Thermoresistance in radioresistant strains of 'Drosophila nebulosa'

International Nuclear Information System (INIS)

Kratz, F.L.

1977-01-01

The detection of thermoresistance in radioresistant strains of 'D. nebulosa' is described, as well as some conclusions on the genetic nature of these differences are presented. The strains used in this experiment were MF 204, from 'Morro de Ferro', in Pocos de Caldas (MG) (one of the biggest radioactive anomalies in the world) whose radioresistance is due to its additive genetic components (Kratz, 1973 and 1975); 85(87) R, an induced radioresistant strain; and MF K a control 'pooled' strain obtained near 'Morro do Ferro'. Survival tests, 72 hours after temperature shocks, performed in the interval of 36 0 C to 39 0 C showed a decreasing gradient of thermoresistance with the following regression coefficients: MF 204 b= - 5,4; 85(87)R b= - 7,2 and MF K b= - 7,9. Bifactorial analysis (strains and sexes) performed at 38 0 C and 39 0 C confirmed differences among strains (P [pt

Effect of temperature on the egg incubation period of Taeniopteryx nebulosa (Plecoptera)

Energy Technology Data Exchange (ETDEWEB)

Brittain, J.E.

1977-01-01

Eggs of Taeniopteryx nebulosa (L.) were incubated in the laboratory at constant temperatures between 2/sup 0/C and 24/sup 0/C and at field temperatures. A relationship, linear on logarithmic scales, was found between water temperature (T/sup 0/C) and mean egg incubation period (Y days) for the temperature range 2 to 24/sup 0/C. The relationship is given by the regression equation: Y = 313 T/sup -1/./sup 03/ (r = 0.998, p < 0.001). Hatching success was low below 4/sup 0/C and above 20/sup 0/C.

Using detection dogs to conduct simultaneous surveys of northern spotted (Strix occidentalis caurina and barred owls (Strix varia.

Directory of Open Access Journals (Sweden)

Samuel K Wasser

Full Text Available State and federal actions to conserve northern spotted owl (Strix occidentalis caurina habitat are largely initiated by establishing habitat occupancy. Northern spotted owl occupancy is typically assessed by eliciting their response to simulated conspecific vocalizations. However, proximity of barred owls (Strix varia-a significant threat to northern spotted owls-can suppress northern spotted owl responsiveness to vocalization surveys and hence their probability of detection. We developed a survey method to simultaneously detect both species that does not require vocalization. Detection dogs (Canis familiaris located owl pellets accumulated under roost sites, within search areas selected using habitat association maps. We compared success of detection dog surveys to vocalization surveys slightly modified from the U.S. Fish and Wildlife Service's Draft 2010 Survey Protocol. Seventeen 2 km × 2 km polygons were each surveyed multiple times in an area where northern spotted owls were known to nest prior to 1997 and barred owl density was thought to be low. Mitochondrial DNA was used to confirm species from pellets detected by dogs. Spotted owl and barred owl detection probabilities were significantly higher for dog than vocalization surveys. For spotted owls, this difference increased with number of site visits. Cumulative detection probabilities of northern spotted owls were 29% after session 1, 62% after session 2, and 87% after session 3 for dog surveys, compared to 25% after session 1, increasing to 59% by session 6 for vocalization surveys. Mean detection probability for barred owls was 20.1% for dog surveys and 7.3% for vocal surveys. Results suggest that detection dog surveys can complement vocalization surveys by providing a reliable method for establishing occupancy of both northern spotted and barred owl without requiring owl vocalization. This helps meet objectives of Recovery Actions 24 and 25 of the Revised Recovery Plan for the

Lockout/Tagout - Turvalukituskäytäntö

OpenAIRE

Juhala, Ville

2017-01-01

Tämän opinnäytetyön tarkoituksena oli laatia kattava ohjeistus kuparitehtaan turvalukituksista. Työ tehtiin Aurubis Finland Oy:n kuparivalssaamoon. Ohjeistuksista tuli käydä ilmi turvalukitusten vaikutus lukittaviin laitteisiin sekä mahdolliset työturvallisuusriskit joita koneiden kanssa toimiessa tulee huomioida. Työn tavoitteena oli lisätä kunnossapidon työturvallisuutta ja selkeyttää koneiden kanssa työskentelyyn liittyviä käytäntöjä. Ohjeistukset laadittiin vahinkokäynnistymisen estoa...

Cutaneous atypical mycobacteriosis in a clouded leopard (Neofelis nebulosa).

Science.gov (United States)

Cerveny, Shannon N S; Thompson, Michelle E; Corner, Sarah M; Swinford, Amy K; Coke, Rob L

2013-09-01

A 16-yr-old male clouded leopard (Neofelis nebulosa) was presented for lethargy and anorexia. A cutaneous abdominal mass extending from the pubis to just caudal to the xiphoid process was present. A biopsy revealed histologic lesions consistent with an atypical mycobacterial infection consisting of diffuse, severe, pyogranulomatous dermatitis and panniculitis, with clear vacuoles and 3-5 microm, intravacuolar, faintly eosinophilic, filamentous bacilli that stained positively with FiteFaraco modified acid-fast stain. The clouded leopard had biochemical findings suggestive of chronic renal failure and euthanasia was elected. Histological evaluation of tissues collected at postmortem examination revealed multicentric B-cell lymphoma involving the oral cavity, liver, spleen, and multiple lymph nodes, bilateral testicular seminomas, thyroid follicular cell adenoma, thyroid C cell adenoma, and biliary cystadenomas. Bacterial culture and molecular sequencing identified the causative agent of the cutaneous abdominal mass as belonging to the Mycobacterium fortuitum group.

Dinámica y crecimiento de los granos de polvo en la nebulosa protoplanetaria

Science.gov (United States)

de La Fuente Marcos, Carlos

2001-06-01

En el escenario estándar de la formación planetaria, los planetesimales (cuerpos de tamaño kilométrico) crecen a partir de granos de polvo, similares a los interestelares, embebidos en un disco gaseoso denominado nebulosa protoplanetaria. Durante esta etapa, los movimientos del gas pueden tener gran influencia en la dinámica y el crecimiento de los granos de polvo, dado que el flujo kepleriano del gas frena el movimiento de los mismos haciendo que caigan hacia el Sol, y la turbulencia inhibe la inestabilidad gravitacional de la capa de polvo. Aunque se acepta que los planetesimales fueron los elementos constituyentes de los planetas, todavía se desconoce cómo se produjo la formación de los mismos. Por esta razón, en los estudios más recientes, existe un renovado interés por comprender mejor la evolución de la capa de polvo inmersa en el disco gaseoso de la Nebulosa. El gas que fluye en el disco puede engendrar estructuras carentes de simetría axial, como por ejemplo ondas espirales y vórtices, a partir de gran variedad de mecanismos de excitación e inestabilidad. En 1995, Barge y Sommeria pusieron de manifiesto que la existencia de vórtices gaseosos persistentes en la nebulosa solar tendría importantes consecuencias sobre la formación de los planetesimales y el posterior crecimiento de los planetas gigantes. La investigación desarrollada en esta Tesis analiza la relación entre el polvo y el gas debida al acoplamiento por fricción dinámica entre ambos; en concreto, se estudia el efecto del flujo medio del gas sobre la dinámica de las partículas de polvo. El primer objetivo es investigar en profundidad los procesos de captura y crecimiento de los granos de polvo dentro de un vórtice y su posible relevancia en cuanto a la formación de los planetesimales. El segundo objetivo es la exploración de los efectos de ondas espirales propagándose en el disco gaseoso sobre la dinámica y el crecimiento de las partículas. La presencia de líneas de

Estimation of food consumption from pellets cast by captive Ural Owls (Strix uralensis)

Science.gov (United States)

Aki Higuchi; Manabu T. Abe

1997-01-01

There is considerable data in the literature on the diet of the Ural Owl (Strix uralensis) based on pellet analysis. Though it is possible to identify prey items by this method, the volume of food consumption is still unknown. The population of Ural Owls in Japan is declining due to the reduction of old-growth forest and the concurrent loss of...

Abundance and population characteristics of Northern Spotted Owls (Strix occidentalis caurina) in Olympic National Park, Washington

Science.gov (United States)

D. Erran Seaman

1997-01-01

We monitored the threatened Northern Spotted Owl (Strix occidentalis caurina) in Olympic National Park from 1992 through 1996. We used a stratified random sampling scheme to survey 35 plots totaling 236 km?, approximately 10 percent of the forested area of the park.

Kahdeksasluokkalaisten kokemukset omasta puhelimen käytöstään

OpenAIRE

Nygård, Jessica

2016-01-01

Tutkimuksen tarkoituksena oli selvittää kahdeksasluokkalaisten kokemuksia omasta puhelimen käytöstään ja tutkia, kokivatko he puhelinriippuvuutta. Tavoitteena oli saada ajankohtaista tietoa nuorten mielipiteistä. Tutkimus suoritettiin kvalitatiivisena eli laadullisena tutkimuksena. Tutkimusaineisto kerättiin vaasalaisen yläasteen kahdeksasluokkalaisilta nuorilta toukokuussa 2016, ja kyselyyn osallistui kymmenen nuorta. Tutkimuksen aineistonkeruumenetelmänä käytettiin kyselytutkimusta. Tut...

Tawny owl (Strix aluco) as a potential transmitter of Enterobacteriaceae epidemiologically relevant for forest service workers, nature protection service and ornithologists.

Science.gov (United States)

Grzywaczewski, Grzegorz; Kowalczyk-Pecka, Danuta; Cios, Szymon; Bojar, Wiktor; Jankuszew, Andrzej; Bojar, Hubert; Kolejko, Marcin

2017-03-31

Established taxa within the Enterobacteriaceae wereisolated from cloacal swabs of Strix aluco chicks in nest boxes located at five research sites. ChromID ESBL medium (bioMerieux) was used to select a pool of Enterobacteriaceae strains producing extended-spectrum beta-lactamases. Drug sensitivity of the chosen strains was determined from the full pool of Enterobacteriaceae to 6 chemotherapeutics of different mechanisms of action. The study evaluated the sensitivity of ESBL-synthesizing isolates to substances belonging to penicillins, cephalosporins, cephamycins, clavams, carbapenems and monobactams. Analysis of the results indicated a potential role of Strix aluco in the dissemination of epidemiologically-relevant Enterobacteriaceae, and, importantly, pose health risks to forest service workers, nature protection service and ornithologists. The results can also serve as the basis for further environmental studies.

Ammattikorkeakoulujen Julkaisuarkisto Theseus : käyttöönotto- ja perustamisvaiheet sekä nykyiset käytänteet ammattikorkeakouluissa

OpenAIRE

Ranta, Anna-Kaisa; Lahdenperä, Silja

2012-01-01

Tässä opinnäytetyössä perehdytään Julkaisuarkisto Theseuksen perustamisvaiheisiin ja käyttöönottoon Suomen ammattikorkeakouluissa. Theseuksen historia käydään läpi Open Access -hankkeen alkuvaiheista nykypäivään asti ja lopuksi luodaan katsaus myös tulevaisuuteen. Lisäksi työssä tutkitaan ammattikorkeakoulujen erilaisia käytänteitä Theseuksen käytön suhteen. Aloitteen työn tekemiseksi on tehnyt Theseus-ohjausryhmä ja työn toimeksiantaja on AMKIT-konsortion johtoryhmä. Tietolähteinä käytet...

Abundâncias químicas de uma amostra de nebulosas planetárias em M51

Science.gov (United States)

Uchida, M. M. M.; Costa, R. D. D.; Maciel, W. J.

2003-08-01

A derivação de abundâncias químicas de nebulosas planetárias permite a investigação dos processos de enriquecimento químico ocorridos durante a evolução das estrelas progenitoras, que têm massas entre 0.8 e 8 massas solares. Adicionalmente as abundâncias de elementos como oxigênio, argônio ou neônio, que não são produzidos por nucleossíntese na progenitora, refletem a evolução do meio interestelar: estrelas menos massivas, de evolução mais lenta, tipicamente originam-se de um meio interestelar mais pobre. Reportamos aqui a derivação de parâmetros físicos e abundâncias químicas de uma amostra de nebulosas planetárias da galáxia M51, uma galáxia de tipo Seyfert 2 pertencente ao Grupo de Sculptor. As observações foram feitas com o telescópio Gemini Norte, usando o espectrógrafo GMOS no modo multi-objeto. Os resultados indicam uma distribuição de abundâncias análoga àquela das planetárias da Galáxia. A amostra observada não permite estabelecer-se com clareza a existência de um gradiente radial como é esperado pelos modelos evolutivos de galáxias expirais; espera-se que uma extensão desta amostra deva indicá-lo posteriormente. (FAPESP/CNPq)

Determinação da composição química em nebulosas planetárias na direção do anticentro galáctico

Science.gov (United States)

Costa, R. D. D.; Uchida, M. M. M.; Maciel, W. J.

2003-08-01

Existe um gradiente radial de abundâncias no disco galáctico, cujo comportamento é razoavelmente bem conhecido para distâncias galactocêntricas entre 3 e 10 kpc. Foi obtido a partir de resultados derivados de nebulosas planetárias, regiões HII e estrelas, como as estrelas quentes de tipo O, B e aglomerados abertos. Com o objetivo de investigar o comportamento deste gradiente radial na região externa do disco, conhecida como anticentro galáctico, reportamos aqui os resultados finais da análise de uma amostra de nebulosas planetárias na direção do anticentro, observadas no LNA e no ESO entre 1995 e 2000. O uso de nebulosas planetárias permite o cálculo das abundâncias de elementos traçadores da evolução química do disco como oxigênio, argônio e neônio com o uso de técnicas de espectroscopia nebular. Os resultados indicam uma distribuição de abundâncias distinta daquela encontrada na vizinhança solar, mostrando que o gradiente radial diminui sensivelmente para distâncias galactocêntricas maiores que 10 kpc. Este resultado está de acordo com os mais recentes modelos de evolução química do disco, que prevêem uma diminuição ou mesmo um desaparecimento do gradiente radial no bordo externo do disco galáctico. (FAPESP/CNPq)

Food habits of the Northern Spotted Owl (Strix occidentalis caurina) at six nest sites in Washington?s east Cascades

Science.gov (United States)

Kenneth R. Bevis; Jo Ellen Richards; Gina M. King; Eric E. Hanson

1997-01-01

This paper reports on 245 pellet samples containing 479 identified prey items collected at six Northern Spotted Owl (Strix occidentalis caurina) breeding sites in the eastern portion of its range. The majority of prey (biomass) came from four species; northern flying squirrels (Glaucomys sabrinus), bushy-tailed woodrats (...

Tiiviisti yhdestä suusta : Tutkimus kertojan käytön merkityksestä dokumenttielokuvassa

OpenAIRE

Rahkola, Nina

2009-01-01

TIIVISTELMÄ Rahkola, Nina. Tiiviisti yhdestä suusta. Tutkimus kertojan käytön merkityksestä dokumenttielokuvassa. Turku, syksy 2009, 68 s. Diakonia‐ammattikorkeakoulu, Diak Länsi Turku. Viestinnän koulutusohjelma, monimediatoimittajan suuntautumisvaihtoehto, medianomi (AMK). Opinnäytetyön tavoitteena oli selvittää, mitä kertojan käyttö merkitsee dokumenttielokuvassa. Tutkielmassa perehdyttiin myös siihen, miten kertojan käyttö vaikuttaa dokumentin tekoprosessiin. Lisäksi tar...

Arkea, ammattitaitoa ja yhteistyötä : työntekijöiden kokemuksia käytöshäiriöisten nuorten hoidosta koulukodissa

OpenAIRE

Haunia, Henna

2011-01-01

TIIVISTELMÄ Haunia, Henna. Arkea, ammattitaitoa ja yhteistyötä : työntekijöiden kokemuksia käytöshäiriöisten nuorten hoidosta koulukodissa. Helsinki, syksy 2011. Diakonia-ammattikorkeakoulu, Diak Etelä, Helsinki. Sosiaalialan koulutusohjelma, sosionomi (YAMK). Tämän opinnäytetyön tarkoituksena oli tutkia koulukodissa tapahtuvaan käytöshäiriöisten nuorten hoitoon liittyviä työmenetelmiä ja kehittämisen tarpeita. Tässä laadullisessa tutkimuksessa tutkimusmenetelmänä oli toimintatutkimus....

Influence of primary prey on home-range size and habitat-use patterns of northern spotted owls (Strix occidentalis caurina)

Science.gov (United States)

Cynthia J. Zabel; Kevin S. McKelvey; James P. Ward

1995-01-01

Correlations between the home-range size of northern spotted owls (Strix occidentalis caurina) and proportion of their range in old-growth forest have been reported, but there are few data on the relationship between their home-range size and prey. The primary prey of spotted owls are wood rats and northern flying squirrels (Glaucomys sabrinus). Wood...

The effect of support springs in ends welded gap hollow YT-joint

Directory of Open Access Journals (Sweden)

R. F. Vieira

Full Text Available This paper presents an analysis on the effect of support springs in an ends circular hollow sections welded into a YT joint. The overall behavior and failure of the joint were characterized under axial compression of the lap brace. Two joint failure modes were identified: chord wall plastification (Mode A and cross-sectional chord buckling (Mode F in the region below the lap brace. The system was modeled with and without support springs using the numerical finite element program Ansys. Model results were compared with experimental data in terms of principal stress in the joint intersection. The finite element model without support springs proved to be more accurate than that with support springs.

Meta-analysis of California Spotted Owl (Strix occidentalis occidentalis) territory occupancy in the Sierra Nevada: habitat associations and their implications for forest management

Science.gov (United States)

Douglas J. Tempel; John J. Keane; R. J. Gutierrez; Jared D. Wolfe; Gavin M. Jones; Alexander Koltunov; Carlos M. Ramirez; William J. Berigan; Claire V. Gallagher; Thomas E. Munton; Paula A. Shaklee; Sheila A. Whitmore; M. Zachariah Peery

2016-01-01

We assessed the occupancy dynamics of 275 California Spotted Owl (Strix occidentalis occidentalis) territories in 4 study areas in the Sierra Nevada, California, USA, from 1993 to 2011. We used Landsat data to develop maps of canopy cover for each study area, which we then used to quantify annual territory-specific habitat...

Effect of yield to tensile (Y/T) ratio on the structural integrity of offshore pipeline: advanced engineering assessment using limit state design approach

Energy Technology Data Exchange (ETDEWEB)

Malatesta, G; Mannucci, G; Demofonti, G [Centro Sviluppo Materiali S.p.A., Rome (Italy); Cumino, G [TenarisDalmine (Italy); Izquierdo, A; Tivelli, M [Tenaris Group (Mexico); Quintanilla, H [TENARIS Group (Mexico). TAMSA

2005-07-01

Nowadays specifications require strict Yield to Tensile ratio limitation, nevertheless a fully accepted engineering assessment of its influence on pipeline integrity is still lacking. Probabilistic analysis based on structural reliability approach (Limit State Design) aimed at quantifying the Y/T ratio influence on failure probabilities of offshore pipelines was made. In particular, Tenaris seamless pipe data were used as input for the probabilistic failure analysis. The LSD approach has been applied to two actual deep water design cases that have been on purpose selected, and the most relevant failure modes have been considered. Main result of the work is that the quantitative effect of the Y/T ratio on failure probabilities of a deep water pipeline resulted not so big as expected; it has a minor effect, especially when failure modes are governed by Y only. (author)

Verkkoyhteisöpalveluiden käytön hyödyt ja haitat työllistyvyydelle

OpenAIRE

Toivonen, Julia

2016-01-01

Sosiaalisen median käyttö on kasvanut viime vuosina huomattavasti ja verkkoyhteisöpalveluiden käyttö työllistyvyyden edistämisen apuna on kasvussa. Verkkoyhteisöpalveluiden käytöllä voidaan katsoa olevan sekä positiivia että negatiivisia vaikutuksia yksilön työllistyvyydelle. Sosiaalisella medialla on suuri mahdollisuus toimia erityisen tehokkaana osana yksilön työllistyvyyden edistämistä, sillä sosiaalinen media tarjoaa paljon mahdollisuuksia rekrytointiin, omien taitojen esille tuomiseen se...

A telemetry study of the social organization of a tawny owl (Strix aluco) population

DEFF Research Database (Denmark)

Sunde, Peter; Bølstad, Mikkel S.

2004-01-01

The spatial dispersion and social interactions were studied in 11 neighbouring pairs of radio-tagged tawny owls Strix aluco in a deciduous wood in Denmark from 1998-2001. The numbers and shapes of territories were stable throughout the survey and similar to a mapping made 40 years earlier. The home...... involving one owl only from each pair. The dispute rate between neighbouring pairs correlated positively with home-range overlap. The total annual mortality was 21% (95% CI: 6-33%). Dead owners were usually replaced within 1-2 months. Two out of four cases of radio-tagged owls disappearing from...

Biodegradation of Di-(2-ethylhexyl) Phthalate by Rhodococcus ruber YC-YT1 in Contaminated Water and Soil

OpenAIRE

Ting Yang; Lei Ren; Yang Jia; Shuanghu Fan; Junhuan Wang; Jiayi Wang; Ruth Nahurira; Haisheng Wang; Yanchun Yan

2018-01-01

Di-(2-ethylehxyl) phthalate (DEHP) is one of the most broadly representative phthalic acid esters (PAEs) used as a plasticizer in polyvinyl chloride (PVC) production, and is considered to be an endocrine-disrupting chemical. DEHP and its monoester metabolites are responsible for adverse effects on human health. An efficient DEHP-degrading bacterial strain Rhodococcus ruber YC-YT1, with super salt tolerance (0–12% NaCl), is the first DEHP-degrader isolated from marine plastic debris found in c...

Variação temporal do gradiente radial de o/h a partir de uma amostra de nebulosas planetárias

Science.gov (United States)

Maciel, W. J.; Costa, R. D. D.; Uchida, M. M. M.

2003-08-01

Gradientes radiais de abundância são observados no disco de nossa Galáxia e também em outras galáxias espirais. No caso da Galáxia, o principal problema relativo aos gradientes é sua variação temporal, que constitui um dos principais vínculos aos modelos de evolução química da Galáxia. As nebulosas planetárias são particularmente interessantes no estudo dos gradientes e suas variações, tanto espaciais como temporais. São objetos brilhantes, podendo ser observadas a grandes distâncias, e têm abundâncias relativamente precisas de diversos elementos químicos. Além disso, sendo originadas de estrelas com massas entre 0.8 e 8 massas solares na sequência principal, incluem objetos com idades e populações diferentes, o que as torna especialmente interessantes ao estudo da variação temporal dos gradientes. Neste trabalho, apresentamos resultados recentes sobre a variação temporal do gradiente de O/H a partir de uma amostra contendo cerca de 200 nebulosas, para as quais obtivemos distâncias por métodos estatísticos. As abundâncias foram parcialmente obtidas a partir de observações em Itajubá e La Silla, sendo as restantes obtidas da literatura. Os resultados mostram, pela primeira vez, evidências de um achatamento do gradiente de O/H, de -0.11 dex/kpc para -0.06 dex/kpc nos últimos 9 giga-anos ou de -0.08 dex/kpc para -0.06 dex/kpc nos últimos 5 giga-anos. Esses valores apresentam um bom acordo com alguns modelos recentes para a evolução química da Galáxia. (FAPESP/CNPq)

Integração da lógica nebulosa à recuperação de informação em data warehouse

OpenAIRE

Luz, Robinson

2005-01-01

A presente pesquisa tem como objeto de estudo a integração da lógica nebulosa às tecnologias de data warehouse . Objetiva, especificamente, propor, com base nas teorias e práticas da Ciência da informação, um modelo conceitual alternativo de organização e recuperação de informação.Para o desenvolvimento do modelo são descritos diversos tipos de bancos de dados e seu histórico, desde sua criação até os armazéns de dados chamados data warehouse . Quanto aos data warehouse , são expostos su...

Detecção e classificação de curto-circuitos em sistemas de distribuição usando rede neural artificial ARTMAP nebulosa

OpenAIRE

Martins, João Roberto Deroco [UNESP

2010-01-01

Este trabalho apresenta uma metodologia para detecção e classificação de faltas do tipo curto-circuito. Esta operação de diagnóstico tem como principal operador um banco de redes neurais artificiais (RNAs) do tipo ARTMAP Nebulosa. Tal ferramenta segue a principal filosofia das RNAs: o reconhecimento de padrões, através de um trei- namento supervisionado inicial, responsável por atualizar os parâmetros das redes con- comitantemente com os resultados desejados. Finalizada a fase de adaptação, a...

Terminologia työvälineenä – aikamuotojärjestelmästä ja sen opetuskäytänteiden ergonomiasta S2-opetuksessa

Directory of Open Access Journals (Sweden)

Maria Kok

2012-10-01

Full Text Available Artikkeli käsittelee kahta ongelmalliseksi osoittautunutta verbien tempusnimitystä, perfektiä ja imperfektiä. Tarkastelen kirjoituksessani nimitysten välittämää informaatiota, jota vertaan S2-oppikirjoissa aikamuotojen käytöstä annettuun tietoon. Kriittisen katsauksen tavoitteena on osoittaa harhaanjohtavien termien haitta ja hyvän metakielen tarve sekä myös pohtia keinoja virheellisten nimitysten korjaamiseksi. Teoreettisena viitekehyksenä on työolosuhteita, työvälineitä ja työtapoja tutkiva ergonomia. Koska kielen opetus ja opiskelu ovat työtä ja metakieli on työväline, jolla opettaja ja opiskelijat yhdessä työskentelevät, on käytettävän termistön ammatillinen ja käytännönläheinen arviointi tarpeen. DOI: http://dx.doi.org/10.5128/LV22.04

Age-dependent diet change, parental care and reproductive costin tawny owls Strix aluco

Science.gov (United States)

Sasvári, Lajos; Hegyi, Zoltán; Csörgõ, Tibor; Hahn, István

2000-07-01

Tawny owls Strix aluco breeding in nest-boxes were studied in a mixed oak/hornbeam/beech forest located in the Duna-Ipoly National Park 30 km north-west of Budapest, Hungary, during the period 1992-1999. Diet composition, prey mass, breeding performance and body mass of the parents of known age were recorded. Older males had a greater ability to choose alternate prey, delivered a greater mass of prey with a higher feeding frequency and achieved higher productivity than younger males when the availability of the preferred prey declined. The reproductive cost was paid only by young parents. We suggest that the lowest breeding performance, which was observed with young parents in adverse weather conditions, may be due to both the lower ability of these younger birds to exploit alternative prey and to their poor body condition which resulted in them providing fewer resources to their offspring because of their need to provide for their own survival.

