of heavy water, emptying of the heavy water system, cleaning and vacuuming of the heavy water system. [Serbo-Croat] Posebne operacije u sistemu teske vode opisane u ovom poglavlju su: tretiranje, dreniranje i razlivanje teske vode, praznjenje sistema teske vode, 'ispiranje' i vakumiranje sistema teske vode.
Directory of Open Access Journals (Sweden)
Angela N Brooks
Full Text Available Although recurrent somatic mutations in the splicing factor U2AF1 (also known as U2AF35 have been identified in multiple cancer types, the effects of these mutations on the cancer transcriptome have yet to be fully elucidated. Here, we identified splicing alterations associated with U2AF1 mutations across distinct cancers using DNA and RNA sequencing data from The Cancer Genome Atlas (TCGA. Using RNA-Seq data from 182 lung adenocarcinomas and 167 acute myeloid leukemias (AML, in which U2AF1 is somatically mutated in 3-4% of cases, we identified 131 and 369 splicing alterations, respectively, that were significantly associated with U2AF1 mutation. Of these, 30 splicing alterations were statistically significant in both lung adenocarcinoma and AML, including three genes in the Cancer Gene Census, CTNNB1, CHCHD7, and PICALM. Cell line experiments expressing U2AF1 S34F in HeLa cells and in 293T cells provide further support that these altered splicing events are caused by U2AF1 mutation. Consistent with the function of U2AF1 in 3' splice site recognition, we found that S34F/Y mutations cause preferences for CAG over UAG 3' splice site sequences. This report demonstrates consistent effects of U2AF1 mutation on splicing in distinct cancer cell types.
Dicty_cDB: Contig-U15036-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG
Dicty_cDB: Contig-U01997-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l
Quantum tunneling in the periodically driven SU(2) model
International Nuclear Information System (INIS)
Arvieu, R.
1991-01-01
The tunneling rate is investigated in the quantum and classical limits using an exactly soluble, periodically driven SU(2) model. The tunneling rate is obtained by solving the time-dependent Schroedinger equation and projecting the exact wave-function on the space of coherent states using the Husimi distribution. The oscillatory, coherent tunneling of the wave-function between two Hartree-Fock minima is observed. The driving plays an important role increasing the tunneling rate by orders of magnitude as compared to the semiclassical results. This is due to the dominant role of excited states in the driven quantum tunneling. (author) 15 refs., 4 figs
Dicty_cDB: Contig-U09720-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK
Dicty_cDB: Contig-U09379-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn
Majore, Madara
2013-01-01
Bakalaura darba mērķis ir novērtēt darba organizācijas līmeni Cēsu nodaļā un izstrādāt priekšlikumus tās pilnveidošanai. Darba mērķu sasniegšanai autore ir izvirzījusi uzdevumus: analizēt Cēsu nodaļas darba saturu un darba īpatnības, noskaidrot darba organizācijas lomu mūsdienu uzņēmumā, novērtēt darba dalīšanu un darba apstākļus Cēsu nodaļā un analizēt profesionālās attīstības vadīšanu Cēsu nodaļā un izstrādāt tās pilnveidošanas virzienus. Darbā autore raksturo uzņēmuma darbības saturu...
Dicty_cDB: Contig-U03323-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC
The standard model on non-commutative space-time
International Nuclear Information System (INIS)
Calmet, X.; Jurco, B.; Schupp, P.; Wohlgenannt, M.; Wess, J.
2002-01-01
We consider the standard model on a non-commutative space and expand the action in the non-commutativity parameter θ μν . No new particles are introduced; the structure group is SU(3) x SU(2) x U(1). We derive the leading order action. At zeroth order the action coincides with the ordinary standard model. At leading order in θ μν we find new vertices which are absent in the standard model on commutative space-time. The most striking features are couplings between quarks, gluons and electroweak bosons and many new vertices in the charged and neutral currents. We find that parity is violated in non-commutative QCD. The Higgs mechanism can be applied. QED is not deformed in the minimal version of the NCSM to the order considered. (orig.)
Is neutralino dark matter compatible with flipped SU(5) models
Energy Technology Data Exchange (ETDEWEB)
McDonald, J.