Lógica nebulosa para avaliar riscos na auditoria Fuzzy logic for risk assessment in auditing

Directory of Open Access Journals (Sweden)

Jerônimo Antunes

2006-08-01

Full Text Available A avaliação dos riscos de que os controles internos de uma entidade possam falhar constitui-se em significativo desafio para os auditores independentes de demonstrações contábeis. As metodologias de trabalho empregadas para tal finalidade, normalmente, utilizam a lógica clássica, ou também denominada binária, presumindo que os fatores de riscos estão presentes, ou não, em um determinado tipo de processo de controle. O objetivo deste trabalho foi conceber um modelo de avaliação de risco dos controles internos de uma entidade utilizando a lógica nebulosa (fuzzy logic, para contemplar os elementos difusos que compõem os fatores desse tipo de risco analisados na auditoria de demonstrações contábeis. A validação conceitual do modelo concebido foi realizada por meio de entrevistas e debates com especialistas em auditoria de demonstrações contábeis e com consultas a bibliografias relevantes pertinentes. Como conclusão do estudo, ficou patente que o modelo de avaliação de risco, com o uso da lógica nebulosa, elimina a restrição binária da lógica clássica e permite tratar, de forma quantitativa, conceitos ambíguos através da aplicação de uma escala psicométrica, para refl etir predicados tais como: "muito bom", "bom", "razoável", "de grande importância", "de pouca importância" etc., tendo potencial para produzir resultados mais amplos e próximos da realidade.The assessment of the risks that an entity's internal control system may fail represents a significant challenge to independent auditors. The methodologies used to audit financial statements are usually supported by classical logic, also called binary logic, departing from the relatively simplistic premise that risk factors are either present or not in a certain kind of control process. This study aimed to conceive a risk assessment model for an entity's internal control system, using the fuzzy logic approach, to take into account the diffuse elements that

Clutch size variation in Tawny Owls (Strix aluco) from adjacent valley systems: can this be used as a surrogate to investigate temporal and spatial variations in vole density?

Science.gov (United States)

Steve J. Petty; Billy L. Fawkes

1997-01-01

Research on Tawny Owls (Strix aluco) in Kielder Forest, northern England, since 1981 demonstrated that field voles (Microtus agrestis) were their most important food. Here, field voles exhibited a 3-4 year cycle of abundance, and mean clutch size in Tawny Owls was significantly related to vole abundance in March. In this analysis...

Some haltuun : Murrosikäisen sosiaalisen median käytön ohjaus terveydenhoitajan työssä

OpenAIRE

Paavola, Pinja; Haapala, Lotta

2016-01-01

Opinnäytetyön tavoitteena oli lisätä terveydenhoitajien tietämystä sosiaalisesta mediasta, jotta he osaavat ohjata murrosikäisiä sosiaalisen median turvallisessa käytössä ja, että murrosikäinen voi käyttää sosiaalista mediaa turvallisesti. Tarkoituksena oli selvittää, miten murrosikäinen käyttää sosiaalisen median sovelluksia ja miten terveydenhoitaja voisi ohjata sosiaalisen median turvalliseen käyttöön. Tutkimuskysymyksinä oli selvittää; mitä murrosikäinen tietää sosiaalisen median turvalli...

High-level expression, secretion, and purification of the thermostable aqualysin I from Thermus aquaticus YT-1 in Pichia pastoris

DEFF Research Database (Denmark)

Oledzka, G.; Dabrowski, Slawomir; Kur, J.

2003-01-01

Aqualysin I is a heat-stable subtilisin-type serine protease which is secreted into the culture medium by Thermus aquaticus YT-1, an extreme thermophile. We report the high-level expression of an aqualysin I protein using its native signal sequence for secretion in the methylotrophic yeast, Pichia...... to that of the native enzyme. We also explored the possibility of secreting the GAP expressed aqualysin I in P. pastoris by in-frame fusion of the Saccharomyces cerevisiae alpha-factor secretion signal. However, the levels of secreted pro-aqualysin I particles were approximately 10 times lower, possibly...

California Spotted Owl (Strix occidentalis occidentalis) habitat use patterns in a burned landscape

Science.gov (United States)

Eyes, Stephanie; Roberts, Susan L.; Johnson, Matthew D.

2017-01-01

Fire is a dynamic ecosystem process of mixed-conifer forests of the Sierra Nevada, but there is limited scientific information addressing wildlife habitat use in burned landscapes. Recent studies have presented contradictory information regarding the effects of stand-replacing wildfires on Spotted Owls (Strix occidentalis) and their habitat. While fire promotes heterogeneous forest landscapes shown to be favored by owls, high severity fire may create large canopy gaps that can fragment the closed-canopy habitat preferred by Spotted Owls. We used radio-telemetry to determine whether foraging California Spotted Owls (S. o. occidentalis) in Yosemite National Park, California, USA, showed selection for particular fire severity patch types within their home ranges. Our results suggested that Spotted Owls exhibited strong habitat selection within their home ranges for locations near the roost and edge habitats, and weak selection for lower fire severity patch types. Although owls selected high contrast edges with greater relative probabilities than low contrast edges, we did not detect a statistical difference between these probabilities. Protecting forests from stand-replacing fires via mechanical thinning or prescribed fire is a priority for management agencies, and our results suggest that fires of low to moderate severity can create habitat conditions within California Spotted Owls' home ranges that are favored for foraging.

Chemical characterization of milk oligosaccharides of an African lion (Panthera leo) and a clouded leopard (Neofelis nebulosa).

Science.gov (United States)

Senda, Akitsugu; Hatakeyama, Emi; Kobayashi, Rui; Fukuda, Kenji; Uemura, Yusuke; Saito, Tadao; Packer, Craig; Oftedal, Olav T; Urashima, Tadasu

2010-12-01

The Carnivora include the superfamilies Canoidea and Feloidea. In species of Canoidea other than the domestic dog, Canis lupus, the milk contains only traces of lactose and much larger concentrations of oligosaccharides. In this study, lactose was found to be the dominant saccharide in the milk or colostrum of two species of Feloidea, namely the African lion (Panthera leo) and the clouded leopard (Neofelis nebulosa). In addition to lactose, the following oligosaccharides were characterized in the milk of a lion; Neu5Gc(α2-3)Gal(β1-4)Glc (3'-NGc-SL), Fuc(α1-2)Gal(β1-4)Glc (2'-fucosyllactose) and GalNAc(α1-3)[Fuc(α1-2)]Gal(β1-4)Glc (A-tetrasaccharide). The colostrum of a clouded leopard contained 3'-NGc-SL, Gal(α1-3)Gal(β1-4)Glc (isoglobotriose) and A-tetrasaccharide. These oligosaccharides differ in some respects from those previously identified in another species of Feloidea, the spotted hyena (Crocuta crocuta). These milks contained 3'-NGc-SL and A-tetrasaccharide, while spotted hyena colostrum did not; however, it contained Neu5Ac(α2-3)Gal(β1-4)Glc (3'-NAc-SL) and Gal(α1-3)[Fuc(α1-2)]Gal(β1-4)Glc (B-tetrasaccharide). © 2010 The Authors. Journal compilation © 2010 Japanese Society of Animal Science.

Prevendo a atividade solar através de redes neurais nebulosas

Science.gov (United States)

Martin, V. A. F.; Poppe, P. C. R.

2003-08-01

Atualmente, a integração de redes neurais com técnicas da Matemática Nebulosa (Fuzzy Sets), tem sido usada robustamente para fazer previsões em vários sistemas físicos. Este trabalho representa uma continuidade da contribuição apresentada anteriormente durante a XXVIIa Reunião Anual da SAB, onde exploramos a aplicação de redes neurais para previsões futuras de séries temporais. Para este, enfatizamos o uso da técnica ANFIS (Adaptative Neuro-Fuzzy Inference System), que consiste em uma rede do tipo back-propagation, onde os dados são processados em uma camada intermediária, tendo numa camada de saída, os dados numéricos. Para que a previsão seja feita com sucesso utilizando-se técnicas matemáticas adequadas, é fundamental a existência de uma série razoavelmente longa de modo que a dinâmica contida nesta possa ser melhor extraída pela rede neural. Nesse sentido, foram utilizados novamente os dados históricos das manchas do Sol (1818-2002) afim de verificar o comportamento futuro da atividade solar (Ciclos de Schawbe) a partir da técnica descrita acima. Previsões realizadas para o ciclo anterior (n.22, máximo de 158,5 em julho de 1989), bem como para o atual (n.23, máximo de 153 em setembro de 2000), apontam valores bastante coerentes com os publicados na literatura, levando em consideração, respectivamente, as barras de erros associadas: 166+/-18 e 160+/-14. Para o próximo ciclo de Schawbe (2006-2017), nossa previsão aponta o valor de 172+/-23 como máximo para o primeiro semestre de 2011 (Abril +/- 3 meses). A ANFIS acompanha de maneira satisfatória o movimento das séries estudadas durante o treinamento e durante a verificação (menor dispersão das funções de pertinência), com erro absoluto inferior a 20 por cento.

Estudo comparativo entre estrelas centrais de nebulosas planetárias deficientes em hidrogênio

Science.gov (United States)

Marcolino, W. L. F.; de Araújo, F. X.

2003-08-01

Apresentamos neste trabalho o resultado de um estudo das principais características espectrais das estrelas centrais de nebulosas planetárias (ECNP) deficientes em hidrogênio. A origem e a evolução dessas estrelas ainda constitui um problema em aberto na evolução estelar. Geralmente esses objetos são divididos em [WCE], [WCL] e [WELS]. Os tipos [WCE] e [WCL] apresentam um espectro típico de uma estrela Wolf-Rayet carbonada de população I e as [WELS] apresentam linhas fracas de carbono e oxigênio em emissão. Existem evidências que apontam a seguinte sequência evolutiva : [WCL] = > [WCE] = > [WELS] = > PG 1159 (pré anã-branca). No entanto, tal cenário apresenta falhas como por exemplo a falta de ECNP entre os tipos [WCL] e [WCE]. Baseados em uma amostra de 24 objetos obtida no telescópio de 1.52m em La Silla, Chile (acordo ESO/ON), ao longo do ano 2000, apresentamos os resultados da comparação das larguras equivalentes de diversas linhas relevantes entre os tipos [WCL], [WCE] e [WELS]. Verificamos que nossos dados estão de acordo com a sequência evolutiva. Baseado nas linhas de C IV, conseguimos dividir pela primeira vez as [WELS] em dois grupos principais. Além disso, os dados reforçam a afirmação de que as [WCE] são as estrelas que possuem a maior temperatura entre as ECNP deficientes em hidrogênio. Discutimos ainda, a escassez de dados disponíveis na literatura e a necessidade da obtenção de parametros físicos para estes objetos.

Determination of Gastrointestinal Transit Times in Barred Owls ( Strix varia ) by Contrast Fluoroscopy.

Science.gov (United States)

Doss, Grayson A; Williams, Jackie M; Mans, Christoph

2017-06-01

Contrast imaging studies are routinely performed in avian patients when an underlying abnormality of the gastrointestinal (GI) tract is suspected. Fluoroscopy offers several advantages over traditional radiography and can be performed in conscious animals with minimal stress and restraint. Although birds of prey are commonly encountered as patients, little is known about GI transit times and contrast imaging studies in these species, especially owls. Owls are commonly encountered in zoological, educational, and wildlife settings. In this study, 12 adult barred owls ( Strix varia ) were gavage fed a 30% weight-by-volume barium suspension (25 mL/kg body weight). Fluoroscopic exposures were recorded at 5, 15, 30, 60, 120, 180, 240, and 300 minutes after administration. Overall GI transit time and transit times of various GI organs were recorded. Median (interquartile range [IQR]) overall GI transit time was 60 minutes (IQR: 19-60 minutes) and ranged from 5-120 minutes. Ventricular and small intestinal contrast filling was rapid. Ventricular emptying was complete by a median of 60 minutes (IQR: 30-120 minutes; range: 30-240 minutes), whereas small intestinal emptying was not complete in 9/12 birds by 300 minutes. Median small intestinal contraction rate was 15 per minute (IQR: 13-16 minutes; range: 10-19 minutes). Median overall GI transit time in barred owls is more rapid than mean transit times reported for psittacine birds and red-tailed hawks ( Buteo jamaicensis ). Fluoroscopy is a safe, suitable method for investigating GI motility and transit in this species.

Avian trichomonosis in spotted owls (Strix occidentalis: Indication of opportunistic spillover from prey

Directory of Open Access Journals (Sweden)

Krysta H. Rogers

2016-12-01

Full Text Available Avian trichomonosis, caused by the flagellated protozoan parasite Trichomonas gallinae, has variable pathogenicity among bird species ranging from asymptomatic infections to severe disease periodically manifesting in epidemic mortality. Traditionally, columbids are identified as highly susceptible to infection with occasional spillover into raptors that prey on infected birds. We identified avian trichomonosis in two dead California spotted owls (Strix occidentalis occidentalis and three dead northern spotted owls (S. o. caurina in California during 2011–2015; infection was confirmed in four owls by PCR. Pathologic lesions associated with trichomonosis in the owls included caseonecrotic lesions of the upper palate accompanied by oropharyngitis, cellulitis, myositis, and/or sinusitis. Spotted owls are known to mainly feed on small mammals; therefore, the source of infection as well as the significance of the disease in spotted owls is unclear. These owl trichomonosis cases coincided temporally and spatially with three trichomonosis epidemics in band-tailed pigeons (Patagioenas fasciata monilis. The same parasite, T. gallinae subtype A2, was isolated from the spotted owls and band-tailed pigeons, suggesting the owls became infected when opportunistically feeding on pigeons during mortality events. Avian trichomonosis is an important factor in the decline of the Pacific Coast band-tailed pigeon population with near-annual mortality events during the last 10 years and could have conservation implications for raptor species at risk, particularly those that are facing multiple threats.

Radiographic evaluation of perching-joint angles in cockatiels (Nymphicus hollandicus), Hispaniolan Amazon parrots (Amazona ventralis), and barred owls (Strix varia).

Science.gov (United States)

Bonin, Glen; Lauer, Susanne K; Guzman, David Sanchez-Migallon; Nevarez, Javier; Tully, Thomas N; Hosgood, Giselle; Gaschen, Lorrie

2009-06-01

Information on perching-joint angles in birds is limited. Joint immobilization in a physiologic perching angle has the potential to result more often in complete restoration of limb function. We evaluated perching-joint angles in 10 healthy cockatiels (Nymphicus hollandicus), 10 Hispaniolan Amazons (Amazona ventralis), and 9 barred owls (Strix varia) and determined intra- and interobserver variability for goniometric measurements in 2 different radiographic projections. Intra- and interobserver variation was less than 7% for all stifle and intertarsal joint measurements but frequently exceeded 10% for the hip-joint measurements. Hip, stifle, and intertarsal perching angles differed significantly among cockatiels, Hispaniolan Amazon parrots, and barred owls. The accuracy of measurements performed on straight lateral radiographic projections with superimposed limbs was not consistently superior to measurements on oblique projections with a slightly rotated pelvis. Stifle and intertarsal joint angles can be measured on radiographs by different observers with acceptable variability, but intra- and interobserver variability for hip-joint-angle measurements is higher.

EXPLORATORY PLASMA BIOCHEMISTRY REFERENCE INTERVALS FOR URAL OWLS (STRIX URALENSIS, PALLAS 1771) FROM THE AUSTRIAN REINTRODUCTION PROJECT.

Science.gov (United States)

Scope, Alexandra; Schwendenwein, Ilse; Stanclova, Gabriela; Vobornik, Angela; Zink, Richard

2016-06-01

The Ural owl (Strix uralensis) is the biggest forest-living owl in Austria; however, it became extinct in Austria through poaching and habitat loss more than half a century ago. The birds examined in the present study were breeding pairs from the reintroduction project with the aim of determining exploratory plasma biochemistry reference intervals in Ural owls and evaluating the amount of biological variation between seasons, sexes, and ages. A total of 45 birds were sampled, including 13 adult males, 14 adult females, and 18 juvenile birds. Remarkably, almost all of the analytes showed significant differences between the subgroups, primarily between seasons, followed by age and sex. Only creatinkinase, glucose, lactatdehydrogenase, and triglycerides did not show any significant variations. Despite partitioning of reference values into subgroups according to biological variation diminishing the number of reference individuals in the respective groups, the resulting smaller reference intervals will improve medical assessment. The results of the present study once again demonstrate that significant seasonal fluctuations must be expected and considered in the interpretation. It can be assumed that these differences are probably even greater in free-range birds with considerable changes in food quantity and quality during and between years.

Blood parasites in Owls with conservation implications for the Spotted Owl (Strix occidentalis)

Science.gov (United States)

Ishak, H.D.; Dumbacher, J.P.; Anderson, N.L.; Keane, J.J.; Valkiunas, G.; Haig, S.M.; Tell, L.A.; Sehgal, R.N.M.

2008-01-01

The three subspecies of Spotted Owl (Northern, Strix occidentalis courina; California, S. o. occidentalis; and Mexican, S. o. lucida) are all threatened by habitat loss and range expansion of the Barred Owl (S. varia). An unaddressed threat is whether Barred Owls could be a source of novel strains of disease such as avian malaria (Plasmodium spp.) or other blood parasites potentially harmful for Spotted Owls. Although Barred Owls commonly harbor Plasmodium infections, these parasites have not been documented in the Spotted Owl. We screened 111 Spotted Owls, 44 Barred Owls, and 387 owls of nine other species for haemosporidian parasites (Leucocytozoon, Plasmodium, and Haemoproteus spp.). California Spotted Owls had the greatest number of simultaneous multi-species infections (44%). Additionally, sequencing results revealed that the Northern and California Spotted Owl subspecies together had the highest number of Leucocytozoon parasite lineages (n=17) and unique lineages (n=12). This high level of sequence diversity is significant because only one leucocytozoon species (L. danilewskyi) has been accepted as valid among all owls, suggesting that L. danilewskyi is a cryptic species. Furthermore, a Plasmodium parasite was documented in a Northern Spotted Owl for the first time. West Coast Barred Owls had a lower prevalence of infection (15%) when compared to sympatric Spotted Owls (S. o. caurina 52%, S. o. occidentalis 79%) and Barred Owls from the historic range (61%). Consequently, Barred Owls on the West Coast may have a competitive advantage over the potentially immune compromised Spotted Owls. ?? 2008 Ishak et al.

Lean jatkuvan kehittämisen ideataulu Herttoniemen päiväkirurgiseen yksikköön - Ideasta käytäntöön

OpenAIRE

Rapo, Jonna

2016-01-01

Lean jatkuvan kehittämisen ideataulu Herttoniemen päiväkirurgiseen yksikköön - Ideasta käytäntöön Opinnäytetyön tarkoituksena oli selvittää työntekijöiden keinoja kehittää hoitotyötä ennen Lean ideataulun käyttöönottoa ja selvittää onko ideataulu toimiva tapa kehittää hoitotyötä. Opinnäytetyön tavoitteena oli kehittää Herttoniemen päiväkirurgisen yksikön hoitotyötä potilaan parhaaksi Lean ideataulun avulla. Työntekijät voivat laittoivat kehittämisideoita ideatauluun, josta valittiin tote...

Diet of the Tawny Owl Strix aluco in the area of Slovenske gorice (NE Slovenia

Directory of Open Access Journals (Sweden)

Janžekovič Franc

2017-11-01

Full Text Available The diet of Tawny Owl Strix aluco was studied in the area of Slovenske gorice - NE Slovenia. The analysis was carried out by examining pellets collected at ten locations in the period from 1984 to 2015. From the pellets, 2,121 prey units were isolated. The predominant prey were mammals (Mammalia, 84.8%, followed by birds (Aves, 8.3%, insects (Insecta, 4.7%, frogs (Anura, 1.6% and earthworms (Oligochaeta, 0.5%. Four orders of mammals were found: rodents (Rodentia, insectivores (Insectivora, bats (Chiroptera and carnivores (Carnivora. The most frequent prey in the owls’ diet were voles (Arvicolinae, 46.6% and mice (Murinae, 28.8%, while the number of shrews (Soricidae was low (4.5%. The obtained results are in concordance with the conclusions of other studies. In the area of Slovenske gorice, the Tawny Owl is an opportunistic predator of small mammals with an emphasis on voles and mice. Prey frequencies differ significantly among some localities. Variability in proportions of prey species among localities can also be the result of sampling carried out in different seasons and variability in the population dynamics of small mammals among years. Challenges for future research are to describe seasonal variability of the diet and to evaluate interspecific competition within the guild of night predators of small mammals: Tawny Owl, Long-eared Owl Asio otus, and Barn Owl Tyto alba, which are sympatric in this area.

Algunes qüestions clau de protecció de dades al núvol. Cap a una «regulació nebulosa»

Directory of Open Access Journals (Sweden)

Lorenzo Cotino Hueso

2015-12-01

Full Text Available S'aborden algunes deficiències de la vella i superada regulació nacional i europea de protecció de dades aplicable als serveis del núvol, així com acció d'institucions de protecció de dades per corregir-les. També s'analitza l'esperat reglament europeu de protecció de dades, entre altres aspectes, la seva tendència a reforçar les obligacions del prestador de serveis de núvol, com a «encarregat» de protecció de dades. Igualment s'estudien les exigències respecte del conjunt contractual i la subcontractació de serveis de núvol. L'ús del núvol freqüentment suposa una transferència internacional de dades; sobre això s'aborden vies de flexibilització de la necessitat d'autorització prèvia (a través de les clàusules contractuals tipus i binding corporate rules. Finalment, es valora el paper de la normativa tècnica privada sobre serveis de núvol (com les normes ISO o l’autoregulació del sector i la futura normativa tècnica que haurà d'aprovar o la Comissió Europea o cada Estat, segons com es reguli finalment en el futur reglament europeu. Aquesta coregulació per normativa tècnica pública o privada acaba conformant-se com una regulació més o menys nebulosa.

Eihän "leikkitäti" voi väsyä, vai voiko? : Käytännön olosuhteet ja työstä aiheutuva stressi musiikkileikkikoulunopettajan työssä

OpenAIRE

Busk, Vilma

2012-01-01

TIIVISTELMÄ Tässä opinnäytetyössä tarkastellaan musiikkileikkikoulunopettajan työtä ja sen haasteita. Keskiössä ovat työn käytännön olosuhteet ja työstä aiheutuva stressi. Opinnäytetyötäni varten tein kyselytutkimuksen, jonka toteutin Internet-kyselynä Facebookissa, Muskari-ideoita-sivustolla. Kyselyyn vastasi 48 musiikkileikkikoulunopettajaa, joilla oli vaihteleva määrä kokemusta ja jotka olivat iältään 21—50-vuotiaita. Vastaajien taustatietojen lisäksi kartoitin mahdollisimman mon...

Role of disulphide bonds in a thermophilic serine protease aqualysin I from Thermus aquaticus YT-1.

Science.gov (United States)

Sakaguchi, Masayoshi; Takezawa, Makoto; Nakazawa, Rie; Nozawa, Kazutaka; Kusakawa, Taro; Nagasawa, Takeshi; Sugahara, Yasusato; Kawakita, Masao

2008-05-01

A thermophilic serine protease, Aqualysin I, from Thermus aquaticus YT-1 has two disulphide bonds, which are also found in a psychrophilic serine protease from Vibrio sp. PA-44 and a proteinase K-like enzyme from Serratia sp. at corresponding positions. To understand the significance of these disulphide bonds in aqualysin I, we prepared mutants C99S, C194S and C99S/C194S (WSS), in which Cys69-Cys99, Cys163-Cys194 and both of these disulphide bonds, respectively, were disrupted by replacing Cys residues with Ser residues. All mutants were expressed stably in Escherichia coli. The C99S mutant was 68% as active as the wild-type enzyme at 40 degrees C in terms of k(cat) value, while C194S and WSS were only 6 and 3%, respectively, as active, indicating that disulphide bond Cys163-Cys194 is critically important for maintaining proper catalytic site conformation. Mutants C194S and WSS were less thermostable than wild-type enzyme, with a half-life at 90 degrees C of 10 min as compared to 45 min of the latter and with transition temperatures on differential scanning calorimetry of 86.7 degrees C and 86.9 degrees C, respectively. Mutant C99S was almost as stable as the wild-type aqualysin I. These results indicate that the disulphide bond Cys163-Cys194 is more important for catalytic activity and conformational stability of aqualysin I than Cys67-Cys99.

Effects of light and presence of fish on lure display and larval release behaviours in two species of freshwater mussels

Science.gov (United States)

Wendell R. Haag; Melvin L. Warren

2000-01-01

We investigated how two sympatric species of freshwater mussels transmit their parasitic larvae to fish hosts. We found that Villosa nebulosa and V. vibex both display large mantle lures to attract potential host fish, but V. nebulosa displayed only at night and V....