1989-07-13
We consider the possibility that the lightest supersymmetric particle in flipped SUSY SU(5)xU(1) models is cosmologically stable and corresponds to a neutralino. Previous studies of dark matter in flipped SUSY SU(5) models have suggested that the decay of the oscillations of the SU(5) breaking scalar field would result in too many neutralinos, if they are stable. We show that it is possible for an acceptable density of neutralinos to occur in the case where the neutralino corresponds to a light photino, if the temperature at the end of the oscillation dominated period is
Dicty_cDB: Contig-U15573-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen
Dicty_cDB: Contig-U16467-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG
Broken SU(3) antidecuplet for Θ+ and Ξ3/2
International Nuclear Information System (INIS)
Pakvasa, Sandip; Suzuki, Mahiko
2004-01-01
If the narrow exotic baryon resonances Θ + (1540) and Ξ 3/2 are members of the J P = 1/2 + antidecuplet with N*(1710), the octet-antidecuplet mixing is required not only by the mass spectrum but also by the decay pattern of N*(1710). This casts doubt on validity of the Θ + mass prediction by the chiral soliton model. While all pieces of the existing experimental information point to a small octet-decuplet mixing, the magnitude of mixing required by the mass spectrum is not consistent with the value needed to account for the hadronic decay rates. The discrepancy is not resolved even after the large experimental uncertainty is taken into consideration. We fail to find an alternative SU(3) assignment even with different spin-parity assignment. When we extend the analysis to mixing with a higher SU(3) multiplet, we find one experimentally testable scenario in the case of mixing with a 27-plet
Kreativnost verbalnog i neverbalnog koda reklamnih poruka banaka koje posluju u Hrvatskoj
Barić, Branka; Jurčić, Antonija
2016-01-01
Oglašavanje je jedan od ključnih načina komuniciranja marketera i tržišta, a promidžbene poruke dio su naše svakodnevice. U Republici Hrvatskoj su u 2015. g. poslovale 1 središnja banka, 27 banaka, 1 štedna banka, 5 stambenih štedionica. Unatoč mnogobrojnim nastojanjima i pritiscima na banke, presudi Vrhovnog suda RH-u u ”slučaju švicarac”, nemoguće je dobiti informaciju o novčanim iznosima koje banke godišnje troše na reklamno oglašavanje. Budući da reklame imaju utjecaj na svakoga od nas te...
Kinetics and thermodynamics of the dissolution of Th1-xMxO2 solid solutions (M = U, Pu)
International Nuclear Information System (INIS)
Hubert, S.; Heisbourg, G.; Dacheux, N.; Moisy, Ph.; Purans, J.
2004-01-01
Kinetics of the dissolution of Th 1-x M x O 2 (M = U, Pu) solid solutions was investigated as a function of several chemical parameters such as pH, substitution ratio, temperature, ionic strength, and electrolyte. Several compositions of Th 1-x U x O 2 and Th 1-x Pu x O 2 were synthesized and characterized before and after leaching by using several methods such as XRD, EXAFS, BET, PIXE, SEM, and XPS. Leaching tests were performed in nitric, hydrochloric or sulfuric media and groundwater. The normalized dissolution rates were evaluated for Th 1-x U x O 2 , and Th 0.88 Pu 0.12 O 2 leading to the determination of the partial order related to the proton concentration, n, and to the corresponding normalized dissolution rate constant at pH = 0, k'T. While for Th enriched solids, the solid solutions Th 1-x U x O 2 have the same dissolution behaviour than ThO 2 with a partial order n ∼ 0.3, in the case of uranium enriched solids, Th 1-x U x O 2 has the same dissolution behaviour than UO 2 with a partial order of n = 1, indicating that uranium oxidation rate becomes the limiting step of the dissolution process. The stoichiometry of the release of both actinides (U or Pu, Th) was verified until the precipitation of thorium occurred in the leachate for pH > 2, while uranium was released in the solution as an uranyl form. For uranium enriched solid solutions, thermodynamic equilibrium was reached after 100 days, and solubility constant of secondary phase was determined. In the case of Th 1-x Pu x O 2 , the dissolution behaviour is similar to that of ThO 2 , but only kinetic aspect of the dissolution can be studied. From the analysis of XPS and EXAFS data on leached and un-leached Th 1-x U x O 2 samples, the dissolution mechanism of solid solutions was explained and will be discussed. The role of the electrolytes on the dissolution of the solid solutions is discussed. Kinetics parameters of dissolution are also given in groundwater and in neutral media
Dicty_cDB: Contig-U10335-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG
Dicty_cDB: Contig-U10837-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI
International Nuclear Information System (INIS)
Teh, R.
1989-07-01
Here I would like to show a general way of writing the gauge potentials A μ α for which the SU(2) Yang-Mills equations of motion can be simplified and become solvable. A number of exact solutions can be obtained from these simplified equations of motion. (author). 14 refs
Dynamical Symmetry Breaking of Extended Gauge Symmetries
Appelquist, Thomas; Shrock, Robert
2003-01-01
We construct asymptotically free gauge theories exhibiting dynamical breaking of the left-right, strong-electroweak gauge group $G_{LR} = {\\rm SU}(3)_c \\times {\\rm SU}(2)_L \\times {\\rm SU}(2)_R \\times {\\rm U}(1)_{B-L}$, and its extension to the Pati-Salam gauge group $G_{422}={\\rm SU}(4)_{PS} \\times {\\rm SU}(2)_L \\times {\\rm SU}(2)_R$. The models incorporate technicolor for electroweak breaking, and extended technicolor for the breaking of $G_{LR}$ and $G_{422}$ and the generation of fermion ...
Dicty_cDB: Contig-U13202-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg
Dicty_cDB: Contig-U01750-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig
Dicty_cDB: Contig-U11883-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig
Dicty_cDB: Contig-U07021-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig
Simulating plasma instabilities in SU(3) gauge theory
International Nuclear Information System (INIS)
Berges, Juergen; Gelfand, Daniil; Scheffler, Sebastian; Sexty, Denes
2009-01-01
We compute nonequilibrium dynamics of plasma instabilities in classical-statistical lattice gauge theory in 3+1 dimensions. The simulations are done for the first time for the SU(3) gauge group relevant for quantum chromodynamics. We find a qualitatively similar behavior as compared to earlier investigations in SU(2) gauge theory. The characteristic growth rates are about 25% lower for given energy density, such that the isotropization process is slower. Measured in units of the characteristic screening mass, the primary growth rate is independent of the number of colors.
Nizozemska bolest u Bolivarijanskoj Republici Venezueli
Jošić, Doc. dr. sc. Hrvoje; Maček Pandak, Fran
2017-01-01
Venezuela je od svog osamostaljenja gospodarstvo temeljila na proizvodnji i izvozu jednog proizvoda. U 19. stoljeću to su bili kava i kakaovac koje je u 20. stoljeću zamijenila nafta. Navedeno je dovelo do nizozemske bolesti koja je gušila ostale gospodarske grane, pa su često korumpirane vlasti kupovale socijalni mir socijalističkim politikama i državnom potrošnjom. 1980-ih došlo je do prvog značajnijeg pada cijene nafte u 20. stoljeću te je Venezuela morala provesti liberalne reforme kako b...
Time-scale calibration by U-Pb geochronology: Examples from the Triassic Period
Mundil, R.
2009-05-01
U-Pb zircon geochronology, pioneered by Tom Krogh, is a cornerstone for the calibration of the time scale. Before Krogh's innovations, U-Pb geochronology was essentially limited by laboratory blank Pb (typically hundreds of nanograms) inherent in the then existing zircon dissolution and purification methods. The introduction of high pressure HF dissolution combined with miniature ion exchange columns (1) reduced the blank by orders of magnitude and allowed mass-spectrometric analyses of minute amounts of material (picograms of Pb and U). Krogh also recognized the need for minimizing the effects of Pb loss, and the introduction of the air-abrasion technique was the method of choice for two decades (2), until the development of the combined annealing and chemical abrasion technique resulted in essentially closed system zircons (3). These are the prerequisite for obtaining precise (permil-level) and accurate radio-isotopic ages of individual zircons contained in primary volcanic ash deposits, which are primary targets for the calibration of the time scale if they occur within fossil bearing sediments. A prime example is the calibration of the Triassic time scale which improved significantly using these techniques. The ages for the base and the top of the Triassic are constrained by U-Pb ages to 252.3 (4) and 201.5 Ma (5), respectively. These dates also constrain the ages of major extinction events at the Permian-Triassic and Triassic-Jurassic boundaries, and are statistically indistinguishable from ages obtained for the Siberian Traps and volcanic products from the Central Atlantic Magmatic Province, respectively, suggesting a causal link. Ages for these continental volcanics, however, are mostly from the K-Ar (40Ar/39Ar) system which requires accounting and correcting for a systematic bias of ca 1 % between U-Pb and 40Ar/39Ar isotopic ages (the 40Ar/39Ar ages being younger) (6). Robust U-Pb age constraints also exist for the Induan- Olenekian boundary (251.2 Ma, (7
National Aeronautics and Space Administration — The MATUFXCHM or tavgU_3d_chm_Fx data product is the MERRA Data Assimilation System Chemistry 2-Dimensional chemistry that is time averaged, single-level, at reduced...
Link2U: un social network aumentato su dispositivi mobili
Directory of Open Access Journals (Sweden)
Monica Sebillo
2012-04-01
Full Text Available Negli ultimi anni il connubio mobile entertainment e social network ha attirato un notevole interesse da parte dispecifici settori che, nonostante le criticità del momento, hanno deciso di investire nella realizzazione di ambienti esoluzioni di intrattenimento/divertimento, un fattore chiave alla base del miglioramento della tecnologia.Link2U: augmenting social networks on mobile devicesNowadays, modern mobile devices have become real person-al computers that increase the ability of building/extending existing applications by combining several technologies such as camera, GPS, 3D graphics and permanent Internet connec-tion. The resulting integration of such technologies allows to run complex applications, such as augmented reality and Social Networks. The goal of our current research is to support mobile users’ daily activities, by developing advanced solutions which take into account principles of human-computer interac-tion and usability. In this paper we propose to exploit the potential of the aug-mented reality and the ability to communicate of social net-works to create a mobile social network, where each commu-nity user may exploit advanced location based services, such as navigation through a two dimensional map, exploration of an area through a camera mode, and identification of points of interest embedded in an augmented reality environment.
Link2U: un social network aumentato su dispositivi mobili
Directory of Open Access Journals (Sweden)
Monica Sebillo
2012-04-01
Full Text Available Negli ultimi anni il connubio mobile entertainment e social network ha attirato un notevole interesse da parte dispecifici settori che, nonostante le criticità del momento, hanno deciso di investire nella realizzazione di ambienti esoluzioni di intrattenimento/divertimento, un fattore chiave alla base del miglioramento della tecnologia. Link2U: augmenting social networks on mobile devices Nowadays, modern mobile devices have become real person-al computers that increase the ability of building/extending existing applications by combining several technologies such as camera, GPS, 3D graphics and permanent Internet connec-tion. The resulting integration of such technologies allows to run complex applications, such as augmented reality and Social Networks. The goal of our current research is to support mobile users’ daily activities, by developing advanced solutions which take into account principles of human-computer interac-tion and usability. In this paper we propose to exploit the potential of the aug-mented reality and the ability to communicate of social net-works to create a mobile social network, where each commu-nity user may exploit advanced location based services, such as navigation through a two dimensional map, exploration of an area through a camera mode, and identification of points of interest embedded in an augmented reality environment.