”Se on tärkeää, että sinä käyt ulkona, et istu vaan kotona ja teet erilaisia asioita.” : tutkimus harrastusten merkityksestä somalityttöjen vapaa-ajassa

OpenAIRE

Tikkanen, Noora

2013-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia miten yksin Suomeen tulleet ja tälläkin hetkellä ilman perhettään asuvat somalitytöt viettävät vapaa-aikaansa, minkä merkityksen he antavat harrastuksille ja mitkä asiat vaikuttavat harrastustoimintaan osallistumiseen. Tutkimuksen tavoitteena oli löytää keinoja, joilla voitaisiin lisätä Turun ensi- ja turvakoti ry:n perheryhmäkodissa asuvien somalityttöjen harrastusaktiivisuutta, ja edistää näin heidän hyvinvointiaan ja kotoutumistaan. Tutkimus...

Iodine chemistry effect on source term assessments. A MELCOR 186 YT study of a PWR severe accident sequence

International Nuclear Information System (INIS)

Herranz, Luis E.; Garcia, Monica; Otero, Bernadette

2009-01-01

Level-2 Probabilistic Safety Analysis has demonstrated to be a powerful tool to give insights into multiple aspects concerning severe accidents: phenomena with the greatest potential to lead to containment failure, safety systems performance and, even, to identify any additional accident management that could mitigate the consequences of such an even, etc. A major result of level-2 PSA is iodine content in Source Term since it is the main responsible for the radiological impact during the first few days after a hypothetical severe accident. Iodine chemistry is known to considerably affect iodine behavior and although understanding has improved substantially since the early 90's, a thorough understanding is still missing and most PSA studies do not address it when assessing severe accident scenarios. This paper emphasizes the quantitative and qualitative significance of considering iodine chemistry in level-2 PSA estimates. To do so a cold leg break, low pressure severe accident sequence of an actual pressurized water reactor has been analyzed with the MELCOR 1.8.6 YT code. Two sets of calculations, with and without chemistry, have been carried out and compared. The study shows that iodine chemistry could result in an iodine release to environment about twice higher, most of which would consist of around 60% of iodine in gaseous form. From these results it is concluded that exploratory studies on the potential effect of iodine chemistry on source term estimates should be carried out. (author)

Relative effects of road risk, habitat suitability, and connectivity on wildlife roadkills: the case of tawny owls (Strix aluco).

Science.gov (United States)

Santos, Sara M; Lourenço, Rui; Mira, António; Beja, Pedro

2013-01-01

Despite its importance for reducing wildlife-vehicle collisions, there is still incomplete understanding of factors responsible for high road mortality. In particular, few empirical studies examined the idea that spatial variation in roadkills is influenced by a complex interplay between road-related factors, and species-specific habitat quality and landscape connectivity. In this study we addressed this issue, using a 7-year dataset of tawny owl (Strix aluco) roadkills recorded along 37 km of road in southern Portugal. We used a multi-species roadkill index as a surrogate of intrinsic road risk, and we used a Maxent distribution model to estimate habitat suitability. Landscape connectivity was estimated from least-cost paths between tawny owl territories, using habitat suitability as a resistance surface. We defined 10 alternative scenarios to compute connectivity, based on variation in potential movement patterns according to territory quality and dispersal distance thresholds. Hierarchical partitioning of a regression model indicated that independent variation in tawny owl roadkills was explained primarily by the roadkill index (70.5%) and, to a much lesser extent, by landscape connectivity (26.2%), while habitat suitability had minor effects (3.3%). Analysis of connectivity scenarios suggested that owl roadkills were primarily related to short range movements (habitat quality and landscape connectivity are globally high for the study species. Nevertheless, the study supported the view that functional connectivity should be incorporated whenever possible in roadkill models, as it may greatly increase their power to predict the location of roadkill hotspots.

Motivation and treatment credibility predict alliance in cognitive behavioral treatment for youth with anxiety disorders in community clinics.

Science.gov (United States)

Fjermestad, K W; Lerner, M D; McLeod, B D; Wergeland, G J H; Haugland, B S M; Havik, O E; Öst, L-G; Silverman, W K

2017-11-16

We examined whether motivation and treatment credibility predicted alliance in a 10-session cognitive behavioral treatment delivered in community clinics for youth anxiety disorders. Ninety-one clinic-referred youths (mean age  = 11.4 years, standard deviation = 2.1, range 8-15 years, 49.5% boys) with anxiety disorders-rated treatment motivation at pretreatment and perceived treatment credibility after session 1. Youths and therapists (YT) rated alliance after session 3 (early) and session 7 (late). Hierarchical linear models were applied to examine whether motivation and treatment credibility predicted YT early alliance, YT alliance change, and YT alliance agreement. Motivation predicted high early YT alliance, but not YT alliance change or alliance agreement. Youth-rated treatment credibility predicted high early youth alliance and high YT positive alliance change, but not early therapist alliance or alliance agreement. Conclusion Efforts to enhance youth motivation and treatment credibility early in treatment could facilitate the formation of a strong YT alliance. © 2017 Wiley Periodicals, Inc.

Effects of Hand-Rearing on Reproductive Success in Captive Large Cats Panthera tigris altaica, Uncia uncia, Acinonyx jubatus and Neofelis nebulosa.

Directory of Open Access Journals (Sweden)

Maja Coulthard Hampson

Full Text Available Species Survival Plans and European Endangered Species Programmes have been developed for several species of endangered felids in order to build up captive reserve populations and support their conservation in the wild. The Siberian tiger (Panthera tigris altaica, snow leopard (Uncia uncia, cheetah (Acinonyx jubatus and clouded leopard (Neofelis nebulosa are managed in such ex situ conservation programmes. Many zoological institutions hand-rear offspring if rearing by the mother fails. Hand-rearing can cause behavioural problems, resulting in decreased copulation and lower breeding success in some species. In this study, studbook data subsets were examined: from 1901 to 2011; and 2000 to 2011. We analysed records from 4273 Siberian tigers, 2045 snow leopards, 3435 cheetahs, and 804 clouded leopards. We assessed the number of offspring produced, litter size, age at first reproduction, longevity, infant mortality and generational rearing of hand-reared versus parent-reared individuals. Hand-reared Siberian tigers (p<0.01; p = 0.0113, snow leopards (p<0.01, male cheetahs (p<0.01 and female clouded leopards (p<0.01 produced fewer offspring than parent-reared individuals. Hand-reared snow leopard breeding pairs had larger litters than parent-reared pairs (p = 0.0404. Hand-reared snow leopard females reproduced later in life (p<0.01. Hand-reared female Siberian tigers lived shorter lives, while hand-reared cheetahs lived longer (p<0.01; p = 0.0107. Infant mortality was higher in hand-reared snow leopards (p<0.01 and male cheetahs (p = 0.0395 in the 1901-2011 dataset and lower in hand-reared female Siberian tiger and male snow leopard cubs (p = 0.0404; p = 0.0349 in the 2000-2011 dataset. The rearing of the mother and subsequent rearing of offspring showed a significant relationship for all species (p<0.01 for Siberian tiger and snow leopard cubs; p<0.001 for cheetah and snow leopard cubs. Taking into account the limited carrying capacity of zoos, the

Total number of planetary nebulae in different galaxies and the PN distance scale.

Science.gov (United States)

Peimbert, M.

1990-12-01

RESUMEN A partir de una muestra de quince galaxias se encuentra que la tasa de natalidad de nebulosas planetarias por unidad de luminosidad, , disminuye al aumentar la luminosidad y al aumentar (B - V)0. Se discuten posibles explicaciones para estos resultados. Se estima el valor de para la Galaxia y a partir de el se encuentra que el numero total de nebulosas planetarias en nuestra galaxia con R de 7200 j 1800. El valor galactico de implica que la mayorfa de las estrellas de masa intermedia pasa por la etapa de nebulosa planetaria. El valor galactico de , la tasa de mortalidad estelar por unidad de luminosidad y la tasa de natalidad de enanas blancas favorecen escalas de distancias largas para nebulosas planetarias, como la de Cudworth (1974) y la de Mallik y Peimbert (1988). ABSTRACT From a sample of fifteen galaxies it is found that the birth rate of PN per unit luminosity, , decreases with increasing luminosity and with increasing (B - V)0 possible reasons for these relationships are discussed. The value for the Galaxy is estimated and, from it, a total number of PN of 7200 # 1800 wid R < 0.64 pc is obtained. The galactic value implies that most of the intermediate mass stars go through the PN stage. The galactic value, the stellar death rate per unit luminosity and the white dwarf birth rate are in favor of long distance scales to PN like those of Cudworth (1974) and Mallik and (1988). Key wonis: NEBULAE.PLANETARY - STARS-EVOLUTION - STARS-SThLIAR STA. S

A non-standard optimal control problem arising in an economics application

Directory of Open Access Journals (Sweden)

Alan Zinober

2013-04-01

Full Text Available A recent optimal control problem in the area of economics has mathematical properties that do not fall into the standard optimal control problem formulation. In our problem the state value at the final time the state, y(T = z, is free and unknown, and additionally the Lagrangian integrand in the functional is a piecewise constant function of the unknown value y(T. This is not a standard optimal control problem and cannot be solved using Pontryagin's Minimum Principle with the standard boundary conditions at the final time. In the standard problem a free final state y(T yields a necessary boundary condition p(T = 0, where p(t is the costate. Because the integrand is a function of y(T, the new necessary condition is that y(T should be equal to a certain integral that is a continuous function of y(T. We introduce a continuous approximation of the piecewise constant integrand function by using a hyperbolic tangent approach and solve an example using a C++ shooting algorithm with Newton iteration for solving the Two Point Boundary Value Problem (TPBVP. The minimising free value y(T is calculated in an outer loop iteration using the Golden Section or Brent algorithm. Comparative nonlinear programming (NP discrete-time results are also presented.

Increase in distribution records of owl species in Manitoba based on a volunteer nocturnal survey using Boreal Owl (Aegolius funereus) and Great Gray Owl (Strix nebulosa) playback

Science.gov (United States)

James R. Duncan; Patricia A. Duncan

1997-01-01

From 1991 through 1995, extensive owl surveys were conducted in late March and early April in Manitoba. Prior to these surveys, distribution records of owls covered only 16-71 per cent of their expected range in Manitoba. The degree to which the survey increased the documented range varied from no increase (6 of 12 species) up to an 88 per cent increase for the...

An invariance property of the common trends under linear transformations of the data

DEFF Research Database (Denmark)

Johansen, Søren; Juselius, Katarina

It is well known that if X(t) is a nonstationary process and Y(t) is a linear function of X(t), then cointegration of Y(t) implies cointegration of X(t). We want to find an analogous result for common trends if X(t) is generated by a finite order VAR. We first show that Y(t) has an infinite order...... VAR representation in terms of its prediction errors, which are a linear process in the prediction error for X(t). We then apply this result to show that the limit of the common trends for Y(t) are linear functions of the common trends for X(t)....

[A Survey for Colton and Other 3 Rare Blood Group Systems in Chinese Nanjing Han Population].

Science.gov (United States)

Chen, Yan; Ma, Ling; Liu, Yan-Chun

2015-10-01

To investigate the distribution of Colton, Diego, Kell and Yt rare blood groups in Chinese Nanjing Han population, so as to improve the transfusion capability of patients with rare blood group and to further enrich the rare-blood-donor bank. A total of 2 015 blood samples from the blood donors were selected randomly to screen the presence of K⁺ and Kp(c+) (Kell), Yt(b+) (Yt), Co(b+) (Colton), Di(a+b+) and Di(a+b-) (Digeo) antigen allele by using PCR and multiplex PCR. Out of 2005 samples, 1 case with K⁺ gene, 8 cases with Yt(b+) gene and 100 cases with Di(a+b+) gene, 2 cases with Di(a+b-) were identified, while no Kp(c+) and Co(b+) were detected. The frequencies of K⁺, Yt(b+) and Di(a+), Di(b+) are 0.0003, 0.0013 and 0.0258, 0.9742, respectively. They are very rare blood groups in Chinese Nanjing Han population.

Solution matching for a three-point boundary-value problem on atime scale

Directory of Open Access Journals (Sweden)

Martin Eggensperger

2004-07-01

Full Text Available Let $mathbb{T}$ be a time scale such that $t_1, t_2, t_3 in mathbb{T}$. We show the existence of a unique solution for the three-point boundary value problem $$displaylines{ y^{DeltaDeltaDelta}(t = f(t, y(t, y^Delta(t, y^{DeltaDelta}(t, quad t in [t_1, t_3] cap mathbb{T},cr y(t_1 = y_1, quad y(t_2 = y_2, quad y(t_3 = y_3,. }$$ We do this by matching a solution to the first equation satisfying a two-point boundary conditions on $[t_1, t_2] cap mathbb{T}$ with a solution satisfying a two-point boundary conditions on $[t_2, t_3] cap mathbb{T}$.

An Invariance Property of the Common Trends under Linear Transformations of the Data

DEFF Research Database (Denmark)

Johansen, Søren; Juselius, Katarina

It is well known that if X(t) is a nonstationary process and Y(t) is a linear function of X(t), then cointegration of Y(t) implies cointegration of X(t). We want to find an analogous result for common trends if X(t) is generated by a finite order VAR. We first show that Y(t) has an infinite order...... VAR representation in terms of its prediction errors, which are a linear process in the prediction error for X(t). We then apply this result to show that the limit of the common trends for Y(t) are linear functions of the common trends for X(t). We illustrate the findings with a small analysis...... of the term structure of interest rates....

IPv6:n käyttöönotto PK-yrityksessä

OpenAIRE

Salonen, Arttu Petteri

2011-01-01

Tämän opinnäytetyön tarkoituksena on selvittää, kuinka IPv6-yhteydet otetaan käyt-töön PK-yrityksessä. Työssä selvitetään minkälaiset vaatimukset IPv6 asettaa lait-teistolle ja minkälaisia käytännön asioita yrityksen täytyy huomioida IPv6:n käyt-töönotossa. Lisäksi työssä on laboratoriosimulaation avulla havainnollistettu eri käyt-töjärjestelmien tukea IPv6:lle ja käyttöönottoon liittyviä reititin- ja osoitekonfiguraati-oita. Käyttöönoton lisäksi opinnäytetyössä esitellään IPv6-protokoll...

Classificador Neuro-nebuloso de Desempenho Escolar Usando o ANFIS com Implementação em R

Directory of Open Access Journals (Sweden)

Jeferson Costa da Silva

2015-11-01

Full Text Available Este artigo descreve alguns conceitos fundamentais para a implementação de um classificador neuro-nebuloso de desempenho escolar. Classificar informações de desempenho escolar é uma tarefa não-linear, pois envolve valores ("Atributos" como: nota, porcentagem de assiduidade (pontualidade e número de reprovações dos alunos em uma disciplina. O objetivo é qualificar o desempenho dos alunos em conceitos nebulosos ("Classes Nebulosas" como: ruim, bom ou ótimo. Baseado em informações numéricas contidas em um Dataset com os valores dos atributos é desenvolvido um classificador nebuloso baseado no modelo de ANFIS de aprendizagem e classificação neuro-nebulosa e implementado na linguagem de programação estatística R.

Kaisafestin digitaalisen markkinoinnin suunnitelma

OpenAIRE

Vepsä, Johanna

2010-01-01

Opinnäytetyöni on Kaisafestin digitaalisen markkinoinnin suunnitelma. Suunnitelman tavoitteena oli edistää tapahtuman kokonaisvaltaista onnistumista tehostetuilla ja tarkennetuilla markkinointitoimenpiteillä. Ensisijaisena tarkoituksenani oli sekä löytää uusia ja toimivia markkinointikäytäntöjä ja –malleja että kehittää ja vahvistaa jo käytössä olevia toimintoja. Toisena tavoitteenani oli tuottaa siirrettävissä oleva malli, jota voidaan käyttää varioiden muiden tapahtumien digitaalisen markki...

Potilasohjauksen osaamisen johtaminen terveydenhuollossa : hoitotyön johtajien näkemyksiä

OpenAIRE

Lehtoranta, Marja

2013-01-01

Tutkimuksen tarkoituksena oli selvittää potilasohjauksen osaamisen johtamista käytännössä. Tutkimuksessa kuvattiin osaamisen johtamisesta erityisesti käytössä olevia potilasohjauksen rakenteita, käytäntöjä ja viestintää, potilasohjauksen osaamisen tunnistamista, kartoittamista ja mittaamista sekä osaamisen kehittämistä ja ylläpitämistä. Tutkimusaineisto kerättiin vuonna 2011 osana Keski-Suomen sairaanhoitopiirin Potilasohjaus vaikuttavaksi (PoiJu) –kehittämishanketta haastattelemalla 22 hoito...

Genetics Home Reference: 3-beta-hydroxysteroid dehydrogenase deficiency

Science.gov (United States)

... for This Page Lutfallah C, Wang W, Mason JI, Chang YT, Haider A, Rich B, Castro-Magana ... A, Copeland KC, Chang YT, Lutfallah C, Mason JI. Carriers for type II 3beta-hydroxysteroid dehydrogenase (HSD3B2) ...

Molecular evidence for species-level distinctions in clouded leopards.

Science.gov (United States)

Buckley-Beason, Valerie A; Johnson, Warren E; Nash, Willliam G; Stanyon, Roscoe; Menninger, Joan C; Driscoll, Carlos A; Howard, JoGayle; Bush, Mitch; Page, John E; Roelke, Melody E; Stone, Gary; Martelli, Paolo P; Wen, Ci; Ling, Lin; Duraisingam, Ratna K; Lam, Phan V; O'Brien, Stephen J

2006-12-05

Among the 37 living species of Felidae, the clouded leopard (Neofelis nebulosa) is generally classified as a monotypic genus basal to the Panthera lineage of great cats. This secretive, mid-sized (16-23 kg) carnivore, now severely endangered, is traditionally subdivided into four southeast Asian subspecies (Figure 1A). We used molecular genetic methods to re-evaluate subspecies partitions and to quantify patterns of population genetic variation among 109 clouded leopards of known geographic origin (Figure 1A, Tables S1 ans S2 in the Supplemental Data available online). We found strong phylogeographic monophyly and large genetic distances between N. n. nebulosa (mainland) and N. n. diardi (Borneo; n = 3 individuals) with mtDNA (771 bp), nuclear DNA (3100 bp), and 51 microsatellite loci. Thirty-six fixed mitochondrial and nuclear nucleotide differences and 20 microsatellite loci with nonoverlapping allele-size ranges distinguished N. n. nebulosa from N. n. diardi. Along with fixed subspecies-specific chromosomal differences, this degree of differentiation is equivalent to, or greater than, comparable measures among five recognized Panthera species (lion, tiger, leopard, jaguar, and snow leopard). These distinctions increase the urgency of clouded leopard conservation efforts, and if affirmed by morphological analysis and wider sampling of N. n. diardi in Borneo and Sumatra, would support reclassification of N. n. diardi as a new species (Neofelis diardi).

Projektioppaan suunnittelu ja toteutus : case: projektiopas Turun ammattikorkeakoulun opiskelijoille

OpenAIRE

Toivonen, Minna

2010-01-01

Tämän opinnäytetyön tavoitteena on tuottaa opiskelijoille projektiopas, johon voi turvautua käytännön työn rinnalla. Opas on kirjoitettu omien kokemusten perusteella opiskelijalta opiskelijalle. Työn on hyvin käytännönläheinen, vain yksittäisiä sanoja ja termejä teoreettisesti selitellen. Toimeksiantajana oli Osuuskunta Zemi Finlandin ohjaava opettaja Jaana Kallio-Gerlander, ensisijaisena tavoitteena oli saada opas auttamaan opiskelijoiden projektityöskentelyä. Prosessi oli hyvin käytännön...

UniProt search blastx result: AK287970 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 3.00E-20 ...

UniProt search blastx result: AK288287 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 3.00E-18 ...

UniProt search blastx result: AK289170 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 1.00E-18 ...

UniProt search blastx result: AK287484 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 3.00E-16 ...

UniProt search blastx result: AK288291 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 6.00E-14 ...

UniProt search blastx result: AK288206 [KOME

Lifescience Database Archive (English)

Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Neofelis nebulosa (Clouded leopard) 4.00E-21 ...

Delay or anticipatory synchronization in one-way coupled systems ...

Indian Academy of Sciences (India)

1Department of Physics, Indian Institute of Science Education and Research, Pune 411 ... Synchronization; variable time delay; time delay systems; secure communication. .... scheme can be defined as y(t − τ2) = x(t − τ1) or y(t) = x(t − τ1 + τ2).

On norm equivalence between the displacement and velocity vectors for free linear dynamical systems

Directory of Open Access Journals (Sweden)

Ludwig Kohaupt

2015-12-01

Full Text Available As the main new result, under certain hypotheses, for free vibration problems, the norm equivalence of the displacement vector $ y(t $ and the velocity vector $ \\dot{y}(t $ is proven. The pertinent inequalities are applied to derive some two-sided bounds on $ y(t $ and $ \\dot{y}(t $ that are known so far only for the state vector $ x(t=[y^T(t, \\dot{y}^T(t]^T $. Sufficient algebraic conditions are given such that norm equivalence between $ y(t $ and $ \\dot{y}(t $ holds, respectively, does not hold, as the case may be. Numerical examples illustrate the results for vibration problems of n degrees of freedom with $ n \\in \\{ 1, 2, 3, 4, 5 \\} $ by computing the mentioned algebraic conditions and by plotting the graphs of $ y(t $ and $ \\dot{y}(t $. Some notations and definitions of References Kohaupt (2008b, 2011 are necessary and are therefore recapitulated. The paper is of interest to Mathematicians and Engineers.

Two distinct affinity binding sites for IL-1 on human cell lines

International Nuclear Information System (INIS)

Bensimon, C.; Wakasugi, N.; Tagaya, Y.; Takakura, K.; Yodoi, J.; Tursz, T.; Wakasugi, H.

1989-01-01

We used two human cell lines, NK-like YT-C3 and an EBV-containing B cell line, 3B6, as models to study the receptor(s) for IL-1. Two distinct types of saturable binding sites were found on both cell lines at 37 degrees C. Between 1 pM and 100 pM of 125I-IL-1-alpha concentration, saturable binding sites were detected on the YT-C3 cells with a K of 4 x 10(-11) M. The K found for the IL-1-alpha binding sites on 3B6 cells was 7.5 x 10(-11) M. An additional binding curve was detected above 100 pM on YT-C3 cells with a K of 7 x 10(-9) M and on 3B6 cells with a K of 5 x 10(-9) M. Scatchard plot analysis revealed 600 sites/cell with high affinity binding and 7000 sites/cell with low affinity for YT-C3 cells and 300 sites/cell with high affinity binding and 6000 sites/cell with low affinity for 3B6 cells. At 37 degrees C, the internalization of 125I-labeled IL-1 occurred via both high and low affinity IL-1R on both YT-C3 and 3B6 cells, whereas the rates of internalization for high affinity binding sites on YT-C3 cells were predominant in comparison to that of low affinity binding sites. In chemical cross-linking studies of 125 I-IL-1-alpha to 3B6 and YT-C3 cells, two protein bands were immunoprecipitated with Mr around 85 to 90 kDa leading to an estimation of the Mr of the IL-1R around 68 to 72 kDa. In similar experiments, the Mr found for the IL-1R expressed on the murine T cell line EL4 was slightly higher (around 80 kDa). Whether these distinct affinity binding sites are shared by a single molecule or by various chains remains to be elucidated

Vesicle-associated membrane protein 7 (VAMP-7) is essential for target cell killing in a natural killer cell line

International Nuclear Information System (INIS)

Marcet-Palacios, Marcelo; Odemuyiwa, Solomon O.; Coughlin, Jason J.; Garofoli, Daniella; Ewen, Catherine; Davidson, Courtney E.; Ghaffari, Mazyar; Kane, Kevin P.; Lacy, Paige; Logan, Michael R.; Befus, A. Dean; Bleackley, R. Chris; Moqbel, Redwan

2008-01-01

Natural killer cells recognize and induce apoptosis in foreign, transformed or virus-infected cells through the release of perforin and granzymes from secretory lysosomes. Clinically, NK-cell mediated killing is a major limitation to successful allo- and xenotransplantation. The molecular mechanisms that regulate the fusion of granzyme B-containing secretory lysosomes to the plasma membrane in activated NK cells, prior to target cell killing, are not fully understood. Using the NK cell line YT-Indy as a model, we have investigated the expression of SNAP REceptors (SNAREs), both target (t-) and vesicular (v-) SNAREs, and their function in granzyme B-mediated target cell killing. Our data showed that YT-Indy cells express VAMP-7 and SNAP-23, but not VAMP-2. VAMP-7 was associated with granzyme B-containing lysosomal granules. Using VAMP-7 small interfering RNA (siRNA), we successfully knocked down the expression of VAMP-7 protein in YT-Indy to less than 10% of untreated cells in 24 h. VAMP7-deficient YT-Indy cells activated via co-culture with Jurkat cells released <1 ng/mL of granzyme B, compared to 1.5-2.5 μg/mL from controls. Using Jurkat cells as targets, we showed a 7-fold reduction in NK cell-mediated killing by VAMP-7 deficient YT-Indy cells. Our results show that VAMP-7 is a crucial component of granzyme B release and target cell killing in the NK cell line YT-Indy. Thus, targeting VAMP-7 expression specifically with siRNA, following transplantation, may be a viable strategy for preventing NK cell-mediated transplant rejection, in vivo

Social CRM -kehitysprojekti

OpenAIRE

Pohjoismäki, Lauri

2017-01-01

Työn tavoitteena oli löytää ratkaisu digitaaliseen markkinointiin erikoistuneen yrityksen ongelmaan ajankäytöstä sosiaalisen median hallinnassa. Yrityksen nykyisellä asiakasmäärällä ei ole enää kannattavaa ajankäytännöllisesti hallita jokaista asiakasyrityksen sosiaalisen median tiliä erikseen, vaan niille on löydettävä keskitetty hallintaympäristö. Työssäni käsiteltiin erilaisia Social CRM -sovelluksia sekä pohdittiin niiden käyttöarvoa ja soveltuvuutta yrityksen käyttöön. Työ myös sivua...

Vulnerability of birds to climate change in California's Sierra Nevada

Directory of Open Access Journals (Sweden)

Rodney B. Siegel

2014-06-01

Full Text Available In a rapidly changing climate, effective bird conservation requires not only reliable information about the current vulnerability of species of conservation concern, but also credible projections of their future vulnerability. Such projections may enable managers to preempt or reduce emerging climate-related threats through appropriate habitat management. We used NatureServe's Climate Change Vulnerability Index (CCVI to predict vulnerability to climate change of 168 bird species that breed in the Sierra Nevada mountains of California, USA. The CCVI assesses species-specific exposure and sensitivity to climate change within a defined geographic area, through the integration of (a species' range maps, (b information about species' natural history traits and ecological relationships, (c historic and current climate data, and (d spatially explicit climate change projections. We conducted the assessment under two different downscaled climate models with divergent projections about future precipitation through the middle of the 21st century. Assessments differed relatively little under the two climate models. Of five CCVI vulnerability ranking categories, only one species, White-tailed Ptarmigan (Lagopus leucura, received the most vulnerable rank, Extremely Vulnerable. No species received the second-highest vulnerability ranking, Highly Vulnerable. Sixteen species scored as Moderately Vulnerable using one or both climate models: Common Merganser (Mergus merganser, Osprey (Pandion haliaetus, Bald Eagle (Haliaeetus leucocephalus, Northern Goshawk (Accipiter gentilis, Peregrine Falcon (Falco peregrinus, Prairie Falcon (Falco mexicanus, Spotted Sandpiper (Actitis macularius, Great Gray Owl (Strix nebulosa, Black Swift (Cypseloides niger, Clark's Nutcracker (Nucifraga columbiana, American Dipper (Cinclus mexicanus, Swainson's Thrush (Catharus ustulatus, American Pipit (Anthus rubescens, Gray-crowned Rosy-Finch (Leucosticte tephrocotis, Pine Grosbeak

High-sensitivity C-reactive protein does not improve the differential diagnosis of HNF1A-MODY and familial young-onset type 2 diabetes: A grey zone analysis.

Science.gov (United States)

Bellanné-Chantelot, C; Coste, J; Ciangura, C; Fonfrède, M; Saint-Martin, C; Bouché, C; Sonnet, E; Valéro, R; Lévy, D-J; Dubois-Laforgue, D; Timsit, J

2016-02-01

Low plasma levels of high-sensitivity C-reactive protein (hs-CRP) have been suggested to differentiate hepatocyte nuclear factor 1 alpha-maturity-onset diabetes of the young (HNF1A-MODY) from type 2 diabetes (T2D). Yet, differential diagnosis of HNF1A-MODY and familial young-onset type 2 diabetes (F-YT2D) remains a difficult challenge. Thus, this study assessed the added value of hs-CRP to distinguish between the two conditions. This prospective multicentre study included 143 HNF1A-MODY patients, 310 patients with a clinical history suggestive of HNF1A-MODY, but not confirmed genetically (F-YT2D), and 215 patients with T2D. The ability of models, including clinical characteristics and hs-CRP to predict HNF1A-MODY was analyzed, using the area of the receiver operating characteristic (AUROC) curve, and a grey zone approach was used to evaluate these models in clinical practice. Median hs-CRP values were lower in HNF1A-MODY (0.25mg/L) than in F-YT2D (1.14mg/L) and T2D (1.70mg/L) patients. Clinical parameters were sufficient to differentiate HNF1A-MODY from classical T2D (AUROC: 0.99). AUROC analyses to distinguish HNF1A-MODY from F-YT2D were 0.82 for clinical features and 0.87 after including hs-CRP. For the grey zone analysis, the lower boundary was set to missMODY with F-YT2D, 65% of patients were classified in between these categories - in the zone of diagnostic uncertainty - even after adding hs-CRP to clinical parameters. hs-CRP does not improve the differential diagnosis of HNF1A-MODY and F-YT2D. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

Social media and scientific research are complementary-YouTube and shrikes as a case study.

Science.gov (United States)

Dylewski, Łukasz; Mikula, Peter; Tryjanowski, Piotr; Morelli, Federico; Yosef, Reuven

2017-06-01

Fascination with animals and their behaviour is one the most prominent patterns persisting in all human cultures. During the last decades, however, technological development and public access to the Internet have increased the speed and the extent of information sharing at an unprecedented rate, in some cases even challenging the traditional methods used in science. In order to understand the extent of this influence, we focused on the behaviour of shrikes. Shrikes are an enigmatic group of songbirds with a unique behaviour of impaling prey. We employed an extensive Internet search on YouTube (YT), a very popular and increasingly important source of information worldwide, for videos recording shrikes. Our analyses revealed that the number of shrike videos on YT is strongly positively correlated with classical knowledge on shrikes from books and scientific articles. Our results also suggest that in some cases YT may provide an alternative source of information on shrike ecology and behaviour. YT videos may thus provide new insights into the study of certain species or subjects and help identify gaps in ecological studies, especially in poorly studied species.

Study of the $H \\rightarrow b\\bar{b}$ in association with a single top quark

CERN Document Server

AUTHOR|(CDS)2266532

2017-01-01

The production of the Higgs boson in association with a single top quark. $tH$ is a very important process for testing the Standard Model theory. There are three production channels: associated production with $W$, t-channel and s-channel. In this study only $tHq$ production with $H\\rightarrow b\\bar{b}$ decay and top leptonic decay has been generated and analyzed. The $tH$ production is important for probing the sign of the Higgs-top Yukawa coupling, $y_{t}$. Namely, there is an interference between diagrams which depends on the relative sign of $y_{t}$. LO Madgraph is used as a tool for generating events, calculating the cross-sections and Feynmann diagrams. The cross-section is parameterized as a continuous function of $y_{t}$. The kinematics of the process appears to be dependent on the $y_{t}$ used. In addition, the dominant background from $t\\bar{t}$ production with heavy flavor jets has been generated and potential discriminating variables to separate $tH$ from this background have been analyzed and dis...

Social media and scientific research are complementary—YouTube and shrikes as a case study

Science.gov (United States)

Dylewski, Łukasz; Mikula, Peter; Tryjanowski, Piotr; Morelli, Federico; Yosef, Reuven

2017-06-01

Fascination with animals and their behaviour is one the most prominent patterns persisting in all human cultures. During the last decades, however, technological development and public access to the Internet have increased the speed and the extent of information sharing at an unprecedented rate, in some cases even challenging the traditional methods used in science. In order to understand the extent of this influence, we focused on the behaviour of shrikes. Shrikes are an enigmatic group of songbirds with a unique behaviour of impaling prey. We employed an extensive Internet search on YouTube (YT), a very popular and increasingly important source of information worldwide, for videos recording shrikes. Our analyses revealed that the number of shrike videos on YT is strongly positively correlated with classical knowledge on shrikes from books and scientific articles. Our results also suggest that in some cases YT may provide an alternative source of information on shrike ecology and behaviour. YT videos may thus provide new insights into the study of certain species or subjects and help identify gaps in ecological studies, especially in poorly studied species.

Chromosome Banding in Amphibia. XXXVI. Multimorphic Sex Chromosomes and an Enigmatic Sex Determination in Eleutherodactylus johnstonei (Anura, Eleutherodactylidae).

Science.gov (United States)

Schmid, Michael; Steinlein, Claus

2018-01-01

A detailed cytogenetic study on the leaf litter frog Eleutherodactylus johnstonei from 14 different Caribbean islands and the mainlands of Venezuela and Guyana revealed the existence of multimorphic XY♂/XX♀ sex chromosomes 14. Their male sex determination and development depends either on the presence of 2 telocentric chromosomes 14 (XtYt), or on 1 submetacentric chromosome 14 (Xsm) plus 1 telocentric chromosome 14 (Yt), or on the presence of 2 submetacentric chromosomes 14 (XsmYsm). The female sex determination and development requires either the presence of 2 telocentric chromosomes 14 (XtXt) or 2 submetacentric chromosomes 14 (XsmXsm). In all individuals analyzed, the sex chromosomes 14 carry a prominent nucleolus organizer region in their long arms. An explanation is given for the origin of the (XtYt)♂, (XsmYt)♂, (XsmYsm)♂, (XtXt)♀, and (XsmXsm)♀ in the different populations of E. johnstonei. Furthermore, the present study gives detailed data on the chromosome banding patterns, in situ hybridization experiments, and the genome size of E. johnstonei. © 2018 S. Karger AG, Basel.

ANÁLISE E MAPEAMENTO DO USO E OCUPAÇÃO DO SOLO DA BACIA DO ALTO DO DESCOBERTO, DF/GO, POR MEIO DE CLASSIFICAÇÃO AUTOMÁTICA BASEADA EM REGRAS E LÓGICA NEBULOSA

Directory of Open Access Journals (Sweden)

Juliana Faria Nunes

2015-02-01

Full Text Available A Bacia do Alto do Descoberto é importante fonte de água para o Distrito Federal. Essa bacia tem apresentado ao longo dos anos expansão agrícola e urbana em detrimento das áreas de vegetação natural. A ocupação inadequada, assim como a falta de planejamento do uso e ocupação do solo, pode levar a alterações do escoamento superficial e, consequentemente, do ciclo hidrológico, a feições erosivas, à contaminação dos mananciais superficiais e subterrâneos e ao desequilíbrio do ecossistema da região. Portanto, o monitoramento e a análise do uso e ocupação do solo são imprescindíveis na prevenção desses impactos e na manutenção dos mananciais. Dessa forma, este estudo tem como objetivo o mapeamento e a análise comparativa do uso e ocupação do solo da Bacia do Alto do Descoberto entre os anos 1994 e 2011. As classificações de uso e ocupação do solo foram elaboradas utilizando um classificador orientado ao objeto baseado em regras e lógica nebulosa, permitindo uma análise dos avanços do uso do solo e a perda da cobertura vegetal da bacia. O sistema de classificação utilizado foi considerado bem-sucedido, com índice de exatidão temática (Kappa de 0,64. Apesar de ainda haver algumas confusões temáticas no processo de classificação, as análises comparativas entre as classes temáticas dos mapas dos referidos anos evidenciaram a forte expansão agrícola da região em aproximadamente 11% da área da bacia, bem como uma perda de vegetação natural.

Research Article

African Journals Online (AJOL)

2017-09-01

Sep 1, 2017 ... (y=at+b) cloud point (t, Yt) which minimizes the distance is determined Σ (Yt - (at + b)). 2 . This ... Ct0 and Ctf initial and final values calculated using the regression at time t0 (January 2003) and tf. (December 2012) ... 2003 to 2012 gen in water reservoir has recorded a negative trend of 2%, this is con.

Stability analysis of a class of fractional delay differential equations

Indian Academy of Sciences (India)

Abstract. In this paper we analyse stability of nonlinear fractional order delay differential equa- tions of the form Dα y(t) = af (y(t − τ )) − by(t), where Dα is a Caputo fractional derivative of order 0 < α ≤ 1. We describe stability regions using critical curves. To explain the proposed theory, we discuss fractional order logistic ...

Hyers-Ulam stability of linear second-order differential equations in complex Banach spaces

Directory of Open Access Journals (Sweden)

Yongjin Li

2013-08-01

Full Text Available We prove the Hyers-Ulam stability of linear second-order differential equations in complex Banach spaces. That is, if y is an approximate solution of the differential equation $y''+ alpha y'(t +eta y = 0$ or $y''+ alpha y'(t +eta y = f(t$, then there exists an exact solution of the differential equation near to y.

Karvian seurakunnan henkilöstötilinpäätös

OpenAIRE

Vaskela, Soila

2008-01-01

Tässä opinnäytetyössä tutkittiin yleisesti sekä käytännössä henkilöstötilinpäätöksen tarkoitusta ja sisältöä. Kohdeorganisaation eli Karvian seurakunnan avulla rakennettiin käytännön esimerkki seurakunnan ensimmäisestä henkilöstötilinpäätöksestä. Tutkimuksen tavoitteena oli löytää oikeat ratkaisut henkilöstötilinpäätöksen rakentamiseen organisaatiossa, jossa kyseinen asiakirja ei vielä ole tunnettu. Lisäksi tavoitteena oli laatia seurakunnalle käyttökelpoinen henkilöstötilinpäätösmalli, jota ...

A stonefly species extinct in Europe (Taeniopteryx araneoides Klapalek, 1902, Taeniopterygidae, Plecoptera) is thriving in the Irtysh River in West Siberia and North Kazakhstan.

Science.gov (United States)

Kosterin, Oleg E; Akimbekova, Nazymgul; Dubatolov, Vladimir V; Sivec, Ignac

2017-03-27

Taeniopteryx araneoides Klápalek, 1902, a stonefly species with brachypterous males, known historically from the Danube, Elbe, and Dniester rivers, but considered to be extinct at least in Europe for more than a century. This species has also been doubtfully reported from Krasnoyarsk, Central Siberia. However, we report this species to be still thriving in the Irtysh River at the cities of Omsk (West Siberia, Russia) and Pavlodar (North Kazakhstan). The occurrence of this species reported least fifty years ago from the Yenisey River at Krasnoyarsk, Russia is considered possible. Unlike the widespread Palaearctic T. nebulosa (Linnaeus, 1758) that occurs in a broad range of stream types, T. araneoides is a potomon species, apparently confined to large rivers. In this habitat, it appears vulnerable to anthropogenic impacts and may be unable to compete with T. nebulosa. The construction of dams and reservoirs has apparently extirpated T. araneoides from most of its former geographical range.

Flexure of Thick Plates Resting on Elastic Foundation Using Two-Variable Refined Plate Theory

Directory of Open Access Journals (Sweden)

Rouzegar Jafar

2015-06-01

Full Text Available Wpublikacji wykorzystano udoskonalona teorie płyty z dwiema zmiennymi do analizy grubych płyt spoczywajacych na sprezystym podłozu. Teoria ta, która zawiera tylko dwa nieznane parametry, pozwala przewidziec paraboliczna zmiennosc naprezen scinajacych. W teorii jest spełniony warunek zerowej trakcji na powierzchni płyty bez uzycia współczynnika korekcyjnego dla scinania. Stosujac zasade minimum energii potencjalnej wyprowadzono równania rzadzace dla płyt prostokatnych o prostym podparciu spoczywajacych na sprezystym podłozu Winklera. Do rozwiazania otrzymanego układu równan sprzezonych zaadoptowano metode Naviera. Obecna teoria pozwoliła rozwiazac szereg przykładowych problemów płyt przy róznych warunkach obciazenia. Porównanie otrzymanych rezultatów z uzyskanymi w innych znanych teoriach wykazuje doskonala efektywnosc stosowanej teorii w modelowaniu grubych płyt spoczywajacych na podłozu sprezystym. Przestudiowano takze wpływ modułu sprezystosci podłoza, grubosci płyty i typu obciazenia. Wyniki pokazuja, ze ugiecia płyty maleja przy wzroscie modułu sprezystosci podłoza i grubosci płyty

Phenotypic Characterization of a Novel Virulence-Factor Deletion Strain of Burkholderia mallei that Provides Partial Protection against Inhalational Glanders in Mice

Science.gov (United States)

2016-02-26

Fort Detrick, MD, USA, 2 Telemedicine and Advanced Technology Research Center, Biotechnology HPC Software Applications Institute, United States Army...allelic exchange mutants, we grew the Bm cointegrate strain in yeast- extract tryptone (YT) broth medium and then serially diluted it onto YT agar...indicated. Cells were fixed with 4% paraformaldehyde and then blocked in PBS containing 0.25% saponin , 0.2% Bovine Serum Albumin (BSA) fraction V

Annealed asymptotics for the parabolic Anderson model with a moving catalyst

NARCIS (Netherlands)

Gärtner, J.; Heydenreich, M.O.

2006-01-01

This paper deals with the solution u to the parabolic Anderson equation ¿u/¿t=¿¿u+¿u on the lattice . We consider the case where the potential ¿ is time-dependent and has the form ¿(t,x)=d0(x-Yt) with Yt being a simple random walk with jump rate 2d. The solution u may be interpreted as the

A randomised controlled trial of adjunctive yoga and adjunctive physical exercise training for cognitive dysfunction in schizophrenia.

Science.gov (United States)

Bhatia, Triptish; Mazumdar, Sati; Wood, Joel; He, Fanyin; Gur, Raquel E; Gur, Ruben C; Nimgaonkar, Vishwajit L; Deshpande, Smita N

2017-04-01

Yoga and physical exercise have been used as adjunctive intervention for cognitive dysfunction in schizophrenia (SZ), but controlled comparisons are lacking. Aims A single-blind randomised controlled trial was designed to evaluate whether yoga training or physical exercise training enhance cognitive functions in SZ, based on a prior pilot study. Consenting, clinically stable, adult outpatients with SZ (n=286) completed baseline assessments and were randomised to treatment as usual (TAU), supervised yoga training with TAU (YT) or supervised physical exercise training with TAU (PE). Based on the pilot study, the primary outcome measure was speed index for the cognitive domain of 'attention' in the Penn computerised neurocognitive battery. Using mixed models and contrasts, cognitive functions at baseline, 21 days (end of training), 3 and 6 months post-training were evaluated with intention-to-treat paradigm. Speed index of attention domain in the YT group showed greater improvement than PE at 6 months follow-up (pattention domain showed greater improvement than TAU alone at 6-month follow-up (pattention and additional cognitive domains well past the training period, supporting our prior reported beneficial effect of YT on speed index of attention domain. As adjuncts, YT or PE can benefit individuals with SZ.

Preserved glucagon-like peptide-1 responses to oral glucose, but reduced incretin effect, insulin secretion and sensitivity in young Asians with type 2 diabetes mellitus

DEFF Research Database (Denmark)

Yeow, Toh Peng; Pacini, Giovanni; Tura, Andrea

2017-01-01

are scarce. We examined the insulin resistance, β-cell function (BC), glucagon-like peptide (GLP)-1 hormone and incretin effect in Asian YT2DM. RESEARCH DESIGN AND METHODS: This case-control study recruited 25 Asian YT2DM and 15 healthy controls, matched for gender, ethnicity and body mass index. Serum......OBJECTIVE: Youth onset type 2 diabetes mellitus (YT2DM) is a globally rising phenomenon with substantial Asians representation. The understanding of its pathophysiology is derived largely from studies in the obese African-American and Caucasian populations, while studies on incretin effect...... glucose, insulin, C peptide and GLP-1 were sampled during 2-hour oral glucose tolerance tests (OGTTs) and 1-hour intravenous glucose tolerance tests (IVGTTs). Insulin sensitivity was derived from the Quantitative Insulin Sensitivity Check Index (QUICKI), Oral Glucose Insulin Sensitivity Index (OGIS...

Measuring the Non-Line-of-Sight Ultra-High-Frequency Channel in Mountainous Terrain: A Spread-Spectrum, Portable Channel Sounder

Science.gov (United States)

2018-03-01

5), correlating each side of equation (3) with a transmit- ted signal, x [t], yields [] = ℎ[] ∗ []. (6) Here...i.e., input), x [t], and the complex-valued received signal (i.e., output), y[t], via the convolution function (Papazian and Lemmon 2011), which is...Rxy is the cross-correlation function of x [t] and y[t], and Rxx is the autocorrelation function of x [t]. The additive noise component is dropped

Effects of Resistance Training on Matrix Metalloproteinase Activity in Skeletal Muscles and Blood Circulation During Aging

Directory of Open Access Journals (Sweden)

Ivo V. de Sousa Neto

2018-03-01

Full Text Available Aging is a complex, multifactorial process characterized by the accumulation of deleterious effects, including biochemical adaptations of the extracellular matrix (ECM. The purpose of this study was to investigate the effects of 12 weeks of resistance training (RT on metalloproteinase 2 (MMP-2 activity in skeletal muscles and, MMP-2 and MMP-9 activity in the blood circulation of young and old rats. Twenty-eight Wistar rats were randomly divided into four groups (n = 7 per group: young sedentary (YS; young trained (YT, old sedentary (OS, and old trained (OT. The stair climbing RT consisted of one training session every 2 other day, with 8–12 dynamic movements per climb. The animals were euthanized 48 h after the end of the experimental period. MMP-2 and MMP-9 activity was measured by zymography. There was higher active MMP-2 activity in the lateral gastrocnemius and flexor digitorum profundus muscles in the OT group when compared to the OS, YS, and YT groups (p ≤ 0.001. Moreover, there was higher active MMP-2 activity in the medial gastrocnemius muscle in the OT group when compared to the YS and YT groups (p ≤ 0.001. The YS group presented lower active MMP-2 activity in the soleus muscle than the YT, OS, OT groups (p ≤ 0.001. With respect to active MMP-2/9 activity in the bloodstream, the OT group displayed significantly reduced activity (p ≤ 0.001 when compared to YS and YT groups. In conclusion, RT up-regulates MMP-2 activity in aging muscles, while down-regulating MMP-2 and MMP-9 in the blood circulation, suggesting that it may be a useful tool for the maintenance of ECM remodeling.

Comparison of PFASs contamination in the freshwater and terrestrial environments by analysis of eggs from osprey (Pandion haliaetus), tawny owl (Strix aluco), and common kestrel (Falco tinnunculus)

International Nuclear Information System (INIS)

Eriksson, Ulrika; Roos, Anna; Lind, Ylva; Hope, Kjell; Ekblad, Alf; Kärrman, Anna

2016-01-01

The level of PFAS (per- and polyfluorinated alkyl substances) contamination in freshwater and terrestrial Swedish environments in 2013/2014 was assessed by analyzing a range of perfluorinated alkyl acids, fluorotelomer acids, sulfonamides, sulfonamidoethanols and polyfluoralkyl phosphate diesters (diPAPs) in predator bird eggs. Stable isotopes ( 13 C and 15 N) were analyzed to elucidate the dietary source. The tawny owl (Strix aluco, n=10) and common kestrel (Falco tinnunculus, n=40), two terrestrial species, and the osprey (Pandion haliaetus, n=30), a freshwater specie were included. In addition, a temporal trend (1997–2001, 2008–2009, 2013) in osprey was studied as well. The PFAS profile was dominated by perfluorooctane sulfonic acid (PFOS) in eggs from osprey and tawny owl, while for common kestrel perfluorinated carboxylic acids (∑PFCA) exceeded the level of PFOS. PFOS concentration in osprey eggs remained at the same level between 1997 and 2001 and 2013. For the long-chained PFCAs, there were a significant increase in concentrations in osprey eggs between 1997 and 2001 and 2008–2009. The levels of PFOS and PFCAs were about 10 and five times higher, respectively, in osprey compared to tawny owl and common kestrel. Evidence of direct exposure from PFCA precursor compounds to birds in both freshwater and terrestrial environment was observed. Low levels of diPAPs were detected in a few samples of osprey (<0.02–2.4 ng/g) and common kestrel (<0.02–0.16 ng/g) eggs, and 6:2 FTSA was detected in a majority of the osprey eggs (<6.3–52 ng/g). One saturated telomer acid (7:3 FTCA), which is a transformation marker from precursor exposure, was detected in all species (<0.24–2.7 ng/g). The 15 N data showed higher levels in osprey eggs compared to tawny owl and common kestrel, indicating that they feed on a 2–3 times higher trophic level. We conclude that ospreys are continuously exposed to PFAS at levels where adverse toxic effects have been observed in

Comparison of PFASs contamination in the freshwater and terrestrial environments by analysis of eggs from osprey (Pandion haliaetus), tawny owl (Strix aluco), and common kestrel (Falco tinnunculus)

Energy Technology Data Exchange (ETDEWEB)

Eriksson, Ulrika, E-mail: ulrika.eriksson@oru.se [Man-Technology-Environment (MTM) Research Centre, School of Science and Technology, Örebro University, SE-701 82 Örebro (Sweden); Roos, Anna; Lind, Ylva [Swedish Museum of Natural History, P.O. Box 50007, SE-104 05 Stockholm (Sweden); Hope, Kjell; Ekblad, Alf; Kärrman, Anna [Man-Technology-Environment (MTM) Research Centre, School of Science and Technology, Örebro University, SE-701 82 Örebro (Sweden)

2016-08-15

The level of PFAS (per- and polyfluorinated alkyl substances) contamination in freshwater and terrestrial Swedish environments in 2013/2014 was assessed by analyzing a range of perfluorinated alkyl acids, fluorotelomer acids, sulfonamides, sulfonamidoethanols and polyfluoralkyl phosphate diesters (diPAPs) in predator bird eggs. Stable isotopes ({sup 13}C and {sup 15}N) were analyzed to elucidate the dietary source. The tawny owl (Strix aluco, n=10) and common kestrel (Falco tinnunculus, n=40), two terrestrial species, and the osprey (Pandion haliaetus, n=30), a freshwater specie were included. In addition, a temporal trend (1997–2001, 2008–2009, 2013) in osprey was studied as well. The PFAS profile was dominated by perfluorooctane sulfonic acid (PFOS) in eggs from osprey and tawny owl, while for common kestrel perfluorinated carboxylic acids (∑PFCA) exceeded the level of PFOS. PFOS concentration in osprey eggs remained at the same level between 1997 and 2001 and 2013. For the long-chained PFCAs, there were a significant increase in concentrations in osprey eggs between 1997 and 2001 and 2008–2009. The levels of PFOS and PFCAs were about 10 and five times higher, respectively, in osprey compared to tawny owl and common kestrel. Evidence of direct exposure from PFCA precursor compounds to birds in both freshwater and terrestrial environment was observed. Low levels of diPAPs were detected in a few samples of osprey (<0.02–2.4 ng/g) and common kestrel (<0.02–0.16 ng/g) eggs, and 6:2 FTSA was detected in a majority of the osprey eggs (<6.3–52 ng/g). One saturated telomer acid (7:3 FTCA), which is a transformation marker from precursor exposure, was detected in all species (<0.24–2.7 ng/g). The {sup 15}N data showed higher levels in osprey eggs compared to tawny owl and common kestrel, indicating that they feed on a 2–3 times higher trophic level. We conclude that ospreys are continuously exposed to PFAS at levels where adverse toxic effects have been

Dicty_cDB: VSD225 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available yt*imskaqavgsnyrvslglpvgavmnsadnsgaknlyviavkgikgrlnrlpsagvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnp...nsadnsgaknlyviavkgikgrlnrlpsag vgdmvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgni lgpvakecsdlwpkva

Case VILA Clothes : Unelmasta toteutukseen

OpenAIRE

Vidgren, Petri; Virtanen, Suvi

2007-01-01

Työn tarkoituksena oli perehtyä franchising-toimintaan käytännön kokemuksen kautta. Näiden kokemusten kautta tutkittiin franchising-teoriaa suhteessa käytännön esimerkkiin. Työ on jatkossa hyödyksi toimeksiantajalle perustaessaan uusia franchising-liikkeitä. Työn toimeksiantajana toimi Stylehunter Oy Teoriaosassa tuotiin esille franchising-toiminnan eri muodot. Osiossa käsiteltiin myös franchisingterminologiaa, franchising-yrittäjyyden mahdollisuuksia ja riskejä, sopimuksia, koulutusjärjestel...