Directory of Open Access Journals (Sweden)
Marina Vokić Žužul
2012-12-01
Full Text Available Dvostranim sporazumima između država čije obale leže sučelice ili međusobno graniče do danas je u Sredozemnome moru konačno definirano samo deset crta razgraničenja epikontinentskih pojaseva. U ovome radu analizira se sadržaj svakog od tih ugovora i ukazuje na potrebu utvrđivanja brojnih novih granica sredozemnoga morskoga dna i podzemlja, posebice s obzirom na sve veću gospodarsku važnost njegovih prirodnih bogatstava. Toj analizi prethodi istraživanje primjene konvencijskih pravila o vanjskim granicama epikontinentskog pojasa u nacionalnim propisima obalnih država. Kao najaktivnija sredozemna zemlja u određivanju granica podmorja ističe se Republika Italija. Uz usvajanje detaljnih propisa o vanjskim granicama epikontinentskog pojasa, Italija je zaključila i pet sporazuma o njegovom razgraničenju sa susjednim državama - s bivšom Jugoslavijom, Tunisom, Španjolskom, Grčkom i Albanijom. Uz te ugovore razmatraju se i temeljne značajke dvaju sporazuma koji provode presude Međunarodnog suda pravde (Libija - Tunis i Libija - Malta te kriteriji razgraničenja epikontinentskog pojasa primijenjeni u ugovorima o jedinstvenoj morskoj granici između Bugarske i Turske te Francuske i Monaka. Predmet analize je i crta razgraničenja epikontinentskih pojaseva utvrđena sporazumom između Turske i bivšega Sovjetskog Saveza 1978., koja je devet godina kasnije postala granicom i njihovih gospodarskih pojaseva. Cilj ovoga izlaganja nije samo dati pregled svih dosada sporazumno utvrđenih granica epikontinentskih pojaseva u Sredozemlju, nego i pokušati odgovoriti na pitanje - trebaju li već postojeće granice koje su bile dogovorene za morsko dno, postati i granice voda nad morskim dnom. To je pitanje od posebne važnosti za buduće razgraničenje gospodarskog pojasa odnosno zaštićenoga ekološko-ribolovnog pojasa Republike Hrvatske sa sličnim zonama susjednih država u Jadranu. S obzirom na nedavno započeta istra
26 CFR 1.881-2 - Taxation of foreign corporations not engaged in U.S. business.
2010-04-01
... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Taxation of foreign corporations not engaged in U.S. business. 1.881-2 Section 1.881-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Foreign Corporations § 1.881-2 Taxation of foreign...
Evidence for dynamic SU(5) symmetry breaking in meson mass multiplets
International Nuclear Information System (INIS)
Frikkee, E.
1994-07-01
It is shown that the mass differences and multiplet pattern for pseudoscalar and vector mesons correspond to a chain of dynamic symmetry reductions SU(n) contains SU(n-1)xU(1). In this symmetry-reduction model, the differences between the masses of the quark flavours are the result of intra-hadronic interactions. Quark confinement is explained as a consequence of the fact that this symmetry breaking chain only occurs in hadrons. The results of a quantitative analysis of mass splittings in meson multiplets indicate that SU(5) is probably the highest symmetry for hadron states. In the proposed dynamic symmetry breaking scheme with five quark flavours there is no one-to-one correspondence between lepton and quark generations. (orig.)
Kinetic study of time-dependent fixation of U"V"I on biochar
International Nuclear Information System (INIS)
Ashry, A.; Bailey, E.H.; Chenery, S.R.N.; Young, S.D.
2016-01-01
Biochar, a by-product from the production of biofuel and syngas by gasification, was tested as a material for adsorption and fixation of U"V"I from aqueous solutions. A batch experiment was conducted to study the factors that influence the adsorption and time-dependent fixation on biochar at 20 °C, including pH, initial concentration of U"V"I and contact time. Uranium (U"V"I) adsorption was highly dependent on pH but adsorption on biochar was high over a wide range of pH values, from 4.5 to 9.0, and adsorption strength was time-dependent over several days. The experimental data for pH > 7 were most effectively modelled using a Freundlich adsorption isotherm coupled to a reversible first order kinetic equation to describe the time-dependent fixation of U"V"I within the biochar structure. Desorption experiments showed that U"V"I was only sparingly desorbable from the biochar with time and isotopic dilution with "2"3"3U"V"I confirmed the low, or time-dependent, lability of adsorbed "2"3"8U"V"I. Below pH 7 the adsorption isotherm trend suggested precipitation, rather than true adsorption, may occur. However, across all pH values (4.5-9) measured saturation indices suggested precipitation was possible: autunite below pH 6.5 and either swartzite, liebigite or bayleyite above pH 6.5.
Building a SuAVE browse interface to R2R's Linked Data
Clark, D.; Stocks, K. I.; Arko, R. A.; Zaslavsky, I.; Whitenack, T.