The Utility of Handheld Programmable Calculators in Aircraft Life Cycle Cost Estimation.

Science.gov (United States)

1982-09-01

YtX 95* 96 GTO 10 97.LBL 1 1 AFTERBURNER TURBOJET 98 "FMIL" 99 XEQ 02 100 STO 37 101 .96 102 YtX 103 64 68 104 * 105 " FMA ’-" 106 XEO 0l 107 RCL 37...3500 RU N AF 750=3,819 .126.892 RUN EN LR .9000 RU N FIIIL? 11,000.0000 RUN BPP ? 1.0000 R LIN FMAX? 19,000.0000 RUN PU 1000=1,29 4,040.200 RUN N

A estabilidade dos PAHS em função da energia da radiação interestelar nas faixas UV e raios-X

Science.gov (United States)

Pinotti, R.; Costa, R. K.; Boechat-Roberty, H. M.; Lago, A.; Souza, G. B.

2003-08-01

A nebulosa CRL 618, uma proto-nebulosa planetária cuja nuvem molecular espessa envolve uma estrela B0, contém uma grande quantidade de C2H2 e CH4. Estas moléculas são consideradas os tijolos da criação de grandes moléculas carbonadas como os Hidrocarbonetos Policíclicos Aromáticos (PAHs). Esta nebulosa, por estar exposta a intensos campos de UV e Raios-X, é uma região de fotodissociação molecular que propicia a formação de novas moléculas, confirmada pela presença de C4H2 e C6H6 (Benzeno), que é a unidade básica dos PAHs. Atribui-se a esta família de moléculas orgânicas duas propriedades fundamentais, a resistência para sobreviver ao campo de radiação UV interestelar e a geração das bandas de emissão não identificadas (UIR) observadas no infravermelho. No entanto, alguns autores questionam a resistência dos PAHs ao campo de radiação UV interestelar. Empregando a técnica de Espectrometria de Massas por Tempo de Vôo, no modo de coincidência fotoelétron-fotoíon, estudamos a ionização e fragmentação das seguintes moléculas: Benzeno, Benzeno deuterado, Naftaleno, Antraceno e Fenantreno. Utilizamos uma fonte de Hélio monocromática em 21,21 eV (584,5 Å) e a radiação Síncroton do Laboratório Nacional de Luz Síncroton (LNLS) em diferentes energias nas proximidades da borda do C 1s ( 290 eV). Comprovamos a estabilidade dos PAHs sob ação de UV (21,21 eV), onde eles apresentam um baixo nível de fotodissociação, produzindo fragmentos ionizados com rendimento total na ordem de 5 por cento em relação ao íon molecular pai. Entretanto, em altas energias, na faixa de Raios-X, a quebra destas moléculas torna-se mais intensa, com a produção de muitos fragmentos. Como uma das rotas de fragmentação do Naftaleno é [(C10H8) = > (C6H6+) + (C4H2) + (e-)], e como temos as evidências observacionais da existência do C4H2 e C6H6 na nebulosa CRL 618, sugerimos que este ambiente também possui o Naftaleno.

Tervetuloa röntgenosastolle Varkauteen : Röntgenhoitajaopiskelijoiden perehdytysopas

OpenAIRE

Koivunen, Sanna; Mäkelä, Laura

2013-01-01

Opinnäytetyönä tuotettiin röntgenhoitajaopiskelijoille perehdytysmateriaali Varkauden sairaalan röntgenosastolle. Työn tarkoituksena oli tehdä käytännön harjoitteluun tuleville röntgenhoitajaopiskelijoille perehdytysopas ja tutkimushuonekohtaiset perehdytyslomakkeet. Tavoitteena oli auttaa röntgenhoitajaopiskelijoita perehtymään työyksikköön ja kehittää käytännön harjoittelua. Perehdyttämismateriaalin ansiosta osastolla työskentelevä henkilökunta ja opiskelijat saavat yhteiset toimintata...

"Äiti, sä oot niin paras äiti" : - Ihmeelliset vuodet - ryhmän vaikutus vanhemmuustaitoihin

OpenAIRE

Pylkkönen, Taru

2011-01-01

”Äiti, sä oot niin paras äiti”: Ihmeelliset vuodet – ryhmän vaikutus vanhempien vanhem-muustaitoihin Vuosi 2011 Sivumäärä 51+ 12 Opinnäytetyön tarkoituksena oli selvittää miten Ihmeelliset vuodet koulussa – projektin yhteydessä toiminut vanhemmuusryhmä vaikutti siihen osallistuvien vanhempien vanhemmuustaitoihin. Ihmeelliset vuodet – ohjelman vanhemmuusryhmät ovat käytöshäiriöisten lasten vanhemmille suunnattuja perheinterventioita, joissa lasten käytökseen pyr...

Uusiomateriaalien käytön ohjeistuksen ja hankekäytäntöjen kehitystarpeet ja mahdollisuudet tierakentamisessa

OpenAIRE

Torniainen, S. (Sanna)

2018-01-01

Tiivistelmä Suomessa käytetään huomattava määrä neitseellistä luonnonkiviainesta tierakentamisessa vuosittain. Uusiomateriaalien soveltuvuutta ja käyttöä tierakentamisessa on tutkittu jo kymmenien vuosien ajan ja etenkin viimeisten vuosien aikana niiden käyttö on hiljalleen kasvanut. Tutkimuksista ja erilaisista kehitysohjelmista huolimatta uusiomateriaalien käyttö ei kuitenkaan ole lisääntynyt ja laajentunut toivotulla tav...

Dicty_cDB: VSD614 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available agvgd mvmatvkkgkpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgp vakecsdlwpkvatnagtiv*INTHKVKTXXKK--- ---V...kpelrkkvctglvvrqrkhwkrkdgvyiyfednagvmcnpkgevkgnilgp vakecsdlwpkvatnagtiv*INTHKVKTXXKK--- ---yt*imskaqavgsnyr

Suunnittelutiedon hallinta omaperusteisessa toimitilatuotannossa

OpenAIRE

Koljonen, Karoliina

2013-01-01

Tämän opinnäytetyön tavoitteena oli löytää keinoja suunnittelutiedon hallintaan omaperusteisissa toimitilakohteissa suunnittelu- ja toteutusvaiheen aikana. Työn tarkoituksena oli järjestelmällistää ja kehittää toimeksiantajan suunnittelunohjauskäytäntöjä. Työ on tehty perustajaurakoitsijan näkökulmasta ja opinnäytetyön aiheen on antanut YIT Rakennus Oy. Työssä tutustuttiin YIT:n tapaan rakentaa omaperusteisia toimistokohteita ja ohjata suunnitteluprosessia. Osana työtä tehtiin 15 haastatt...

Mainosideoista sähköisiin sisältöihin : sisältöstrategian merkitys mainostoimistojen digitaalisissa palveluissa

OpenAIRE

Pasanen, Riikka

2012-01-01

Sisältöstrategia on suunnittelukäytäntö, jonka tähtää liiketoiminnallisiin tavoitteisiin vaikuttavan verkkosisällön avulla. Tutkimuksessa tarkastellaan hyvän verkkosisällön kriteerejä ja pohditaan, voisiko mainostoimisto ottaa oppia sisältöstrategian käytännöistä ja tarjota sen avulla parempaa palvelua asiakkailleen. Tutkimusta varten on haastateltu neljää mainonnan strategisen suunnittelun ja asiakasjohdon ammattilaista, joiden näkemyksiä on peilattu tutkijan pitkään kokemukseen alalta sekä ...

Tietoa kosketuksen päässä : NFC-teknologia innovatiivisten käyttötapausten kautta

OpenAIRE

Toivanen, Sanna

2012-01-01

Opinnäytetyöni tutkii vähittäiskauppaa, NFC-teknologiaa, sekä innovointia prosessien kautta käytäntöön. Tavoitteena oli löytää uusia ideoita NFC-teknologian käyttöön, pää-asiassa vähittäiskauppakontekstissa. Työn tutkimuksellinen osuus koostuu tutkimus-haastatteluista, innovaatiotyöpajoista, sekä kirjallisuuskatsauksesta edellä mainittuihin aiheisiin liittyen. NFC tulee sanoista Near Field Communication ja suomeksi se on kääntynyt lähitunnis-tamiseksi tai lähitunnistusteknologiaksi. NFC-t...

Metabolic rate and evaporative water loss of Mexican Spotted and Great Horned Owls

Science.gov (United States)

Joseph L. Ganey; Russell P. Balda; Rudy M. King

1993-01-01

We measured rates of oxygen consumption and evaporative water loss (EWL) of Mexican Spotted (Strix occidentalis lucida) and Great Horned (Bubo virginianus) owls in Arizona. Basal metabolic rate averaged 0.84 ccO2. g-1. h-1...

Estimating inbreeding rates in Northern Spotted Owls: insights from pedigrees and spatio-demographic models

Science.gov (United States)

The federally-threatened Northern Spotted Owl (Strix occidentalis caurina) has a substantial influence on management of federal lands. Despite decades of investigation, important details about its status and habits remain unknown. In particular, determining the frequency of inbre...

Modeling interactions betweenspotted owl and barred owl populations in fire-prone forests

Science.gov (United States)

Background / Question / Methods Efforts to conserve northern spotted owls (Strix occidentalis caurina) in the eastern Cascades of Washington must merge the challenges of providing sufficient structurally complex forest habitat in a fire-prone landscape with the limitations impos...

Some factors effecting algal consumption in subarctic Ephemeroptera, Plecoptera, and Simuliidae

Energy Technology Data Exchange (ETDEWEB)

Moore, J.W.

1977-01-01

Some of the factors influencing algal consumption in the mayflies Leptophlebia nebulosa, Cinygmula tarda, Baetis foemina and B. cf. bicaudatus, the plecopterans Arcynopteryx signata, Nemoura cinctipes and N. oregonensis and in the dipterans Simulium arcticum, S. venustum and S. decorum were investigated between June 1975 and June 1976 in several streams in the Canadian subarctic. Algae represented up to 65% of the gut contents of L. nebulosa but only 0--8% in the other mayflies. They were important in the plecopterans (85--90%) but less so (2--13%) in the simuliids. Most of the interspecies variability in algal consumption could be explained in terms of food availability. This factor was in turn dependent on the density and attachment characteristics of the flora and the strength of their cell wall. Feeding intensity in most species was low between October and April, reaching it peak in July and August. From 51 to 83% of intraspecies feeding variability was due to changing temperature, followed in importance by water velocity in the dipterans and food availability in the mayflies. All species in this latter group ceased feeding in the final instar stages.

Reality-tv leikkaajan silmin

OpenAIRE

Hietaniemi, Tommi

2012-01-01

Opinnäytetyössäni tutkin 2000-luvulla television ohjelmatarjonnan vallannutta realitya, myös tosi-tv:ksi kutsuttua ohjelmagenreä leikkaajan näkökulmasta. Käytännön esimerkkeinä ja laajan aiheen rajaajana käytän leikkaamiani televisiosarjoja Iceblock, Linnan tähdet sekä Supermarjo ja tytöt. Miten leikkaajan työnkuva erottuu erityyppisissä projekteissa ja erikokoisissa työryhmissä? Tai sisällöllisesti, mitkä seikat leikkaajan on hyvä ottaa huomioon realitya rakentaessa? In my thesis I a...

Production of vanillin by metabolically engineered Escherichia coli.

Science.gov (United States)

Yoon, Sang-Hwal; Li, Cui; Kim, Ju-Eun; Lee, Sook-Hee; Yoon, Ji-Young; Choi, Myung-Suk; Seo, Weon-Taek; Yang, Jae-Kyung; Kim, Jae-Yeon; Kim, Seon-Won

2005-11-01

E. coli was metabolically engineered to produce vanillin by expression of the fcs and ech genes from Amycolatopsis sp. encoding feruloyl-CoA synthetase and enoyl-CoA hydratase/aldolase, respectively. Vanillin production was optimized by leaky expression of the genes, under the IPTG-inducible trc promoter, in complex 2YT medium. Supplementation with glucose, fructose, galactose, arabinose or glycerol severely decreased vanillin production. The highest vanillin production of 1.1 g l(-1) was obtained with cultivation for 48 h in 2YT medium with 0.2% (w/v) ferulate, without IPTG and no supplementation of carbon sources.

Pk-yrityksen aggressiivinen verosuunnittelu

OpenAIRE

Koivisto, Milla

2015-01-01

Opinnäytetyössä tarkastellaan pienten ja keskisuurten yritysten ja näiden yrittäjäomistajien verotusta ja sen suunnittelua. Työn tarkoituksena ja tärkeimpänä tavoitteena pidetään aggressiivisen verosuunnittelun keinojen pohdintaa sekä tulkitsemista erityisesti osakeyhtiö-muotoisten yritysten kannalta. Ensin selvitetään yleisesti verotuskäytäntöjä sekä eri yritysmuotojen verotuksellista eroavaisuutta. Tämän jälkeen käsitellään varsinaisen verosuunnittelun teoreettista pohjaa sekä käytäntö...

Liikkuva kuva ja ääni digitaalisessa sarjakuvassa : säilyttäen sarjakuvamainen pysähtynyt hetki

OpenAIRE

Veijalainen, Roni

2013-01-01

Tarkastelen digitaalisuuden tuomia mahdollisuuksia elävöittää sarjakuvaa, sekä käyn läpi sarjakuvan ominaispiirteitä. Keskityn nimenomaan pohtimaan vaihtoehtoehtoja elävöittää digitaalista sarjakuvaa liikkuvilla elementeillä ja äänellä. Haluan löytää vaihtoehtoja käyttää näitä tehosteita siten, että tunne pysähtyneestä hetkestä säilyisi. Tarkastelen myös internetin avulla löytämiäni erilaisia digitaalisia sarjakuvia, joissa on käytetty digitaalisuuden mahdollistamia tehosteita. Tulen miet...

VAS-diagnostiikkatestereiden käyttö ajoneuvojen huolto- ja korjaustöissä

OpenAIRE

Pilvi, Juha

2014-01-01

Tämän insinöörityön aiheena on Volkswagen-konsernissa käytössä olevat VAS- diagnostiikkatesterit. Työssä tarkastellaan VAS-diagnostiikkatestereiden käyttöä ajoneuvojen huolto- ja korjaustoiminnassa. Pääpaino tulee olemaan päivittäisen korjaamotyöskentelyn kannalta olennaisimmissa toiminnoissa ja ominaisuuksissa. Työssä perehdytään myös diagnostiikkatestereiden historiaan ja ohjelmistojen tulevaisuuden näkymiin. Loppuosassa kuvataan kaksi käytännön vianhakua käyttäen VAS5051B- diagnostiikk...

Keskihurun tilan uudelleenkäynnistäminen

OpenAIRE

Leiviskä, Jaakko

2014-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia Keskihurun maatilan, eli kotitilani uudelleenkäynnistämisen toteutuksen kannattavuutta ja pellonkäyttövaihtoehtoja. Tilan päätuotantosuunnaksi on kaavailtu mansikanviljelyä. Tämän osalta työssä tutkittiin viljelyn toteuttamisvaihtoehtoja, viljelykierron järjestämistä sekä välikasvien viljelyä. Toinen päätarkoitus oli löytää mansikanviljelyn ulkopuolelle jääville pelloille taloudellisesti ja työajankäytön kannalta järkevin vaihtoehto. Työn tavoi...

Full simulation study of the top Yukawa coupling at the ILC at $\\sqrt{s}$ = 1 TeV

CERN Document Server

Price, Tony; Strube, Jan; Tanabe, Tomohiko

2015-01-01

We present a study of the expected precision for measurement of the top Yukawa coupling, yt, in e+e- collisions at a center-of-mass energy of 1 TeV and assuming a beam polarization of P (e-, e+) = (-0.8,+0.2). Independent analyses of ttH final states containing at least six hadronic jets are performed, based on detailed simulations of SiD and ILD, the two candidate detector concepts for the ILC. We estimate that a statistical precision of yt of 4% can be obtained with an integrated luminosity of 1 $\\mathrm{ab}^{-1}$.

Millaisia TVT-taitoja on valmistuvilla aineenopettajilla

OpenAIRE

Kolu, Mika

2012-01-01

Tässä pro gradu -tutkielmassa tutkitaan, millaisia TVT-taitoja on Jyväskylän yliopistosta valmistuvilla aineenopettajilla. Lisäksi selvitetään millainen merkitys TVT:lla on yhteiskunnassa ja opetuskäytössä yleisesti. Toisessa luvussa kerrotaan miten Opetushallitus ja -ministeriö on määritellyt TVT:n tavoitetilan yhteiskunnassa, ja sen hyödyntämisen opetuksessa. Samalla käydään läpi eri kuntien käytänteitä TVT:n käyttöönotossa. Kolmannessa luvussa selvitetään millaisia opettajien TVT-taitoja o...

Hevostalouden pesuvesien laatu ja soveltuvat puhdistusmenetelmät

OpenAIRE

Loisa, Leena

2010-01-01

Hevostalous on Suomessa muuttunut merkittävästi viimeisten vuosikymmenien aikana. Hevosten käyttö on muuttunut työhevoskäytöstä urheilu- ja vapaa-ajankäytöksi ja uusia hevosharrastusmuotoja kehitetään jatkuvasti. Näin ollen hevostallien lukumäärä ja myös niiden tuottamat jätevesimäärät ovat jatkuvassa kasvussa. Vuoden 2004 alussa voimaan tullut Valtioneuvoston asetus 542/2003 talousjätevesien käsittelystä vesihuoltolaitosten viemäriverkostojen ulkopuolisilla alueilla edellyttää saostuskaivokä...

Kitaristin vasen käsi

OpenAIRE

Lindsberg, Maija

2015-01-01

Tässä opinnäytetyössä käsitellään klassisen kitaristin vasemman käden tekniikkaa. Aluksi esitellään kitaransoiton perusteita ja tekniikoita, jonka jälkeen annetaan kappalekohtaisia esimerkkejä niiden käytöstä. Tutkimuksen alla olevat kappaleet on valittu sen perusteella, että soitan ne B-tutkinto-ohjelmassani. Kiinnostuksen kohteena ovat erityisesti kohdat, jotka itse olen kokenut hankaliksi tai mielenkiintoisiksi vasemman käden osalta. Pyrin löytämään ratkaisuja ongelmiin ja lisäämään tietoi...

Analysis of Sensitivity and Uncertainty in an Individual-Based Model of a Threatened Wildlife Species

Science.gov (United States)

We present a multi-faceted sensitivity analysis of a spatially explicit, individual-based model (IBM) (HexSim) of a threatened species, the Northern Spotted Owl (Strix occidentalis caurina) on a national forest in Washington, USA. Few sensitivity analyses have been conducted on ...

Virtuaalikuvat oppilaitosten käytössä

OpenAIRE

Jeskanen, Lauri

2011-01-01

Tämä opinnäytetyö käsittelee virtuaalikuvien, eli 360-asteisten panoraamojen, käyttöä oppilaitoksissa. Tärkeimpinä asioina on virtuaalikuvien sekä – kierrosten toiminnan selvittäminen sekä virtuaalikuvien tulevaisuuden käyttökohteiden arviointi. Tarkastelussa ovat myös virtuaalikuvien mahdollinen sisältö sekä käyttömediat. Opinnäytetyön tuloksena valmistui noin 40 virtuaalikuvaa kattava, toimeksiantajalle toimitettu, virtuaalikierros Tampereen ammattikorkeakoulun tiloista. Virtuaalikierro...

Ferromagnetic resonance relaxation processes in Zn2Yt

International Nuclear Information System (INIS)

Mita, M.; Shimizu, H.

1975-01-01

Experimentally obtained linewidth in FMR of Zn 2 Y is analyzed numerically on the basis of two-magnon, three-magnon and four-magnon relaxation processes. In the analysis procedure of three-magnon linewidth, the effective exchange constants are determined to be D = 0.15 x 10 -9 Oe cm 2 and D = 9.3 x 10 -9 Oe cm 2 within and between the crystallographic planes. The two-magnon linewidth induced by surface imperfections is discussed in consideration of scattering due to multipole demagnetizations of the imperfections. The four-magnon linewidth is observed for the first time and analyzed successfully

CRM-järjestelmän käytettävyystutkimus

OpenAIRE

Paavilainen, Mikko

2015-01-01

Opinnäytetyön aiheena oli käytettävyys ja käytettävyystutkimus. Opinnäytetyö sisältää käytettävyyden perusteita ja käytettävyystestin suunnittelua, toteutusta ja tuloksia. Käytettävyystesti koskee CGI:n CRM-järjestelmän projektin luonti ja hallintatoimintoja. Nalli CRM–järjestelmä on yrityksellä käytössä oleva asiakkuuksienhallintajärjestelmä. Käytettävyystutkimuksen tavoitteena oli löytää käytettävyysongelmia ja kehittää ratkaisuja niiden korjaamiseksi. Käytettävyystestiin osallistui järjest...

Päihteitä käyttävä nainen ja raskaus : kirjallisuuskatsaus

OpenAIRE

Sainio, Marianna; Simula, Sonja

2017-01-01

Naisten päihteiden kulutus on kasvanut Suomessa viime vuosikymmeninä ja tästä johtuen myös raskaana olevien naisten päihteiden käyttö on ajankohtainen ongelma. Tämän opinnäytetyön tarkoituksena oli käsitellä päihteiden käytön vaikutuksia sikiöön ja vastasyntyneeseen lapseen. Tavoitteena oli tuoda esiin raskaana olevan päihteitä käyttävän naisen hoidollisia erityispiirteitä sekä nostaa esille raskaudenaikaisen päihteiden käytön riskejä. Opinnäytetyö toteutettiin kirjallisuuskatsauksena. Tu...

Musiikki muistisairaan vanhuksen hyvinvoinnin edistäjänä : Hoitonetti

OpenAIRE

Haapamäki, Tiina

2013-01-01

Iäkkäämpien ikäryhmien osuuden kasvaessa myös muistisairauksia sairastavien määrä moninkertaistuu. Muistisairaudet ovat isoin riskitekijä, joka johtaa iäkkään ihmisen pois kodistaan ympärivuorokautiseen hoitopaikkaan. Muistisairauksiin liittyvät käytösoireet heikentävät elämänlaatua ja lisäävät palvelujen tarvetta. Ne ovat myös merkittävin pitkäaikaishoidon alkamisen syy. Muistisairauksien aiheuttamia käytösoireita voidaan lievittää lääkehoidolla. Toisin kuin muistisairaan lääkehoitoon, musii...

Työskentely Norjassa : maassa työskennelleiden kokemuksia

OpenAIRE

Mäkäläinen, Teressa

2013-01-01

Tämän opinnäytetyön tarkoituksena oli antaa käytännönläheistä tietoa Norjaan muuttamisesta, työnhausta ja muista asuinmaan vaihdossa huomioon otettavista asioista, kuten verotuksesta ja sosiaaliturvasta, elinkustannuksista, asunnon hankinnasta ja käytännön elämästä. Opinnäytetyö on tarkoitettu avuksi kaikille Norjaan töihin lähteville tai sitä suunnitteleville. Tarkoituksena on tutustuttaa lukija Norjan työelämään ja maahanmuuttoa koskeviin säännöksiin, sekä auttaa Suomesta muuttamisen järjes...

Selvitys HR House Oy:n vuokratyöntekijöiden työtyytyväisyydestä

OpenAIRE

Kaskela, Leeni

2011-01-01

Opinnäytetyön tarkoituksena oli selvittää HR House Oy:n palveluksessa olevien vuokratyöntekijöiden työtyytyväisyyteen vaikuttavia asioita. Opinnäytetyö on laadullinen tutkielma, jossa käytän tutkimusmenetelmänä teemahaastattelua. Tutkimuskysymykseni selvittävät, mitkä asiat vaikuttavat työntekijöiden työ- tyytyväisyyteen ja mitä he kertovat työtyytyväisyyteen vaikuttavista tekijöistä. Toimeksianto opinnäytetyön tekemiseen on tullut HR House Oy Henkilöstöpalveluilta. Tavoitteena oli löytää kei...