2017-12-01
The Rolling Deck to Repository program (R2R) is creating and evaluating a new browse portal based on the SuAVE platform and the R2R linked data graph. R2R manages the underway sensor data collected by the fleet of US academic research vessels, and provides a discovery and access point to those data at its website, www.rvdata.us. R2R has a database-driven search interface, but seeks a more capable and extensible browse interface that could be built off of the substantial R2R linked data resources. R2R's Linked Data graph organizes its data holdings around key concepts (e.g. cruise, vessel, device type, operator, award, organization, publication), anchored by persistent identifiers where feasible. The "Survey Analysis via Visual Exploration" or SuAVE platform (suave.sdsc.edu) is a system for online publication, sharing, and analysis of images and metadata. It has been implemented as an interface to diverse data collections, but has not been driven off of linked data in the past. SuAVE supports several features of interest to R2R, including faceted searching, collaborative annotations, efficient subsetting, Google maps-like navigation over an image gallery, and several types of data analysis. Our initial SuAVE-based implementation was through a CSV export from the R2R PostGIS-enabled PostgreSQL database. This served to demonstrate the utility of SuAVE but was static and required reloading as R2R data holdings grew. We are now working to implement a SPARQL-based ("RDF Query Language") service that directly leverages the R2R Linked Data graph and offers the ability to subset and/or customize output.We will show examples of SuAVE faceted searches on R2R linked data concepts, and discuss our experience to date with this work in progress.
Topological Quantization of Instantons in SU(2) Yang–Mills Theory
International Nuclear Information System (INIS)
Wo-Jun, Zhong; Yi-Shi, Duan
2008-01-01
By decomposing SU(2) gauge potential in four-dimensional Euclidean SU(2) Yang–Mills theory in a new way, we find that the instanton number related to the isospin defects of a doublet order parameter can be topologically quantized by the Hopf index and Brouwer degree. It is also shown that the instanton number is just the sum of the topological charges of the isospin defects in the non-trivial sector of Yang–Mills theory. (general)
Indian Academy of Sciences (India)
Abstract. We introduce in this paper embedded Gaussian unitary ensemble of random matrices, for m fermions in Ω number of single particle orbits, generated by random two- body interactions that are SU(4) scalar, called EGUE(2)-SU(4). Here the SU(4) algebra corresponds to Wigner's supermultiplet SU(4) symmetry in ...
International Nuclear Information System (INIS)
Guerrero, José Luis; Vallejos, Ángela; Cerón, Juan Carlos; Sánchez-Martos, Francisco; Pulido-Bosch, Antonio; Bolívar, Juan Pedro
2016-01-01
Sierra de Gádor is a karst macrosystem with a highly complex geometry, located in southeastern Spain. In this arid environment, the main economic activities, agriculture and tourism, are supported by water resources from the Sierra de Gádor aquifer system. The aim of this work was to study the levels and behaviour of some of the most significant natural radionuclides in order to improve the knowledge of the hydrogeochemical processes involved in this groundwater system. For this study, 28 groundwater and 7 surface water samples were collected, and the activity concentrations of the natural U-isotopes ("2"3"8U, "2"3"5U and "2"3"4U) and "2"2"6Ra by alpha spectrometry were determined. The activity concentration of "2"3"8U presented a large variation from around 1.1 to 65 mBq L"−"1. Elevated groundwater U concentrations were the result of oxidising conditions that likely promoted U dissolution. The PHREEQC modelling code showed that dissolved U mainly existed as uranyl carbonate complexes. The "2"3"4U/"2"3"8U activity ratios were higher than unity for all samples (1.1–3.8). Additionally, these ratios were in greater disequilibrium in groundwater than surface water samples, the likely result of greater water-rock contact time. "2"2"6Ra presented a wide range of activity concentrations, (0.8 up to about 4 × 10"2 mBq L"−"1); greatest concentrations were detected in the thermal area of Alhama. Most of the samples showed "2"2"6Ra/"2"3"4U activity ratios lower than unity (median = 0.3), likely the result of the greater mobility of U than Ra in the aquifer system. The natural U-isotopes concentrations were strongly correlated with dissolution of sulphate evaporites (mainly gypsum). "2"2"6Ra had a more complex behaviour, showing a strong correlation with water salinity, which was particularly evident in locations where thermal anomalies were detected. The most saline samples showed the lowest "2"3"4U/"2"3"8U activity ratios, probably due to fast uniform bulk
Energy Technology Data Exchange (ETDEWEB)