Application of Bayesian methods to habitat selection modeling of the northern spotted owl in California: new statistical methods for wildlife research

Science.gov (United States)

Howard B. Stauffer; Cynthia J. Zabel; Jeffrey R. Dunk

2005-01-01

We compared a set of competing logistic regression habitat selection models for Northern Spotted Owls (Strix occidentalis caurina) in California. The habitat selection models were estimated, compared, evaluated, and tested using multiple sample datasets collected on federal forestlands in northern California. We used Bayesian methods in interpreting...

Effects of experimental removal of barred owls on population demography of northern spotted owls in Washington and Oregon—2015 progress report

Science.gov (United States)

Wiens, J. David; Dugger, Katie M.; Lewicki, Krista E.; Simon, David C.

2016-03-14

Evidence indicates that competition with newly established barred owls (Strix varia) is causing rapid declines in populations of northern spotted owls (Strix occidentalis caurina), and that the longterm persistence of spotted owls may be in question without additional management intervention. A pilot study in California showed that lethal removal of barred owls in combination with habitat conservation may be able to slow or even reverse population declines of spotted owls at local scales, but it remains unknown whether similar results can be obtained in larger areas with different forest conditions and where barred owls are more abundant. In 2015, we implemented a before-after-controlimpact (BACI) experimental design on two study areas in Oregon and Washington with at least 20 years of pre-treatment demographic data on spotted owls to determine if removal of barred owls can improve population trends of spatially associated spotted owls. Here we provide an overview of our research accomplishments and preliminary results in Oregon and Washington in 2015.

Diversidad de arañas (Araneae, Araneomorphae en la selva de montaña: un caso de estudio en las Yungas Argentinas

Directory of Open Access Journals (Sweden)

Rubio, Gonzalo D.

2015-12-01

Full Text Available The spider diversity from yungas vegetation in northwestern Argentina is studied, integrating two levels: local (α diversity, community structures and a projection at regional level of diversity (β diversity. Twenty six sites in Salta Province were sampled, representing different ambient/altitudinal strata of yungas sensu stricto (SP= pedemontane rainforest, SM= montane rainforest and BM= montane forest, yungas sensu lato (Cc-s= yungas central and southern sectors connectivity areas, YT= transitional yungas, and Chaco Serrano sites (ChS as contrast. The sampling was carried out seasonally for one year taking 10 samples of vegetation with G-Vac method. A total of 6412 spiders, 188 species and 34 families were obtained (only yungas. Theridiidae, Anyphaenidae and Linyphiidae were dominant. The highest richness was observed in Araneidae, Salticidae and Theridiidae. >em>Chibchea salta (Pholcidae, Dubiaranea msp111 (Linyphiidae and Mysmena msp110 (Mysmenidae were dominant species. Relevant differences in species composition and abundance highlighted two groups of environment (Cc-s+SP+YT+ChS vs. (SM+BM. Dictynidae, Oxyopidae and Philodromidae are associated with lower altitudinal floors (Cc-s, YT, ChS. The greatest species richness and diversity were recorded in SP and YT. The highest similarity was recorded in SM and BM; the major differences were observed in Cc-s and ChS compared with the other ambient, except with SP. Complementarity and similarity indices and coefficients revealed high β diversity in the region. Thus, it is suggested that besides reinforcing protection in transitional levels Yungas (the most disturbed and diverse habitats for spiders, conservation management in the area should be directed towards promoting natural spatial heterogeneity of Yungas, giving special emphasis to habitat mosaics that constitute each different stratum.Se estudia la diversidad de arañas de vegetación de las yungas del noroeste argentino, integrando dos

Sound recordings of road maintenance equipment on the Lincoln National Forest, New Mexico

Science.gov (United States)

D. K. Delaney; T. G. Grubb

2004-01-01

The purpose of this pilot study was to record, characterize, and quantify road maintenance activity in Mexican spotted owl (Strix occidentalis lucida) habitat to gauge potential sound level exposure for owls during road maintenance activities. We measured sound levels from three different types of road maintenance equipment (rock crusherlloader,...

Comparative habitat use of sympatric Mexican spotted and great horned owls

Science.gov (United States)

Joseph L. Ganey; William M. Block; Jeffrey S. Jenness; Randolph A. Wilson

1997-01-01

To provide information on comparative habitat use, we studied radiotagged Mexican spotted owls (Strix occidentalis lucida: n = 13) and great horned owls (Bubo virginianus: n = 4) in northern Arizona. Home-range size (95% adaptive kernel estimate) did not differ significantly between species during either the breeding or nonbreeding...

Mapping sources, sinks, and connectivity using a simulation model of Northern Spotted Owls

Science.gov (United States)

This is a study of source-sink dynamics at a landscape scale. In conducting the study, we make use of a mature simulation model for the northern spotted owl (Strix occidentalis caurina) that was developed as part of the US Fish and Wildlife Service’s most recent recovery plannin...

West nile virus anti-body surveillance in three Sierra Nevada raptors of conservation concern

Science.gov (United States)

J.M. Hull; J.J. Keane; L.A. Tell; H.B. Ernest

2010-01-01

West Nile virus (WNV) infection has caused high levels of mortality in North American hawks and owls. To investigate the extent of infection among raptors of conservation concern in the Sierra Nevada, we tested 62 Northern Goshawks (Accipiter gentilis), 209 Spotted Owls (Strix occidentalis), and 22 Great Gray Owls (...

Energy requirements for growth in the Yorkshire terrier.

Science.gov (United States)

Alexander, Janet E; Colyer, Alison; Morris, Penelope J

2017-01-01

The 2006 National Research Council (NRC) equation calculating puppy energy requirements does not account for reported breed differences in growth pattern. Energy requirements of toy breed puppies are unknown and it is unclear whether feeding guidelines should differ between breeds. Energy requirements of Yorkshire terrier (YT) puppies were observed over their first year of life and compared with those predicted by the NRC and those previously observed in large (Labrador retriever) and medium (miniature Schnauzer; MS) breed puppies. Twenty-two puppies (from eight litters) were offered complete and balanced diets to maintain ideal body condition score (BCS). Energy intake, body weight and BCS were recorded from 10 to 52 weeks of age. Every 12 weeks, health was monitored by veterinary examination, routine haematology and plasma biochemistry. Puppies remained clinically healthy with normal skeletal development throughout. After analysis by linear mixed models it was observed that the NRC equation overestimates YT energy requirements between 10 and 20 weeks of age by up to 324·3 (95 % CI 390·4, 258·2) kJ/kg 0·75 . Energy intake was lower ( P  < 0·05) in YT than Labradors until 29 weeks by up to 376·6 (95 % CI 477·4, 275·3) kJ/kg 0·75 and lower than MS between 16 and 25 weeks by up to 216·3 (95 % CI 313·0, 119·7) kJ/kg 0·75 ( P  < 0·05). Data indicate differences in toy, medium and large breed energy requirements for growth. The NRC equation for puppy energy requirements overestimated the requirements of this YT population, suggesting the need for breed-specific feeding guides for growth to avoid overfeeding.

Association of weather and nest-site structure with reproductive success in California spotted owls

Science.gov (United States)

Malcolm North; George Steger; Renee Denton; Gary Eberlein; Tom Munton; Ken Johnson

2000-01-01

Although the spotted owl (Strix occidentalis) has been intensively studied, factors influencing its reproduction are not well understood. We examined a 9-year demographic study of 51-86 pairs of the California spotted owl (S. o. occidentalis), weather conditions, and forest structure at nest sites in oak (Quercus sp.) woodland and...

Venäläinen tytäryritys suomalaisessa konsernitilinpäätöksessä - Case Inlook Oy

OpenAIRE

Romanova, Julia

2009-01-01

Työn keskeisin käsite on konsernin tilinpäätöstietojen yhdisteleminen ja tilinpäätöskäytäntö. Tilinpäätöskäytäntö voidaankin ajatella taloudellisen kommunikoinnin välineenä – taloudelli-sena kielenä. Kielen tehtävänä on kiteyttää informaatio tai ajatukset merkkeihin, jotka ym-märretään tietyssä kirjanpitoympäristössä samalla tavalla. Ongelmana on se, että taloudelli-nen kieli sisältää paljon kulttuurille ominaisia asioita, mikä tekee jokaisesta eri kirjanpitoym-päristön taloudellisesta kieles...

Hoitajien kokemuksia Theraplay-ryhmäsovelluksesta lastenpsykiatrisessa hoitotyössä

OpenAIRE

Manninen, Niina; Ollikainen, Laura

2011-01-01

Tämän opinnäytetyön tarkoituksena oli selvittää hoitajien kokemuksia ja ajatuksia Theraplay-ryhmäsovelluksesta lastenpsykiatrisessa hoitotyössä sekä kartoittaa hoitajien mielipiteitä mahdollisesta tanssin ja musiikin käytöstä osana tätä sovellusta. Opinnäytetyön tehtävänä oli selvittää millaisia kokemuksia hoitajilla on Theraplay-ryhmäsovelluksesta, mitä ajatuksia mahdollinen musiikin ja tanssin käyttö osana Theraplay-ryhmäsovellusta herättää sekä mitä kehitettävää tämän sovelluksen käytössä ...

Three new species of tube-dwelling spider genus Ariadna Audouin, 1826 (Araneae: Segestriidae) from India.

Science.gov (United States)

Siliwal, Manju; Yadav, Archana; Kumar, Dolly

2017-12-05

The tube-dwelling spider family Segestriidae is represented in India by only two species, Ariadna nebulosa Simon, 1906 and Segestria inda Simon, 1906. Both species are known only from their type localities. For about 96 years, there has been no report of these spiders from the Indian subcontinent. Here, we describe three new species based on female specimens from India. Ariadna vansda sp. nov. from Gujarat; A. molur sp. nov., and A. chhotae sp. nov. from Karnataka.

Accessible light detection and ranging: estimating large tree density for habitat identification

Science.gov (United States)

Heather A. Kramer; Brandon M. Collins; Claire V. Gallagher; John Keane; Scott L. Stephens; Maggi Kelly

2016-01-01

Large trees are important to a wide variety of wildlife, including many species of conservation concern, such as the California spotted owl (Strix occidentalis occidentalis). Light detection and ranging (LiDAR) has been successfully utilized to identify the density of large-diameter trees, either by segmenting the LiDAR point cloud into...

Spotted owl roost and nest site selection in northwestern California

Science.gov (United States)

J.A. Blakesley; A.B. Franklin; R.J. Gutierrez

1992-01-01

We directly observed roost and nest site selection in a population of northern spotted owls (Strix occidentalis caurina) in northwestern California during 1985-89. Because of potential biases caused by use of radio telemetry in previous studies, we examined habitat use relative to habitat availability at a level not previously reported for spotted...

Revision of the cicada genus Dilobopyga (Hemiptera, Cicadidae) from Sulawesi and the Moluccas.

Science.gov (United States)

Duffels, J P

2018-04-13

This revision of the cicadas of the genus Dilobopyga provides a diagnosis of the genus and descriptions, illustrations and distribution maps for 48 species. The following 33 species described here are new to science: D. angulata, angustata, bifida, curvispina, fasciata, hayashii, hollowayi, johani, knighti, langeraki, laterocurvata, latifascia, luwukensis, macrocerata, maleo, mamasa, mediolobata, nebulosa, operculata, palopoensis, pelengensis, platyacantha, quadrimaculata, rantemario, recurvata, rozendaali, sangihensis, sarasinorum, splendida, tambusisi, toraja, vantoli and watuwila. The key presented is designed for the identification of males of Dilobopyga to the species level. The subdivision of the genus in five species groups viz., opercularis group (17 species), nebulosa group (1 species), chlorogaster group (16 species), minahassae group (6 species) and watuwila group (8 species), is sustained by a phylogenetic analysis of morphological characters of all species described.        The cicadas of the genus Dilobopyga are found in Sulawesi, neighbouring islands and southern Moluccas. Of the 48 species of Dilobopyga 43 species are endemic to Sulawesi. Most of these Sulawesi species are restricted to either one peninsula or to a part of Central Sulawesi. The remaining five species are endemic to either the Sangihe Islands, Banggai Islands or the southern Moluccas. A taxon-area cladogram for the species of Dilobopyga provides a basis for a discussion on the historic biogeography of the genus.

The contribution of federal and nonfederal habitat to persistence of the northern spotted owl on the Olympic Peninsula, Washington: report of the reanalysis team.

Science.gov (United States)

Richard S. Holthausen; Martin G. Raphael; Kevin S. McKelvey; Eric D. Forsman; Edward E. Starkey; D. Erran. Seaman

1995-01-01

We analyzed likely patterns of distribution and persistence of northern spotted owls (Strix occidentalis caurina) on the Olympic Peninsula. Analysis focused on the effects of Federal habitat under provisions of the Northwest Forest Plan; additional benefits to the owl population of different levels of habitat retention on non-Federal lands; effects of establishing a...

Spotted owl ecology: theory and methodology—a reply to Rosenberg et al.

Science.gov (United States)

A.B. Carey

1995-01-01

In their remarks on the study of Spotted Owls (Strix occidentalis) by Carey et al. (1992). Rosenberg et al. (1994) questioned the appropriateness of certain analyses and methods, and specific interpretation of the results. Herein, I respond to the comments of Rosenberg et al. (1994), which are summarized in italics.Sample sizes were nor...

Models for mapping potential habitat at landscape scales: an example using northern spotted owls.

Science.gov (United States)

William C. McComb; Michael T. McGrath; Thomas A. Spies; David. Vesely

2002-01-01

We are assessing the potential for current and alternative policies in the Oregon Coast Range to affect habitat capability for a suite of forest resources. We provide an example of a spatially explicit habitat capability model for northern spotted owls (Strix occidentalis caurina)to illustrate the approach we are taking to assess potential changes...

Relative abundance of small mammals in nest core areas and burned wintering areas of Mexican spotted owls in the Sacramento Mountains, New Mexico

Science.gov (United States)

Joseph L. Ganey; Sean C. Kyle; Todd A. Rawlinson; Darrell L. Apprill; James P Ward

2014-01-01

Mexican Spotted Owls (Strix occidentalis lucida) are common in older forests within their range but also persist in many areas burned by wildfire and may selectively forage in these areas. One hypothesis explaining this pattern postulates that prey abundance increases in burned areas following wildfire. We observed movement to wintering areas within areas burned by...

Diets of California spotted owls in the Sierra National Forest

Science.gov (United States)

Thomas E. Munton; Kenneth D. Johnson; George N. Steger; Gary P. Eberlein

2002-01-01

From May 1987 through October 1992 and from July through August 1998, we studied diets of California spotted owls (Strix occidentalis occidentalis). Regurgitated pellets were collected at roost and nest sites between 1,000 and 7,600 ft elevation in the Sierra National Forest and were examined for remnant bones, feathers, and insect exoskeletons....

Molecular Evidence for Species-Level Distinctions in Clouded Leopards

OpenAIRE

Buckley-Beason, Valerie A.; Johnson, Warren E.; Nash, Willliam G.; Stanyon, Roscoe; Menninger, Joan C.; Driscoll, Carlos A.; Howard, JoGayle; Bush, Mitch; Page, John E.; Roelke, Melody E.; Stone, Gary; Martelli, Paolo P.; Wen, Ci; Ling, Lin; Duraisingam, Ratna K.

2006-01-01

Among the 37 living species of Felidae, the clouded leopard (Neofelis nebulosa) is generally classified as a monotypic genus basal to the Panthera lineage of great cats [1–5]. This secretive, mid-sized (16–23 kg) carnivore, now severely endangered, is traditionally subdivided into four southeast Asian subspecies (Figure 1A) [4–8]. We used molecular genetic methods to re-evaluate subspecies partitions and to quantify patterns of population genetic variation among 109 clouded leopards of known ...

TECNOLOGIAS DA VIDA E TEOLOGIA

Directory of Open Access Journals (Sweden)

. Editorial

2001-01-01

Full Text Available Pierre Simon de Laplace, astrofísico do final do século XVIII, tinha elaborado uma hipótese cosmogônica sobre a origem do universo, segundo a qual o sistema solar proviria de uma nebulosa primitiva. Um dia mostrou essa teoria a Napoleão, pedindo-lhe sua opinião. Este respondeu: "Interessante, mas onde você coloca a Deus em tudo isso?" "Majestade", retrucou Laplace, "essa é uma hipótese inútil".

Oscillation of two-dimensional linear second-order differential systems

International Nuclear Information System (INIS)

Kwong, M.K.; Kaper, H.G.

1985-01-01

This article is concerned with the oscillatory behavior at infinity of the solution y: [a, ∞) → R 2 of a system of two second-order differential equations, y''(t) + Q(t) y(t) = 0, t epsilon[a, ∞); Q is a continuous matrix-valued function on [a, ∞) whose values are real symmetric matrices of order 2. It is shown that the solution is oscillatory at infinity if the largest eigenvalue of the matrix integral/sub a//sup t/ Q(s) ds tends to infinity as t → ∞. This proves a conjecture of D. Hinton and R.T. Lewis for the two-dimensional case. Furthermore, it is shown that considerably weaker forms of the condition still suffice for oscillatory behavior at infinity. 7 references

Työn ja vapaa-ajan tasapaino

OpenAIRE

Yoshida, Teemu

2013-01-01

Tämän opinnäytetyön aiheena oli työn ja vapaa-ajan tasapainon hallinta. Työssä paneuduttiin työn ja vapaa-ajan tasapainon määrittelyn vaikeuteen sekä tasapainon löytämisen mukanaan tuomiin hyötyihin. Tavoitteena oli selvittää, mitkä tekijät vaikuttavat työntekijän elämän tasapainoon. Tutkimus on rajattu organisaation näkökulmasta niihin tunnusmerkkeihin ja käytäntöihin, jotka määrittelevät perheystävällisen organisaatiokulttuurin unohtamatta kuitenkaan yksineläviä työntekijöitä. Työntekijän ...

Physiological Plausibility and Boundary Conditions of Theories of Risk Sensitivity

DEFF Research Database (Denmark)

Marchiori, Davide; Elqayam, Shira

2012-01-01

dilatation, which in turn positively correlates with a risk aversion behavior. They hypothesize that participants’ attention is increased in decision problems involving losses, which trigger an innate prudent behavior in situations entailing danger and/or hazard. Interestingly, Y&T find that the nature...... of attention is not selective, i.e., when losses are present, participants are shown to devote more attention to the task as a whole rather than to the single negative outcomes, in contrast to Prospect Theory's loss aversion....... and physiological underpinnings of one of the central topics in judgment and decision-making (JDM) research – choice behavior in decisions from experience. Y&T successfully contributes to this goal by demonstrating a novel effect that losses increase experimental participants’ arousal as measured by pupil...

Urkintalaki

OpenAIRE

Kivioja, Elina

2010-01-01

Tämän opinnäytetyön tavoite on antaa kattava kuva siitä, millä keinoilla työnantaja voi lukea työntekijöidensä sähköpostiviestejä, valvoa Internetin ja intranetin käyttöä työpaikoilla, ja näin estää yrityssalaisuuksiensa oikeudettomat paljastumiset ja tietoverkon väärinkäytökset. Tietoverkon väärinkäytösten osalta työni perustuu pääasiassa sähköisen viestinnän tietosuojalain säännöksiin ja lain esitöihin. Työnantajan oikeuksien osalta hakea esille ja lukea työntekijöiden sähköpostiviestejä pe...

Physical characteristics of the binary PHA 2003 YT1

Czech Academy of Sciences Publication Activity Database

Larson, S. M.; Grauer, A. D.; Beshore, E.; Christensen, E.; Pravec, Petr; Kaasalainen, M.; Nolan, M. C.; Howell, E. S.; Hine, A. A.; Galád, Adrián; Gajdoš, Š.; Kornoš, L.; Világi, J.

2004-01-01

Roč. 36, č. 4 (2004), s. 1139 ISSN 0002-7537 R&D Projects: GA AV ČR IAA3003204 Institutional research plan: CEZ:AV0Z1003909 Keywords : binary * asteroids * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

Lockout tagout, turvalukituskäytäntö valimossa

OpenAIRE

Rouhiainen, Henri

2017-01-01

Tämän opinnäytetyön tarkoituksena oli käydä Aurubis Finland Oy:n kuparivalimon määriteltyjen laitteiden energialähteet läpi sekä tarkistaa laitteiden ja koneiden turvalukitukset ja tehdä ohjeistukset turvalukitusten osalta. Työssä käytettiin lockout/tagout-standardin mukaista vahinkokäynnistyksen eston toimintamallia. Tämä sama työ tehtiin Aurubiksen kuparivalssaamossa eri insinööriopiskelijan toimesta, jolloin ohjeiden tyylistä ja ulkonäöstä päätettiin yhteistyössä. Tiedon hankkimiseksi ...

Final Supplemental Environmental Impact Statement for Airborne Laser Program at Kirtland AFB, White Sands Missile Range/ Holloman AFB, New Mexico; Edwards AFB, Vandenberg AFB, California

Science.gov (United States)

2003-06-01

Sneed pincushion cactus T Kuen_zler hedgehog cactus - Sacramento oricklv ooppy - I Sacramento Mountains checkerspot - ! butterfly . . Federal Status E...caiifomicus Coho salmon ~_j_Pncorhynchus kisutch , Unarmoured three- spined 1 C~asterosleus aculeatus- ----: stickleback , wi/liamsoni 1 E T E...septentrionalis) Kuenzler hedgehog cachts (Echinocereus fendleri var. kuenzleri) THREATENED Bald eagle (Haliaeetus /.:ucocephalus) Mexican spotted owl (Strix

The scientific basis for modeling Northern Spotted Owl habitat: A response to Loehle, Irwin, Manly, and Merrill

Science.gov (United States)

Jeffrey R. Dunk; Brian Woodbridge; Elizabeth M. Glenn; Raymond J. Davis; Katherine Fitzgerald; Paul Henson; David W. LaPlante; Bruce G. Marcot; Barry R. Noon; Martin G. Raphael; Nathan H. Schumaker; Brendan. White

2015-01-01

The U.S. Fish and Wildlife Service recently revised the recovery plan (USFWS, 2011) and designated Critical Habitat (USFWS, 2012a) for the Northern Spotted Owl (Strix occidentalis caurina). The Critical Habitat designation was based in part on a map of relative habitat suitability that was developed by USFWS (2011, 2012b) for this purpose. Loehle...

Managing emerging threats to spotted owls

Science.gov (United States)

Ho Yi Wan; Joseph L. Ganey; Christina D. Vojta; Samuel A. Cushman

2018-01-01

The 3 spotted owl (Strix occidentalis) subspecies in North America (i.e., northern spotted owl [S. o. caurina], California spotted owl [S. o. occidentalis], Mexican spotted owl [S. o. lucida]) have all experienced population declines over the past century due to habitat loss and fragmentation from logging. Now, the emerging influences of climate change, high-severity...

Food habits of Mexican Spotted Owls in Arizona

Science.gov (United States)

Joseph L. Ganey

1992-01-01

The Spotted Owl (Strix occidentalis) is most common in mature and old-growth coniferous forests throughout much of its range (Forsman et al. 1984, Laymon 1988, Ganey and Balda 1989a, Thomas et al. 1990). Proximate factors underlying habitat selection in Spotted Owls are understood poorly. Abundance and availability of food, however, may be a key...

Survival and reproduction of radio-marked adult spotted owls.

Science.gov (United States)

C.C. Foster; E.D. Forsman; E.C. Meslow; G.S. Miller; J.A. Reid; F.F. Wagner; A.B. Carey; J.B. Lint

1992-01-01

We compared survival, reproduction, and body mass of radio-marked and non radio-marked spotted owls (Strix occidentalis) to determine if backpack radios influenced reproduction or survival. In most study areas and years, there were no differences (P > 0.05) in survival of males and females or in survival of radio-marked versus banded owls. There...

Nest reuse by Northern Spotted Owls on the east slope of the Cascade Range, Washington

Science.gov (United States)

Stan G. Sovern; Margaret Taylor; Eric D. Forsman

2011-01-01

During a long-term demography study of Northern Spotted Owls (Strix occidentalis caurina) in the eastern Cascade Range of Washington State in 1989 to 2008, we documented 276 nests of Northern Spotted Owls at 73 different territories. Of these nests, 90.2% were on platforms, mostly in clumps of deformed limbs caused by dwarf mistletoe (primarily...

The effects of habitat, climate, and Barred Owls on long-term demography of Northern Spotted Owls

Science.gov (United States)

Katie M. Dugger; Eric D. Forsman; Alan B. Franklin; Raymond J. Davis; Gary C. White; Carl J. Schwarz; Kenneth P. Burnham; James D. Nichols; James E. Hines; Charles B. Yackulic; Paul F. Doherty; Larissa Bailey; Darren A. Clark; Steven H. Ackers; Lawrence S. Andrews; Benjamin Augustine; Brian L. Biswell; Jennifer Blakesley; Peter C. Carlson; Matthew J. Clement; Lowell V. Diller; Elizabeth M. Glenn; Adam Green; Scott A. Gremel; Dale R. Herter; J. Mark Higley; Jeremy Hobson; Rob B. Horn; Kathryn P. Huyvaert; Christopher McCafferty; Trent McDonald; Kevin McDonnell; Gail S. Olson; Janice A. Reid; Jeremy Rockweit; Viviana Ruiz; Jessica Saenz; Stan G. Sovern

2016-01-01

Estimates of species’ vital rates and an understanding of the factors affecting those parameters over time and space can provide crucial information for management and conservation. We used mark–recapture, reproductive output, and territory occupancy data collected during 1985–2013 to evaluate population processes of Northern Spotted Owls (Strix occidentalis...