Chen, Wang, E-mail: sc19321@s.okayama-u.ac.jp, E-mail: okakent@okayama-u.ac.jp, E-mail: pbernath@odu.edu; Kawaguchi, Kentarou, E-mail: sc19321@s.okayama-u.ac.jp, E-mail: okakent@okayama-u.ac.jp, E-mail: pbernath@odu.edu; Tang, Jian, E-mail: jtang@okayama-u.ac.jp [Graduate School of Natural Science and Technology, Okayama University, 3-1-1 Tsushima-naka, Kita-ku, 700-8530, Okayama (Japan); Bernath, Peter F., E-mail: sc19321@s.okayama-u.ac.jp, E-mail: okakent@okayama-u.ac.jp, E-mail: pbernath@odu.edu [Department of Chemistry and Biochemistry, Old Dominion University, 4541 Hampton Boulevard, Norfolk, Virginia 23529-0126 (United States)
2016-02-14
Thirteen bands for the B{sup 1}Δ{sub g}–A{sup 1}Π{sub u} system and eleven bands for the B{sup ′1}Σ{sub g}{sup +}–A{sup 1}Π{sub u} system of C{sub 2} were identified in the Fourier transform infrared emission spectra of hydrocarbon discharges. The B{sup ′1}Σ{sub g}{sup +} v = 4 and the B{sup 1}Δ{sub g} v = 6, 7, and 8 vibrational levels involved in nine bands were studied for the first time. A direct global analysis with Dunham parameters was carried out satisfactorily for the B{sup 1}Δ{sub g}–A{sup 1}Π{sub u} system except for a small perturbation in the B{sup 1}Δ{sub g} v = 6 level. The calculated rovibrational term energies up to B{sup 1}Δ{sub g} v = 12 showed that the level crossing between the B{sup 1}Δ{sub g} and d{sup 3}Π{sub g} states is responsible for many of the prominent perturbations in the Swan system observed previously. Nineteen forbidden transitions of the B{sup 1}Δ{sub g}–a{sup 3}Π{sub u} transition were identified and the off-diagonal spin-orbit interaction constant A{sub dB} between d{sup 3}Π{sub g} and B{sup 1}Δ{sub g} was derived as 8.3(1) cm{sup −1}. For the B{sup ′1}Σ{sub g}{sup +}–A{sup 1}Π{sub u} system, only individual band analyses for each vibrational level in the B′{sup 1}Σ{sub g}{sup +} state could be done satisfactorily and Dunham parameters obtained from these effective parameters showed that the anharmonic vibrational constant ω{sub e}x{sub e} is anomalously small (nearly zero). Inspection of the RKR (Rydberg-Klein-Rees) potential curves for the B{sup ′1}Σ{sub g}{sup +} and X{sup 1}Σ{sub g}{sup +} states revealed that an avoided crossing or nearly avoided crossing may occur around 30 000 cm{sup −1}, which is responsible for the anomalous molecular constants in these two states.
Energy Technology Data Exchange (ETDEWEB)
Koesling, Jens
2010-06-15
We introduce a novel method to determine 6j-symbols of quantum groups. This method is inspired by the methods used in the determination of fusing matrices of WZNW models. With this method we determine the 6j-symbols of the quantum group U{sub q}sl(2) and the super quantum group U{sub q}osp(1 vertical stroke 2). We present the 6j-symbols as a recurrence relation and its initial values. The 6j-symbols transform between the s-channel and the u-channel decomposition of the invariants of the four-fold tensor product of modules of a quantum group. These invariants fulfil certain difference equations. We set one of the representations in the invariant to the fundamental representation, and deduce a system of linear equations for the initial values of the recurrence relation determining the 6j-symbols. (orig.)
Polarization labelling spectroscopy of the A 1Σ+sub(u) band of Na2
International Nuclear Information System (INIS)
Itoh, H.; Hayakawa, M.; Fukuda, Y.; Matsuoka, M.
1981-01-01
A result of the polarization labelling spectroscopy of the A 1 Σ + sub(u) band of sodium dimer for the high vibrational quantum number upsilon' > 20 is reported. The frequency difference Δν = νsub(o)sub(b)sub(s)-νsub(c)sub(a)sub(l) is found to decrease from 2 to -3 cm -1 as the rotational levels (upsilon' = 27-30), where νsub(c)sub(a)sub(l) is the calculated transition frequency using the Dunham coefficients of Demtroeder and Stock for the X 1 Σ + sub(g) band and of Kusch and Hessel for the A 1 Σ + sub(u) band. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Ojeda-Guillén, D., E-mail: dogphysics@gmail.com [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, C.P. 07738, México D.F. (Mexico); Mota, R.D. [Escuela Superior de Ingeniería Mecánica y Eléctrica, Unidad Culhuacán, Instituto Politécnico Nacional, Av. Santa Ana No. 1000, Col. San Francisco Culhuacán, Delegación Coyoacán, C.P. 04430, México D.F. (Mexico); Granados, V.D. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, C.P. 07738, México D.F. (Mexico)
2014-08-14
We decouple the Dirac's radial equations in D+1 dimensions with Coulomb-type scalar and vector potentials through appropriate transformations. We study each of these uncoupled second-order equations in an algebraic way by using an su(1,1) algebra realization. Based on the theory of irreducible representations, we find the energy spectrum and the radial eigenfunctions. We construct the Perelomov coherent states for the Sturmian basis, which is the basis for the unitary irreducible representation of the su(1,1) Lie algebra. The physical radial coherent states for our problem are obtained by applying the inverse original transformations to the Sturmian coherent states. - Highlights: • We solve the most general Dirac–Kepler–Coulomb problem. • The eigenfunctions and energy spectrum are obtained in a purely algebraic way. • We construct the radial SU(1,1) coherent states for the Kepler–Coulomb problem.
International Nuclear Information System (INIS)
Ojeda-Guillén, D.; Mota, R.D.; Granados, V.D.