Implementation of special engineering safety features for severe accident management. New SAMG approach

International Nuclear Information System (INIS)

Grigorov, D.; Borisov, E.; Mancheva, K.

2012-01-01

Conclusions: As a result of the thermohydraulic analysis conducted the following main conclusions are formulated: The operator actions for accident management are effective and allow reaching conditions for application of the new engineering safety features for SAMG; The new engineering safety features application is effective and prevents severe core damage for Scenario 1. For the Scenario 2 they prevents degradation and relocation of the reactor core for a long period of time (in the analysis this period is 10 h, but the unit could be kept in safe condition for longer time which is not specifically analysed).The maximal fuel cladding temperature for Scenario 1 reaches 558 o C. This low fuel cladding temperature gradient is achieved by applying a complex of operator actions which prevent any core damage. If the additional discharge line with DN 100 mm from the PRZ is not opened then a severe core damage occurs; The maximal fuel cladding temperature for Scenario 2 reaches 1307 o C. One of the possibilities for keeping this temperature below 1200 o C is to mount second line (the first SFP line is between YT12S03.S04) from the SFP to the TQ22 pipeline which is connected to YT14B01 hydroaccumulator line, between the check valves YT14S03.S04

The evolution of mapping habitat for northern spotted owls (Strix occidentalis caurina): A comparison of photo-interpreted, Landsat-based, and lidar-based habitat maps

Science.gov (United States)

Ackers, Steven H.; Davis, Raymond J.; Olsen, K.; Dugger, Catherine

2015-01-01

Wildlife habitat mapping has evolved at a rapid pace over the last few decades. Beginning with simple, often subjective, hand-drawn maps, habitat mapping now involves complex species distribution models (SDMs) using mapped predictor variables derived from remotely sensed data. For species that inhabit large geographic areas, remote sensing technology is often essential for producing range wide maps. Habitat monitoring for northern spotted owls (Strix occidentalis caurina), whose geographic covers about 23 million ha, is based on SDMs that use Landsat Thematic Mapper imagery to create forest vegetation data layers using gradient nearest neighbor (GNN) methods. Vegetation data layers derived from GNN are modeled relationships between forest inventory plot data, climate and topographic data, and the spectral signatures acquired by the satellite. When used as predictor variables for SDMs, there is some transference of the GNN modeling error to the final habitat map.Recent increases in the use of light detection and ranging (lidar) data, coupled with the need to produce spatially accurate and detailed forest vegetation maps have spurred interest in its use for SDMs and habitat mapping. Instead of modeling predictor variables from remotely sensed spectral data, lidar provides direct measurements of vegetation height for use in SDMs. We expect a SDM habitat map produced from directly measured predictor variables to be more accurate than one produced from modeled predictors.We used maximum entropy (Maxent) SDM modeling software to compare predictive performance and estimates of habitat area between Landsat-based and lidar-based northern spotted owl SDMs and habitat maps. We explored the differences and similarities between these maps, and to a pre-existing aerial photo-interpreted habitat map produced by local wildlife biologists. The lidar-based map had the highest predictive performance based on 10 bootstrapped replicate models (AUC = 0.809 ± 0.011), but the

ARTIFICIAL NEURAL NETWORKS, FUZZY LOGIC AND NEURO-FUZZY SYSTEM IN THE ROLE OF SHORT TERM LOAD FORECAST

OpenAIRE

LUIZ SABINO RIBEIRO NETO

1999-01-01

Esta dissertação investiga o desempenho de técnicas de inteligência computacional na previsão de carga em curto prazo. O objetivo deste trabalho foi propor e avaliar sistemas de redes neurais, lógica nebulosa, neuro-fuzzy e híbridos para previsão de carga em curto prazo, utilizando como entradas variáveis que influenciam o comportamento da carga, tais como: temperatura, índice de conforto e perfil de consumo. Este trabalho envolve 4 etapas principais: um estudo...

Von Gierke disease

Science.gov (United States)

... sugar test Genetic testing Lactic acid blood test Triglyceride level Uric acid blood test If a person ... 45. Kishnani PS, Chen Y-T. Defects in metabolism of carbohydrates. In: Kliegman RM, Stanton BF, St. ...

The multiplicity dependence of inclusive pt spectra from p-p collisions at sqrt s = 200 GeV

International Nuclear Information System (INIS)

Adams, J.; Aggarwal, M.M.; Ahammed, Z.; Amonett, J.; Anderson, B.D.; Anderson, M.; Arkhipkin, D.; Averichev, G.S.; Bai, Y.; Balewski, J.; Barannikova, O.; Barnby, L.S.; Baudot, J.; Bekele, S.; Belaga, V.V.; Bellingeri-Laurikainen, A.; Bellwied, R.; Benedosso, F.; Bhardwaj, S.; Bhasin, A.; Bhati, A.K.; Bichsel, H.; Bielcik, J.; Bielcikova, J.; Bland, L.C.; Blyth, S.-L.; Bonner, B.E.; Botje, M.; Bouchet, J.; Brandin, A.V.; Bravar, A.; Bystersky, M.; Cadman, R.V.; Cai, X.Z.; Caines, H.; Calderonde la Barca Sanchez, M.; Castillo, J.; Catu, O.; Cebra, D.; Chajecki, Z.; Chaloupka, P.; Chattopadhyay, S.; Chen, H.F.; Chen, J.H.; Cheng, J.; Cherney, M.; Chikanian, A.; Christie, W.; Coffin, J.P.; Cormier, T.M.; Cosentino, M.R.; Cramer, J.G.; Crawford, H.J.; Das, D.; Das, S.; Daugherity, M.; de Moura, M.M.; Dedovich, T.G.; DePhillips, M.; Derevschikov, A.A.; Didenko, L.; Dietel, T.; Djawotho, P.; Dogra, S.M.; Dong, W.J.; Dong, X.; Draper, J.E.; Du, F.; Dunin, V.B.; Dunlop, J.C.; Dutta Mazumdar, M.R.; Eckardt, V.; Edwards, W.R.; Efimov, L.G.; Emelianov, V.; Engelage, J.; Eppley, G.; Erazmus, B.; Estienne, M.; Fachini, P.; Fatemi, R.; Fedorisin, J.; Filimonov, K.; Filip, P.; Finch, E.; Fine, V.; Fisyak, Y.; Fu, J.; Gagliardi, C.A.; Gaillard, L.; Ganti, M.S.; Ghazikhanian, V.; Ghosh, P.; Gonzalez, J.S.; Gorbunov, Y.G.; Gos, H.; Grebenyuk, O.; Grosnick, D.; Guertin, S.M.; Guimaraes, K.S.F.F.; Guo, Y.; Gupta, N.; Gutierrez, T.D.; Haag, B.; Hallman, T.J.; Hamed, A.; Harris, J.W.; He, W.; Heinz, M.; Henry, T.W.; Hepplemann, S.; Hippolyte, B.; Hirsch, A.; Hjort, E.; Hoffman, A.M.; Hoffmann, G.W.; Horner, M.J.; Huang, H.Z.; Huang, S.L.; Hughes, E.W.; Humanic, T.J.; Igo, G.; Jacobs, P.; Jacobs, W.W.; Jakl, P.; Jia, F.; Jiang, H.; Jones, P.G.; Judd, E.G.; Kabana, S.; Kang, K.; Kapitan, J.; Kaplan, M.; Keane, D.; Kechechyan, A.; Khodyrev, V.Yu.; Kim, B.C.; Kiryluk, J.; Kisiel, A.; Kislov, E.M.; Klein, S.R.; Kocoloski, A.; Koetke, D.D.; Kollegger, T.

2006-01-01

We report measurements of transverse momentum pt spectra for ten event multiplicity classes of p-p collisions at sqrt s = 200$ GeV. By analyzing the multiplicity dependence we find that the spectrum shape can be decomposed into a part with amplitude proportional to multiplicity and described by a Levy distribution on transverse mass mt, and a part with amplitude proportional to multiplicity squared and described by a gaussian distribution on transverse rapidity yt. The functional forms of the two parts are nearly independent of event multiplicity. The two parts can be identified with the soft and hard components of a two-component model of p-p collisions. This analysis then provides the first isolation of the hard component of the pt spectrum as a distribution of simple form on yt

Linear Pursuit Differential Game under Phase Constraint on the State of Evader

Directory of Open Access Journals (Sweden)

Askar Rakhmanov

2016-01-01

Full Text Available We consider a linear pursuit differential game of one pursuer and one evader. Controls of the pursuer and evader are subjected to integral and geometric constraints, respectively. In addition, phase constraint is imposed on the state of evader, whereas pursuer moves throughout the space. We say that pursuit is completed, if inclusion y(t1-x(t1∈M is satisfied at some t1>0, where x(t and y(t are states of pursuer and evader, respectively, and M is terminal set. Conditions of completion of pursuit in the game from all initial points of players are obtained. Strategy of the pursuer is constructed so that the phase vector of the pursuer first is brought to a given set, and then pursuit is completed.

Quantum influence in the criticality of the spin- {1}/{2} anisotropic Heisenberg model

Science.gov (United States)

Ricardo de Sousa, J.; Araújo, Ijanílio G.

1999-07-01

We study the spin- {1}/{2} anisotropic Heisenberg antiferromagnetic model using the effective field renormalization group (EFRG) approach. The EFRG method is illustrated by employing approximations in which clusters with one ( N'=1) and two ( N=2) spins are used. The dependence of the critical temperature Tc (ferromagnetic-F case) and TN (antiferromagnetic-AF case) and thermal critical exponent, Yt, are obtained as a function of anisotropy parameter ( Δ) on a simple cubic lattice. We find that, in our results, TN is higher than Tc for the quantum anisotropic Heisenberg limit and TN= Tc for the Ising and quantum XY limits. We have also shown that the thermal critical exponent Yt for the isotropic Heisenberg model shows a small dependence on the type of interaction (F or AF) due to finite size effects.

Electron microscopical studies of the common bile duct in reindeer

Directory of Open Access Journals (Sweden)

Timo Rahko

1990-08-01

Full Text Available In a previous publication the authors have described some ultrastructural characteristics of granulated cells in the common bile duct of the reindeer. On the basis of the same material, electron microscopic observations on other tissue elements of bile duct wall are now reported. The surface and glandular epithelium were composed of tall columnar epithelial cells with villous structures on the luminal surfaces. The parietal cytoplasmic membranes of epithelial cells were equipped with intercellular desmosomes while intraepithelial globule leucocytes did not form any junctional complex with other cells. Apical cytoplasmic areas of superficial epithelial cells showed electron-dense small bodies possibly consisting of mucinous substances. The goblet and deep glandular cells, on the other hand, contained numerous large mucin granules with less electron-dense matrices. It appears that their secretions are more abundant than those in superficial epithelial cells which obviously are absorptive as their main function. The nuclei and other cytoplasmic organelles showed profiles similar to those in epithelial cells generally. The lumen of the bile ducts was usually empty or contained fine-granular or amorphous material. An unusual feature was the presence of parts of globule leucocytes or even almost whole cells occurring freely in ductal secretions.Elektronimikroskooppinen tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Aikaisemmassa julkaisussa tekijät kuvasivat poron yhteisen sappikäytävän (ductus hepaticus communis seinämän jyväsellisten solujen hienorakennetta. Tässä artikkelissa selostetaan saman aineiston perusteella (6 tervettä teurasporoa elektronimikroskooppisia havaintoja sappikäytäväseinämän muista kudosrakenteista. Sappikäytäväseinämän pinta- ja rauhasepiteeli koostuu korkeista epiteelisoluista. Pinnallisia epiteelisoluja kattavat säännölliset mikrovillukset, ja niillä on vain v

Genetics Home Reference: isobutyryl-CoA dehydrogenase deficiency

Science.gov (United States)

... An Y, Weavil SD, Chaing SH, Bali D, McDonald MT, Kishnani PS, Chen YT, Millington DS. Rare ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

Genetics Home Reference: short-chain acyl-CoA dehydrogenase deficiency

Science.gov (United States)

... An Y, Weavil SD, Chaing SH, Bali D, McDonald MT, Kishnani PS, Chen YT, Millington DS. Rare ... 10 All Bulletins Features What is direct-to-consumer genetic testing? What are genome editing and CRISPR- ...

Science verses political reality in delisting criteria for a threatened species: The Mexican spotted owl experience

Science.gov (United States)

Gary C. White; William M. Block; Joseph L. Ganey; William H. Moir; James P. Ward; Alan B. Franklin; Steven L. Spangle; Sarah E. Rinkevich; J. Robert Vahle; Frank P. Howe; James L. Dick

1999-01-01

The Mexican spotted owl (Strix occidentalis lucida) was listed as a threatened species under the Endangered Species Act (ESA) in April 1993 (USDI 1993). Concomitant with the listing of the owl, a recovery team was appointed to develop a plan to recover the owl, allowing for its removal from the list of threatened and endangered species. The recovery plan - "the...

Conflicting perspectives on spotted owls, wildfire, and forest restoration

Science.gov (United States)

Joseph L. Ganey; Ho Yi Wan; Samuel A. Cushman; Christina D. Vojta

2017-01-01

Evidence of increasing fire extent and severity in the western US in recent decades has raised concern over the effects of fire on threatened species such as the spotted owl (Strix occidentalis Xantus de Vesey), which nests in forests with large trees and high canopy cover that are vulnerable to high-severity wildfire. A dichotomy of views exists on the impact of high-...

Environmental Assessment: Space Innovation and Development Center Schriever AFB, Colorado

Science.gov (United States)

2006-03-01

coloradensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Least tern (interior population) .A Sterna antillarum E Mexican spotted owl Strix...Haliaeetus leucocephalus T Boreal toad Bufo boreas boreas c Canada lynx Lynx canadensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Least...T CUSTER Bald eagle IIaliaeetus leucocephalus T Canada lynx Lynx canadensis T Greenback cutthroat trout Oncorhynchus clarki stomias T Mexican

Wood owls of the genera Strix and Ciccaba

NARCIS (Netherlands)

Voous, K.H.

1964-01-01

"... speaking here as a taxonomist to taxonomists, I am certainly no less than respectful toward the noble art of classification" (Léon Croizat, 1958, p. 119). In considering a thorough systematic study a necessity before entering into zoogeographical theories, the author feels he may expect the

Galactosemia

Science.gov (United States)

... and Rector's The Kidney. 10th ed. Philadelphia, PA: Elsevier; 2016:chap 45. Broomfield A, Brain C, Grunewald S. ... Neurology in Clinical Practice. 7th ed. Philadelphia, PA: Elsevier; 2016:chap 91. Kishnani PS, Chen Y-T. ...

Girando con pesas en las manos: conservación del momento angular

OpenAIRE

Ferrer Roca, Chantal

2013-01-01

Las personas que practican patinaje artístico, al girar sobre sí mismas encogiendo progresivamente sus extremidades, son capaces de incrementar de forma espectacular su velocidad de giro. También los cuerpos del universo, que siempre están girando (estrellas, púlsares, nebulosas) cambian la velocidad de rotación con el tiempo. Este vídeo presenta una demostración clásica y sencilla en la que una persona sentada en una banqueta giratoria con dos pesas en las manos modifica su velocidad de giro...

Yoga for High‑Risk Pregnancy: A Randomized Controlled Trial

African Journals Online (AJOL)

assess yoga therapy (YT) module on maternal stress level in high risk pregnancy. .... i.e., 35 years, (6) BMI > 30, (7) family history (sister, ... neurosis, addictions, etc. ... 68 patients were allocated to two treatment groups: Yoga (n= 30),.

Determining the Critical Point of a Sigmoidal Curve via its Fourier Transform

International Nuclear Information System (INIS)

Bilge, Ayse Humeyra; Ozdemir, Yunus

2016-01-01

A sigmoidal curve y(t) is a monotone increasing curve such that all derivatives vanish at infinity. Let t_n be the point where the nth derivative of y(t) reaches its global extremum. In the previous work on sol-gel transition modelled by the Susceptible-Infected- Recovered (SIR) system, we observed that the sequence { t_n } seemed to converge to a point that agrees qualitatively with the location of the gel point [2]. In the present work we outline a proof that for sigmoidal curves satisfying fairly general assumptions on their Fourier transform, the sequence { t_n } is convergent and we call it “the critical point of the sigmoidal curve”. In the context of phase transitions, the limit point is interpreted as a junction point of two different regimes where all derivatives undergo their highest rate of change. (paper)

Fitness Level and Not Aging per se, Determines the Oxygen Uptake Kinetics Response

Directory of Open Access Journals (Sweden)

Mitchell A. George

2018-03-01

Full Text Available Although aging has been associated to slower V˙O2 kinetics, some evidence indicates that fitness status and not aging per se might modulate this response. The main goal of this study was to examine the V˙O2, deoxygenated hemoglobin+myoglobin (deoxy-[Hb+Mb] kinetics, and the NIRS-derived vascular reperfusion responses in older compared to young men of different training levels (i.e., inactive, recreationally active, and endurance trained. Ten young inactive [YI; 26 ± 5 yrs.; peak V˙O2 (V˙O2peak, 2.96 ± 0.55 L·min−1], 10 young recreationally active (YR; 26 ± 6 yrs.; 3.92 ± 0.33 L·min−1, 10 young endurance trained (YT; 30 ± 4 yrs.; 4.42 ± 0.32 L·min−1, 7 older inactive (OI; 69 ± 4 yrs.; 2.50 ± 0.31 L·min−1, 10 older recreationally active (OR; 69 ± 5 yrs.; 2.71 ± 0.42 L·min−1, and 10 older endurance trained (OT; 66 ± 3 yrs.; 3.20 ± 0.35 L·min−1 men completed transitions of moderate intensity cycling exercise (MODS to determine V˙O2 and deoxy-[Hb+Mb] kinetics, and the deoxy-[Hb+Mb]/V˙O2 ratio. The time constant of V˙O2 (τV˙O2 was greater in YI (38.8 ± 10.4 s and OI (44.1 ± 10.8 s compared with YR (26.8 ± 7.5 s and OR (26.6 ± 6.5 s, as well as compared to YT (14.8 ± 3.4 s, and OT (17.7 ± 2.7 s (p < 0.05. τV˙O2 was greater in YR and OR compared with YT and OT (p < 0.05. The deoxy-[Hb+Mb]/V˙O2 ratio was greater in YI (1.23 ± 0.05 and OI (1.29 ± 0.08 compared with YR (1.11 ± 0.03 and OR (1.13 ± 0.06, as well as compared to YT (1.01 ± 0.03, and OT (1.06 ± 0.03 (p < 0.05. Similarly, the deoxy-[Hb+Mb]/ V˙O2 ratio was greater in YR and OR compared with YT and OT (p < 0.05. There was a main effect of training (p = 0.033, whereby inactive (p = 0.018 and recreationally active men (p = 0.031 had significantly poorer vascular reperfusion than endurance trained men regardless of age. This study demonstrated not only that age-related slowing of V˙O2 kinetics can be eliminated in endurance trained individuals

Ruotsinkielisten alkeistason suomenoppijoiden paikallissijojen käytöstä

Directory of Open Access Journals (Sweden)

Tuija Määttä

2011-10-01

Full Text Available This article presents the results of research on how Swedish-speaking students learning Finnish as a foreign language at the beginners’ level use the Finnish local cases in their writing. The research is based on the Swedish subcorpus of a larger electronic corpus entitled the International Corpus of Learner Finnish. At the time the survey work was conducted, the subcorpus contained 43 496 words. To find all occurrences of the six local cases, the corpus was analysed using a concord-programme as a tool. By inputting the case suffixes, e.g. the inessive suffixes ssa/sa and ssä/sä, as keywords, the programme found both the correct local case forms and the wrong ones.

Recenzija. Monografija apie filosofijos ir literatūros giminystę

Directory of Open Access Journals (Sweden)

Tomas Kačerauskas

2011-04-01

Full Text Available Prieš keletą metų neoficialiame pokalbyje J. Baranova prasitarė, kad nėra didesnio malonumo už rašymą. Tiesą sakant, buvau sužavėtas ir priblokštas ne tik dėl šios ištaros asimetrijos R. Barthes’o minčiai apie skaitymo malonumą (net erotinį. Visai kitaip apie rašymą atsiliepia A. Šliogeris (kurio filosofi jos apmąstymui J. Baranova pelnytai skiria daug dėmesio: jis mieliau nerašytų nei rašytų. Tokiais atvejais prisimenu M. Bulgakovą, kuris „tempiąs save už plaukų prie rašomojo stalo“. Rašymas daug kam siejasi su disciplina, prievarta savęs atžvilgiu, geriausiu atveju – kasdieniu įpročiu.

The cointegrated vector autoregressive model with general deterministic terms

DEFF Research Database (Denmark)

Johansen, Søren; Nielsen, Morten Ørregaard

2017-01-01

In the cointegrated vector autoregression (CVAR) literature, deterministic terms have until now been analyzed on a case-by-case, or as-needed basis. We give a comprehensive unified treatment of deterministic terms in the additive model X(t)=Z(t) Y(t), where Z(t) belongs to a large class...... of deterministic regressors and Y(t) is a zero-mean CVAR. We suggest an extended model that can be estimated by reduced rank regression and give a condition for when the additive and extended models are asymptotically equivalent, as well as an algorithm for deriving the additive model parameters from the extended...... model parameters. We derive asymptotic properties of the maximum likelihood estimators and discuss tests for rank and tests on the deterministic terms. In particular, we give conditions under which the estimators are asymptotically (mixed) Gaussian, such that associated tests are X 2 -distributed....

The cointegrated vector autoregressive model with general deterministic terms

DEFF Research Database (Denmark)

Johansen, Søren; Nielsen, Morten Ørregaard

In the cointegrated vector autoregression (CVAR) literature, deterministic terms have until now been analyzed on a case-by-case, or as-needed basis. We give a comprehensive unified treatment of deterministic terms in the additive model X(t)= Z(t) + Y(t), where Z(t) belongs to a large class...... of deterministic regressors and Y(t) is a zero-mean CVAR. We suggest an extended model that can be estimated by reduced rank regression and give a condition for when the additive and extended models are asymptotically equivalent, as well as an algorithm for deriving the additive model parameters from the extended...... model parameters. We derive asymptotic properties of the maximum likelihood estimators and discuss tests for rank and tests on the deterministic terms. In particular, we give conditions under which the estimators are asymptotically (mixed) Gaussian, such that associated tests are khi squared distributed....

Demography of the California spotted owl in the Sierra National Forest and Sequoia/Kings Canyon National Parks

Science.gov (United States)

George N. Steger; Thomas E. Munton; Kenneth D. Johnson; Gary P. Eberlein

2002-01-01

Nine years (1990–1998) of demographic data on California spotted owls (Strix occidentalis occidentalis) in two study areas on the western slopes of the Sierra Nevada—one in the Sierra National Forest (SNF), the other in Sequoia/Kings Canyon National Parks (SNP)—are summarized. Numbers of territorial owls fluctuated from 85 to 50 in SNF and 80 to 58...

The 1996 Survey of Threatened and Endangered Species on Army Lands: A Summary Report.

Science.gov (United States)

1997-12-01

TRISTIS) TOPEKA SHINER C FIS 1 ONCORHYNCHUS CLARKI STOMIAS GREENBACK CUTTHROAT TROUT T FIS 1 OREOMYSTIS (=LOXOPS) MANA CREEPER, HAWAII E BIR 2...PEREGRINE FORSCOM FT CARSON HALIAEETUS EAGLE, BALD T BIR B LEUCOCEPHALUS FORSCOM FT CARSON ONCORHYNCHUS CLARKI GREENBACK CUTTHROAT T FIS 0 STOMIAS TROUT...ONCORHYNCHUS CLARKI GREENBACK CUTTHROAT TROUT T FIS NR STOMIAS FORSCOM FT CARSON SPIRANTHES DILUVIALIS UTE LADIES’-TRESSES T PLA NR FORSCOM -FT CARSON STRIX

Processing and microstructure characterisation of oxide dispersion strengthened Fe–14Cr–0.4Ti–0.25Y2O3 ferritic steels fabricated by spark plasma sintering

International Nuclear Information System (INIS)

Zhang, Hongtao; Huang, Yina; Ning, Huanpo; Williams, Ceri A.; London, Andrew J.; Dawson, Karl; Hong, Zuliang; Gorley, Michael J.; Grovenor, Chris R.M.; Tatlock, Gordon J.; Roberts, Steve G.; Reece, Michael J.; Yan, Haixue; Grant, Patrick S.

2015-01-01

Highlights: • Nanostructured ODS steels were successfully produced by SPS. • Presence of Y 2 Ti 2 O 7 nanoclusters was confirmed by synchrotron XRD and microscopy. • The chemistry of nanoclusters tested by ATP indicated they are Y–Ti–O oxides. - Abstract: Ferritic steels strengthened with Ti–Y–O nanoclusters are leading candidates for fission and fusion reactor components. A Fe–14Cr–0.4Ti + 0.25Y 2 O 3 (14YT) alloy was fabricated by mechanical alloying and subsequently consolidated by spark plasma sintering (SPS). The densification of the 14YT alloys significantly improved with an increase in the sintering temperature. Scanning electron microscopy and electron backscatter diffraction revealed that 14YT SPS-sintered at 1150 °C under 50 MPa for 5 min had a high density (99.6%), a random grain orientation and a bimodal grain size distribution (<500 nm and 1–20 μm). Synchrotron X-ray diffraction patterns showed bcc ferrite, Y 2 Ti 2 O 7 , FeO, and chromium carbides, while transmission electron microscopy and atom probe tomography showed uniformly dispersed Y 2 Ti 2 O 7 nanoclusters of <5 nm diameter and number density of 1.04 × 10 23 m −3 . Due to the very much shorter consolidation times and lower pressures used in SPS compared with the more usual hot isostatic pressing routes, SPS is shown to be a cost-effective technique for oxide dispersion strengthened (ODS) alloy manufacturing with microstructural features consistent with the best-performing ODS alloys

Optimal investment for enhancing social concern about biodiversity conservation: a dynamic approach.