2014-01-01
We decouple the Dirac's radial equations in D+1 dimensions with Coulomb-type scalar and vector potentials through appropriate transformations. We study each of these uncoupled second-order equations in an algebraic way by using an su(1,1) algebra realization. Based on the theory of irreducible representations, we find the energy spectrum and the radial eigenfunctions. We construct the Perelomov coherent states for the Sturmian basis, which is the basis for the unitary irreducible representation of the su(1,1) Lie algebra. The physical radial coherent states for our problem are obtained by applying the inverse original transformations to the Sturmian coherent states. - Highlights: • We solve the most general Dirac–Kepler–Coulomb problem. • The eigenfunctions and energy spectrum are obtained in a purely algebraic way. • We construct the radial SU(1,1) coherent states for the Kepler–Coulomb problem
Atenica: u potrazi za izgubljenim spalištem
Directory of Open Access Journals (Sweden)
Staša Babić
2016-11-01
Full Text Available Funerarni konteksti svakako su arheološki zapisi u čijem formiranju značajnu ulogu igraju simboličke i kultne predstave zajednice. S druge strane, u odsustvu pisanih svedočanstava o tim predstavama, arheolozi su skloni da svoje interpretacije zasnivaju na uopštenim i pojednostavljenim idejama o „primitivnim” kultovima, kao što je „solarni kult”. U takvom postupku, tehnički aspekti zapisa zanemaruju se u korist tumačenja pretpostavljenih simboličkih „poruka”. Među kneževskim grobovima centralnog Balkana, humke u Atenici pored Čačka dugo su predstavljale jedini primer ove vrste sahrane koji je istražen u okviru sistematskih arheoloških istraživanja i stoga je čitav niz autora posvećivao posebnu pažnju konstrukciji ovih tumula i mogućnostima interpretacije rituala koji je pratio polaganje pokojnika. U ovom pogledu, naročito je značajna tzv. „ritualna površina” u okviru humke II – tri pravougaona prostora oivičena redovima oblutaka, sa pravilno raspoređenim levkastim jamama, ispunjenim tamnom zemljom, fragmentima keramike i gorelih kostiju. Interpretacije su se kretale od ideja o grobovima kremiranih ljudskih žrtava, preko replika svetilišta, sve do složene simbolike solarnog kulta, izražene numerološkim pravilnostima. S druge strane, budući da se radi o kremiranim pokojnicima, u okviru obe humke identifikovana su spališta – relativno male lučne konstrukcije od redova oblutaka, na kojima su takođe zapaženi tragovi gorenja. Niz praktičnih nelogičnosti koje proističu iz ovih tumačenja ostao je po strani, u nastojanju da se složeni ritual sahrane sa kremacijom poveže sa simboličkim predstavama percipiranim kao primerene za kulturni kontekst sahrana u Atenici – ljudske žrtve, solarni kult. U kružnom dokaznom postupku, ove su ideje, manje ili više prećutno, uzimane za početnu premisu šire interpretacije kultnih praksi zajednice koja je svoje istaknute članove sahranila pod humkama u
The finite - dimensional star and grade star irreducible representation of SU(n/1)
International Nuclear Information System (INIS)
Han Qi-zhi.
1981-01-01
We derive the conditions of star and grade star representations of SU(n/1) and give some examples of them. We also give a brief review of the finite - dimensional irreducible representations of SU(n/1). (author)
Novi trendovi u proizvodnji etanola kao biogoriva
Directory of Open Access Journals (Sweden)
Mirela Ivančić Šantek
2016-01-01
Full Text Available Povećanje emisije stakleničkih plinova, energetska ovisnost i nestabilnost isporuke energenata posljedica su ubrzane potrošnje fosilnih goriva zbog ubrzanog rasta svjetske populacije i industrijalizacije. Bioetanol je postao atraktivno zamjensko biogorivo jer se proizvodi iz obnovljivih sirovina i ekološki je prihvatljiv. Upotrebljava se kao pogonsko gorivo i to kao hidrirani (96 % ili bezvodni (u mješavinama s benzinom. Bioetanol se proizvodi fermentacijom s kvascem S. cerevisiae ili nekim drugim mikroorganizmom iz ugljikohidrata kao što su jednostavni šećeri, škrob i celuloza. Nakon fermentacije, bioetanol se izdvaja i pročišćava destilacijom i dehidracijom. Sastav je propisan specifikacijama za primjenu u motornim gorivima. Uobičajeni usjevi, kao što su kukuruz, šećerna repa i trska, zasad su osnovne sirovine za proizvodnju bioetanola. Međutim, proizvodnja bioetanola iz ovih sirovina ne može zadovoljiti globalne potrebe za bioetanolom, zbog njihove primarne uloge u prehrani ljudi i životinja. Lignoceluloza je pogodna sirovina za proizvodnju bioetanola jer je široko rasprostranjena, obnovljiva i ne upotrebljava se u prehrani. Proizvodnja bioetanola iz lignoceluloznih sirovina je složen proces, koji se u mnogim aspektima razlikuje od proizvodnje iz šećernih ili škrobnih sirovina. U ovom radu prikazane su dosadašnje i nove tehnologije u proizvodnji bioetanola uključujući primjenu različitih sirovina, postupaka proizvodnje i radnih mikroorganizama. Nadalje, navedene su mogućnosti integracije osnovnih koraka u bioprocesima proizvodnje s ciljem povećanja produktivnosti i smanjenja troškova proizvodnje.
International Nuclear Information System (INIS)
Marrero, E.; Ortega, J.; Palomar, J.
2009-01-01
Summary: Excess enthalpies H m E and excess volumes V m E obtained at a temperature of 298.15 K and atmospheric pressure are presented for a set of 20 binary mixtures comprised of the first four propyl esters, C u-1 H 2u-1 COOC 3 H 7 (u = 1 to 4), and five α,ω-dichloroalkanes, ClCH 2 (CH 2 ) v-2 CH 2 Cl (v = 2 to 6). All the mixtures are exothermic except for those corresponding to propyl methanoate with v ≥ 4. The V m E are positive in most mixtures except for those where v = 4, 5, 6, for V m E m E with v, while the increase in u produces a greater exothermicity in the mixing process, which becomes inverted for propyl butanoate. The variation in V m E with the chain length of the compounds of the mixtures studied is not regular since both the enthalpic and the volumetric effects are due to interactions of different nature, positive and negative. Interpretation of the behavior was assisted by applying the quantum-chemistry method COSMO-RS. This method describes qualitatively and quantitatively the contribution of the different types of interactions, electrostatic, van der Waals, and those due to the (Cl, Cl) bond in the dihalide, and the influence of the ester and dichloroalkane chains. This information was also useful to adequately modify the application of the UNIFAC group contribution model, proposing parameters for the Cl, Cl/carboxylate interaction that vary with the chain length of the compounds involved. With this modification, the results estimated by UNIFAC model can be considered good
Kuranski propisi o odijevanju kao temelj egalitarnosti u islamu
Harcet, Marjana
2008-01-01
Članak ukazuje na to da su odredeni kodeksi oblačenja, koji su se uvažili u nekim islamskim zemljama, posljedica predislamske tradicije i patrijarhalnih interpretacija Kurana te da nisu u skladu sa jednim od temeljnih ciljeva religije - ispravljanjem krivičnih društvenih struktura. Iako se iz Kuranskih propisa, koji su predstavljeni u prvom dijelu članka, može razabrati da upute o odijevanju nisu bile postavljene zato, da bi se žene podredilo, neke se prakse pokrivanja koje su ostale na sn...
International Nuclear Information System (INIS)
Ellis, J.
1982-01-01
The author gives an introduction to the construction of grand unified theories on the base of the SU(3)xSU(2)xU(1) model of the strong, weak, and electromagnetic interactions. Especially he discusses the proton decay, neutrino masses and oscillations, and cosmological implications in connection with grand unified theories. (orig./HSI)
New solutions of euclidean SU(2) gauge theory
International Nuclear Information System (INIS)
Khan, I.
1983-08-01
New solutions of the Euclidean SU(2) gauge theory having finite field strength everywhere are presented. The solutions are self dual or antidual and constitute a two-parameter family which includes the instantons. (author)
The SU(2|3) dynamic two-loop form factors
International Nuclear Information System (INIS)
Brandhuber, A.; Kostacińska, M.; Penante, B.; Travaglini, G.; Young, D.
2016-01-01
We compute two-loop form factors of operators in the SU(2|3) closed subsector of N = 4 supersymmetric Yang-Mills. In particular, we focus on the non-protected, dimension-three operators Tr(X[Y,Z]) and Tr(ψψ) for which we compute the four possible two-loop form factors, and corresponding remainder functions, with external states 〈X̄ȲZ̄| and 〈ψ̄ψ̄|. Interestingly, the maximally transcendental part of the two-loop remainder of 〈X̄ȲZ̄|Tr(X[Y,Z])|0〉 turns out to be identical to that of the corresponding known quantity for the half-BPS operator Tr(X"3). We also find a surprising connection between the terms subleading in transcendentality and certain a priori unrelated remainder densities introduced in the study of the spin chain Hamiltonian in the SU(2) sector. Next, we use our calculation to resolve the mixing, recovering anomalous dimensions and eigenstates of the dilatation operator in the SU(2|3) sector at two loops. We also speculate on potential connections between our calculations in N = 4 super Yang-Mills and Higgs + multi-gluon amplitudes in QCD in an effective Lagrangian approach.
The SU(2|3) dynamic two-loop form factors
Energy Technology Data Exchange (ETDEWEB)
Brandhuber, A.; Kostacińska, M. [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London,Mile End Road, London E1 4NS (United Kingdom); Penante, B. [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London,Mile End Road, London E1 4NS (United Kingdom); Institut für Physik und IRIS Adlershof, Humboldt Universität zu Berlin,Zum Großen Windkanal 6, 12489 Berlin (Germany); Travaglini, G.; Young, D. [Centre for Research in String Theory, School of Physics and Astronomy,Queen Mary University of London,Mile End Road, London E1 4NS (United Kingdom)
2016-08-23
We compute two-loop form factors of operators in the SU(2|3) closed subsector of N = 4 supersymmetric Yang-Mills. In particular, we focus on the non-protected, dimension-three operators Tr(X[Y,Z]) and Tr(ψψ) for which we compute the four possible two-loop form factors, and corresponding remainder functions, with external states 〈X̄ȲZ̄| and 〈ψ̄ψ̄|. Interestingly, the maximally transcendental part of the two-loop remainder of 〈X̄ȲZ̄|Tr(X[Y,Z])|0〉 turns out to be identical to that of the corresponding known quantity for the half-BPS operator Tr(X{sup 3}). We also find a surprising connection between the terms subleading in transcendentality and certain a priori unrelated remainder densities introduced in the study of the spin chain Hamiltonian in the SU(2) sector. Next, we use our calculation to resolve the mixing, recovering anomalous dimensions and eigenstates of the dilatation operator in the SU(2|3) sector at two loops. We also speculate on potential connections between our calculations in N = 4 super Yang-Mills and Higgs + multi-gluon amplitudes in QCD in an effective Lagrangian approach.