Science.gov (United States)

Lee, Joung Hun; Iwasa, Yoh

2012-11-01

To maintain biodiversity conservation areas, we need to invest in activities, such as monitoring the condition of the ecosystem, preventing illegal exploitation, and removing harmful alien species. These require a constant supply of resources, the level of which is determined by the concern of the society about biodiversity conservation. In this paper, we study the optimal fraction of the resources to invest in activities for enhancing the social concern y(t) by environmental education, museum displays, publications, and media exposure. We search for the strategy that maximizes the time-integral of the quality of the conservation area x(t) with temporal discounting. Analyses based on dynamic programming and Pontryagin's maximum principle show that the optimal control consists of two phases: (1) in the first phase, the social concern level approaches to the final optimal value y(∗), (2) in the second phase, resources are allocated to both activities, and the social concern level is kept constant y(t) = y(∗). If the social concern starts from a low initial level, the optimal path includes a period in which the quality of the conservation area declines temporarily, because all the resources are invested to enhance the social concern. When the support rate increases with the quality of the conservation area itself x(t) as well as with the level of social concern y(t), both variables may increase simultaneously in the second phase. We discuss the implication of the results to good management of biodiversity conservation areas. 2012 Elsevier Inc. All rights reserved

Infrared Imaging and Optical Imaging and Spectroscopy of (mostly) type I Planetary Nebulae II

OpenAIRE

J. Bohigas

2003-01-01

Se presentan datos espectroscópicos, imágenes en las principales líneas ópticas de emisión e imágenes infrarrojas para descubrir la presencia de hidrógeno molecular, de 14 nebulosas planetarias (NPs). Once de estas satisfacen los dos criterios que definen a las NPs de tipo I (ricas en helio con un alto cociente N/O). Todas son clasificadas como bipolares, aunque dos de ellas (A 24 y M3-5) pudieran ser bipolares vistas de frente o elípticas. Hidrógeno molecular chocado está pres...

Planetary Nebulae with H2 Emission

OpenAIRE

Margarita Rosado; Lorena Arias

2003-01-01

Hacemos una revisión de la emisión en hidrogeno molecular (H2) de las nebulosas planetarias (NPs). Vemos como esta emisión se encuentra asociada a objetos de forma bipolar. Describimos los niveles de energía de la molécula de hidrogeno, los principales mecanismos para poblarlos (choques y fluorescencia) y las formas en que se puede discriminar que mecanismo opera. Proponemos que la cinemática del H2 también puede ser usada para discriminar el mecanismo de excitación de sus líneas de emisión. ...

Thermal evolution of the Kramer radiating star

Indian Academy of Sciences (India)

as pressure anisotropy, shear, heat flow and bulk viscosity. The study of .... where m(v) is the Newtonian mass of the star as measured by an observer at infinity. The junction .... Adiabatic index ( = (dp/dρ)) as a function of y(t). of collapse ...

Forenkling av tekniske systemer

DEFF Research Database (Denmark)

Førland-Larsen, Arne; Bramslev, Katharina; Halderaker, Ingrid

De fleste moderne kontorbygg har omfattende tekniske installasjoner. Mange byggeiere opplever at dagens kompliserte tekniske anlegg ikke fungerer som de skal. De ender med å få reklamasjoner, høyt energiforbruk og klager på inneklima. Kan en kraftig forenkling av ventilasjons-, oppvarmings- og...

Macroscopical and microscopical studies of the common bile duct in reindeer (Rangifer tarandus tarandus L

Directory of Open Access Journals (Sweden)

Timo Rahko

1990-08-01

Full Text Available The histological structure and secretory function of the common bile duct (ductus hepaticus communis has not been previously described in reindeer. Macroscopical studies were thus performed in 25 reindeer to reveal the morphology and topography of the ductus hepaticus communis and adjoining organs. Histologic structure of the common bile duct was investigated in 20 animals. Our studies showed that the ductus hepaticus communis and pancreaticus join about 2 cm before the duodenal opening to form the common duct. The common bile duct is an elastic tube about 3 to 5 cm long and 2 to 3 mm thick partly surrounded by fat and pancreatic tissues. The wall of the duct, being about 1 mm thick by light microscopy, consisted of folded mucosa surrounded by connective tissue fibres and a serosal layer. Distally, also muscular bands were seen. In some areas separate leucocytes and even lymphatic nodules were present. Surprisingly pancreatic acini occurred in certain areas of the wall, even in close contact to subepithelial tissues. Mucosal epithelium consisted of surface and glandular epithelial cells with mucous secretion. Numerous intraepithelial globule leucocytes were identifiable within the lamina epithelialis.Tutkimus yhteisen sappikäytävän rakenteesta porolla.Abstract in Finnish / Yhteenveto: Yhteisen sappikäytävän (ductus hepaticus communis histologista rakennetta ja eritystoimintaa ei ole aikaisemmin kuvattu porolla. Makroskooppisia tutkimuksia suoritettiin 25 porolla yhteisen sappikäytävän rakenteen ja topografian selvittämiseksi. Seinämän histologinen rakenne selvitettiin 20 porolla. Tutkimukset osoittivat, että porolla ductus hepaticus communis ja ductus pancreaticus yhtyvät noin 2 cm ennen ohutsuolta muodostaakseen yhteisen tiehyeen. Ductus hepaticus communis on noin 3-5 cm pitkä ja 2-3 mm:n läpimittainen käytävä. Se on elastinen ja osit-tain rasva- ja haimakudoksen ympäröimä. Seinämä on mikroskooppisesti noin 1 mm paksu

Populações estelares do bojo galáctico

Science.gov (United States)

Escudero, A. V.; Costa, R. D. D.; Maciel, W. J.

2003-08-01

Os estudos mais recentes do bojo galáctico têm enfocado essencialmente as abundâncias químicas de elementos pesados, como o ferro, obtidos a partir das estrelas nas regiões centrais da galáxia. Elementos leves, como hélio, nitrogênio, oxigênio e argônio ainda são pouco estudados nestas regiões, devido à difícil determinação de suas abundâncias a partir de estrelas. Nestas condições as nebulosas planetárias desempenham um importante papel, pois permitem a determinação de abundâncias destes elementos usando técnicas de espectroscopia nebular. Neste trabalho, reportamos a análise das abundâncias químicas de uma nova amostra de nebulosas planetárias do bojo, bem como os resultados preliminares de um código numérico destinado a modelar a evolução química desta região. Usamos como vínculos observacionais os resultados obtidos das nebulosas planetárias, bem como de abundâncias estelares da região do bojo, obtidas da literatura. A partir deste modelo da evolução química e dos vínculos observacionais foi possível fazer um diagnóstico mais preciso das populações que constituem o bojo galáctico. O estudo destas populações que compõem a região central de nossa galáxia é de extrema importância para o maior entendimento da evolução química e dinâmica da galáxia como um todo. Por isto, verificamos a importância dos modelos de formação simples e mista utilizados para explicar características da população da região central da galáxia. Algumas destas características são: uma grande dispersão nos valores das abundâncias químicas e um grande espalhamento nas correlações entre as abundâcias de nitrogênio e oxigênio. Estas peculiaridades são dificilmente reproduzidas por modelos de formação simples, e portanto são importantes indícios da validade dos modelos de formação mista, tais como um rápido colapso do bojo seguido de uma evolução secular. (FAPESP, CNPq)

pyXSIM: Synthetic X-ray observations generator

Science.gov (United States)

ZuHone, John A.; Hallman, Eric. J.

2016-08-01

pyXSIM simulates X-ray observations from astrophysical sources. X-rays probe the high-energy universe, from hot galaxy clusters to compact objects such as neutron stars and black holes and many interesting sources in between. pyXSIM generates synthetic X-ray observations of these sources from a wide variety of models, whether from grid-based simulation codes such as FLASH (ascl:1010.082), Enzo (ascl:1010.072), and Athena (ascl:1010.014), to particle-based codes such as Gadget (ascl:0003.001) and AREPO, and even from datasets that have been created “by hand”, such as from NumPy arrays. pyXSIM can also manipulate the synthetic observations it produces in various ways and export the simulated X-ray events to other software packages to simulate the end products of specific X-ray observatories. pyXSIM is an implementation of the PHOX (ascl:1112.004) algorithm and was initially the photon_simulator analysis module in yt (ascl:1011.022); it is dependent on yt.

Theoretical analysis of non-Gaussian heterogeneity effects on subsurface flow and transport

Science.gov (United States)

Riva, Monica; Guadagnini, Alberto; Neuman, Shlomo P.

2017-04-01

Much of the stochastic groundwater literature is devoted to the analysis of flow and transport in Gaussian or multi-Gaussian log hydraulic conductivity (or transmissivity) fields, Y(x)=ln\\func K(x) (x being a position vector), characterized by one or (less frequently) a multiplicity of spatial correlation scales. Yet Y and many other variables and their (spatial or temporal) increments, ΔY, are known to be generally non-Gaussian. One common manifestation of non-Gaussianity is that whereas frequency distributions of Y often exhibit mild peaks and light tails, those of increments ΔY are generally symmetric with peaks that grow sharper, and tails that become heavier, as separation scale or lag between pairs of Y values decreases. A statistical model that captures these disparate, scale-dependent distributions of Y and ΔY in a unified and consistent manner has been recently proposed by us. This new "generalized sub-Gaussian (GSG)" model has the form Y(x)=U(x)G(x) where G(x) is (generally, but not necessarily) a multiscale Gaussian random field and U(x) is a nonnegative subordinator independent of G. The purpose of this paper is to explore analytically, in an elementary manner, lead-order effects that non-Gaussian heterogeneity described by the GSG model have on the stochastic description of flow and transport. Recognizing that perturbation expansion of hydraulic conductivity K=eY diverges when Y is sub-Gaussian, we render the expansion convergent by truncating Y's domain of definition. We then demonstrate theoretically and illustrate by way of numerical examples that, as the domain of truncation expands, (a) the variance of truncated Y (denoted by Yt) approaches that of Y and (b) the pdf (and thereby moments) of Yt increments approach those of Y increments and, as a consequence, the variogram of Yt approaches that of Y. This in turn guarantees that perturbing Kt=etY to second order in σYt (the standard deviation of Yt) yields results which approach those we obtain

Plastid DNA analysis reveals cryptic hybridization in invasive dalmatian toadflax populations

Science.gov (United States)

Andrew Boswell; Sharlene E. Sing; Sarah M. Ward

2016-01-01

Gene flow between Dalmatian toadflax (DT) and yellow toadflax (YT), both aggressive invaders throughout the Intermountain West, is creating hybrid populations potentially more invasive than either parent species. To determine the direction of gene flow in these hybrid populations, species-diagnostic cytoplasmic markers were developed. Markers were based on...

The effectiveness of different instruction methods for risk and safety management in relation to medical profession and seniority

NARCIS (Netherlands)

Navot Pikkel, Dvora

2017-01-01

The study, which was guided by Prof.dr J.b. Rijsman as promotor and by Dr. Y.T. Tal as co- promotor, was a comparative interventional study that was designed to evaluate the effectiveness of different teaching & educational strategies of risk management and patient's safety in medicine. Eventually,

The Ecology of the Ural Owl at South-Western Border of Its Distribution (Slovenia

Directory of Open Access Journals (Sweden)

Al Vrezec

2016-04-01

Full Text Available In Slovenia the Ural Owl (Strix uralensis is on its south-western limit of distribution and belongs to the southern subspecies Strix uralensis macroura. Dark coloured owls are characteristic for this subspecies and represent between 5 to 15% of the population. Slovenian breeding population size is estimated at 400 to 700 pairs. The densities of territories ranges between 0.9 to 13.4 territories per 10 km2, and the highest are reached in mountain forests of southern Dinaric region. In the forests with dominant deciduous trees, e.g. Beech (Fagus sylvatica and Pedinculate Oak (Quercus robur, the breeding densities are significantly higher than in the forests with higher proportion of coniferous trees, e.g. Norway Spruce (Picea abies. The species does not select specific altitude and throughout Slovenia it occurs between 150 and 1600 m a.s.l.  The most of the nest found at natural nest-sites were in tree holes or semi-holes (56% and at the tree stumps (20%. Nest boxes were occupied less frequently in Slovenia with occupancy rate of 29%. At least in mountain regions breeding begins quite late, between 15 March to 21 June. Average clutch size is 3.3 ± 1.0 eggs per nest. About 80% of all nests are successful raising at least one young. The diet shifts significantly between breeding and non-breeding period due to the seasonality in prey availability. According to the biomass the most important prey in breeding period are mice (Muridae, voles (Arvicollidae and mole (Talpa europaea, but in the non-breeding period voles and dormice (Gliridae predominate. Large Fat Dormouse (Glis glis seems to have very important role in the post-breeding period, but not in the breeding period due to its dormancy. As a large forest-dwelling predator the Ural Owl shapes the raptor community in the forest by excluding mezopredator species, as Tawny Owl (Strix aluco, what allows smaller raptors, e.g. Boreal Owl (Aegolius funereus to expend their ranges to lower elevations

A block Krylov subspace time-exact solution method for linear ordinary differential equation systems

NARCIS (Netherlands)

Bochev, Mikhail A.

2013-01-01

We propose a time-exact Krylov-subspace-based method for solving linear ordinary differential equation systems of the form $y'=-Ay+g(t)$ and $y"=-Ay+g(t)$, where $y(t)$ is the unknown function. The method consists of two stages. The first stage is an accurate piecewise polynomial approximation of

Yoga Therapy for Abdominal Pain-Related Functional Gastrointestinal Disorders in Children: A Randomized Controlled Trial

NARCIS (Netherlands)

Korterink, Judith J.; Ockeloen, Lize E.; Hilbink, Mirrian; Benninga, Marc A.; Deckers-Kocken, Judith M.

2016-01-01

The aim of the present study was to compare effects of 10 weeks of yoga therapy (YT) and standard medical care (SMC) on abdominal pain and quality of life (QoL) in children with abdominal pain-related functional gastrointestinal disorders (AP-FGIDs). Sixty-nine patients, ages 8 to 18 years, with

Composting of food and yard wastes by locally isolated fungal strains

African Journals Online (AJOL)

GREGORY

2011-12-16

Dec 16, 2011 ... 74% total organic matter (TOM), 7.2 pH and 132% germination index (GI) further showed the potentials of the produced compost. Based on this, food waste (FW) and yard trimmings (YT) showed an economic potential for sustainable production of compost using low technology. Key words: Lignocellulolytic ...

Barred Owl Habitat and Prey: A Review and Synthesis of the Literature

OpenAIRE

Livezey, Kent B.

2007-01-01

Barred Owls (Strix varia) historically inhabited the forests of eastern North America. During the last century, they expanded their range to include forests throughout the southern provinces of Canada, southeastern Alaska, British Columbia, Washington, Oregon, and northern California. To date, there has been no synthesis of the varied habitats or prey used by Barred Owls in their expanded range. Here I review and synthesize studies concerning habitat (N  =  114) and prey (N  =  43) of Barred ...

La pianificazione degli spazi rurali nell’area metropolitana di Napoli: una sfida impossibile?

Directory of Open Access Journals (Sweden)

Biagio Cillo

2013-07-01

Full Text Available Nell’area metropolitana di Napoli le aree agricole periurbane si presentano frequentemente nella forma di aree intercluse all’interno di conurbazioni a forma di nebulosa, per le quali  non esiste interesse alla coltivazione, a causa della maggiore convenienza economica della loro trasformazione in aree edificate. Tale processo è incentivato dal controllo del territorio esercitato dalla malavita organizzata capace di indirizzare i processi di urbanizzazione. Per conservare queste aree nella condizione di spazi aperti in grado di riequilibrare le condizioni ambientali delle aree urbanizzate e di assicurare un buon livello qualità al paesaggio metropolitano, è necessario riconquistare il loro controllo attraverso molteplici azioni.

Kuntoutusta oppimassa, käytännöstä teoriaan

OpenAIRE

Similä, Markku

2010-01-01

Opinnäytetyön tavoitteena oli kehittää Kainuun ammattiopisto - liikelaitoksen tarpeisiin ammatillisen kuntoutuksen täydennyskoulutus. Tarve koulutuksen järjestämiseen tuli keväällä 2009 Kainuun alueella toimivalta Kumppaniksi ry:ltä. Täydennyskoulutuksen tavoitteena oli lisätä Kumppaniksi ry:n henkilökunnan osaamista ammatillisen kuntoutuksen käsitteistä ja toimintatavoista. Opiskelijaryhmä oli Kumppaniksi ry:n työntekijöitä. Opiskelijaryhmä koostui monen eri ammatin osaajista. Yhteistä ...

Superhero Comics and the Popular Geopolitics of American Identity

OpenAIRE

MIETTINEN, MERVI

2011-01-01

Englantilaisen filologian oppialaan kuuluvassa lisensiaatintutkielmassani erittelen ja analysoin supersankarisarjakuvien roolia Yhdysvaltojen populaarisen geopoliittisen identiteetin rakentumisessa. Tutkimuksessani keskityn etenkin siihen, miten supersankarisarjakuvien kautta muodostuva populaari kansallinen identiteetti tarkemmin analysoituna paljastaa useita ristiriitoja supersankarin edustamien kansallisten ihanteiden ja hahmon käytännön toimien välillä. Yhdeksi keskeisimmistä ristiriidois...

The Dickey-Fuller test for exponential random walks

NARCIS (Netherlands)

Davies, P.L.; Krämer, W.

2003-01-01

A common test in econometrics is the Dickey–Fuller test, which is based on the test statistic . We investigate the behavior of the test statistic if the data yt are given by an exponential random walk exp(Zt) where Zt = Zt-1 + [sigma][epsilon]t and the [epsilon]t are independent and identically

Determination of antidepressant activity of Cyperus rotundus L ...

African Journals Online (AJOL)

Tropical Journal of Pharmaceutical Research April 2017; 16 (4): 867-871 ... 1Shandong University School of Medicine, Jinan, 250012, 2Department of Psychology, People's Hospital of Linyi City, Linyi,. 276003 ..... Academic Press, 1977: 692-698. 8. Porsolt RD, Bertin A ... Lim DW, Jung JW, Park JH, Baek NI, Kim YT, Kim IH,.

Journal of Applied Sciences and Environmental Management - Vol ...

African Journals Online (AJOL)

Some physico-chemical and biological characteristics of soil and water samples of part of the Niger Delta area, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. YT Puyate, A Rim-Rukeh. http://dx.doi.org/10.4314/jasem.v12i2.55551 ...

East African Medical Journal

African Journals Online (AJOL)

2002-07-01

Jul 1, 2002 ... PREVALENCE OF VITAMIN A DEFICIENCY AMONG PRE-SCHOOL AND SCHOOL-AGED CHILDREN IN ARSSI ZONE. ETHIOPIA. YT Asrat, BSc. MSc ... in the “low” range (<20ttl/dl) in 51% of the children. Conclusion: The results ... of Arssi zone Dodotana Sire district was selected at random for this study.

Development of a New Class of Drugs to Inhibit All Forms of Androgen Receptor in Castration Resistant Prostate Cancers

Science.gov (United States)

2016-10-01

titration methods (protein in the syringe, ligand in the cell), we were able to obtain a reproducible thermogram for the ligand binding reaction...to VPC-14449 as a model drug to assist on other related projects. 1. Tam, K., Dalal, K., Hsing, M., Cheng, C.W., Chiang, Y.T., Sharma, A., Peacock

Assessing the sources of the fishing down marine food web process in the Argentinean-Uruguayan Common Fishing Zone

Directory of Open Access Journals (Sweden)

Andrés J. Jaureguizar

2008-03-01

Full Text Available The temporal trend in the mean trophic level (mTL, fisheries-in-balance index (FIB, trophic categories landing (TrC and landing profile (LP of the exploited marine community (82 species in the Argentinean-Uruguayan Common Fishing Zone (AUCFZ were examined from 1989 to 2003. The total landings (Yt (rs=-0.561; P< 0.05 and the Yt of carnivores and top predators has declined, while the Yt of herbivores, detritivores and omnivores has increased. Consequently, the mTL significantly decreased (rs =-0.88; P< 0.01 at a rate of 0.41 from 1991 (mTL =3.81 to 2003 (mTL =3.4, and the FIB index has declined in the last 6 years. The LP temporal pattern showed four periods with significant differences in their species composition and Primary Production Required, which shows a strong decline in the traditional fishery resources (i.e. Merluccius hubbsi, Micropogonias furnieri, and increases in crustacean (Chaceon notilis, molluscs (Zygochlamys patagonica and some fishes (Macrodon ancylodon, Macruronus magallanicus, Rajidae. The mTL trend reflects the changes in the AUCFZ landing structure. This was characterized by large, slow-growing and late-maturing species during the early 1990s, while during recent years, early 2000s, it was mainly characterized by medium-sized fishes, crustaceans and molluscs. The examination of the mTL, FBI, TrC trajectories and LP temporal pattern suggests that new fishery resources are developing or that the fishing effort has been redistributed from overexploited resources to lightly exploited resources. In addition, the examination of discriminator and common species, and the fact that traditional resources are being over-fished support the hypothesis that the mTL trend has been influenced more by the impacts of new fishing technologies than the changes in market-driven exploitation and environmental fluctuation. These results provide evidence of the fishing down process along AUCFZ.

Soil Salt Distribution and Tomato Response to Saline Water Irrigation under Straw Mulching.

Directory of Open Access Journals (Sweden)

Yaming Zhai

Full Text Available To investigate better saline water irrigation scheme for tomatoes that scheduling with the compromise among yield (Yt, quality, irrigation water use efficiency (IWUE and soil salt residual, an experiment with three irrigation quotas and three salinities of irrigation water was conducted under straw mulching in northern China. The irrigation quota levels were 280 mm (W1, 320 mm (W2 and 360 mm (W3, and the salinity levels were 1.0 dS/m (F, 3.0 dS/m (S1 and 5.0 dS/m (S2. Compared to freshwater, saline water irrigations decreased the maximum leaf area index (LAIm of tomatoes, and the LAIm presented a decline tendency with higher salinity and lower irrigation quota. The best overall quality of tomato was obtained by S2W1, with the comprehensive quality index of 3.61. A higher salinity and lower irrigation quota resulted in a decrease of individual fruit weight and an increase of the blossom-end rot incidence, finally led to a reduction in the tomato Yt and marketable yield (Ym. After one growth season of tomato, the mass fraction of soil salt in plough layer under S2W1 treatment was the highest, and which presented a decline trend with an increasing irrigation quota. Moreover, compared to W1, soil salts had a tendency to move to the deeper soil layer when using W2 and W3 irrigation quota. According to the calculation results of projection pursuit model, S1W3 was the optimal treatment that possessed the best comprehensive benefit (tomato overall quality, Yt, Ym, IWUE and soil salt residual, and was recommended as the saline water irrigation scheme for tomatoes in northern China.

Soil Salt Distribution and Tomato Response to Saline Water Irrigation under Straw Mulching.

Science.gov (United States)

Zhai, Yaming; Yang, Qian; Wu, Yunyu

2016-01-01

To investigate better saline water irrigation scheme for tomatoes that scheduling with the compromise among yield (Yt), quality, irrigation water use efficiency (IWUE) and soil salt residual, an experiment with three irrigation quotas and three salinities of irrigation water was conducted under straw mulching in northern China. The irrigation quota levels were 280 mm (W1), 320 mm (W2) and 360 mm (W3), and the salinity levels were 1.0 dS/m (F), 3.0 dS/m (S1) and 5.0 dS/m (S2). Compared to freshwater, saline water irrigations decreased the maximum leaf area index (LAIm) of tomatoes, and the LAIm presented a decline tendency with higher salinity and lower irrigation quota. The best overall quality of tomato was obtained by S2W1, with the comprehensive quality index of 3.61. A higher salinity and lower irrigation quota resulted in a decrease of individual fruit weight and an increase of the blossom-end rot incidence, finally led to a reduction in the tomato Yt and marketable yield (Ym). After one growth season of tomato, the mass fraction of soil salt in plough layer under S2W1 treatment was the highest, and which presented a decline trend with an increasing irrigation quota. Moreover, compared to W1, soil salts had a tendency to move to the deeper soil layer when using W2 and W3 irrigation quota. According to the calculation results of projection pursuit model, S1W3 was the optimal treatment that possessed the best comprehensive benefit (tomato overall quality, Yt, Ym, IWUE and soil salt residual), and was recommended as the saline water irrigation scheme for tomatoes in northern China.

Development of tungsten coatings for the corrosion protection of alumina-based ceramics

International Nuclear Information System (INIS)

Arons, R.M.; Dusek, J.T.; Hafstrom, J.W.

1979-01-01

A means of applying tungsten coatings to an alumina based ceramic is described. A slurry of pure tungsten was prepared and applied by brush coating or slip casting on the alumina-3 wt % Yt small crucible. The composite was fired and a very dense ceramic crucible with a crack free tungsten coating was produced

Report of Accomplishments under the Airport Improvement Program.

Science.gov (United States)

1983-09-30

0) RUNLWAYMLhy>, FRIEDMAN MEMORIA :. ACCESLS WAY :fHppjV’EMO;:tr, * (COMMERCIAL, HAIILEY U.. 43t, 1% ISCELLAINiAUS SA!L: :v -YT;;:- FRIEDMAN MEMORIA ...airport no. funds Description of work K= 5 0 I S (CONTINUED) CHAMPAIGN/ URBANA 02 $ 423,364 TAXIWAY IMPROVEMEN’:’S; A’WVESS WAY UNIVERSITY OF CONSTRUCTION

Journal of Applied Sciences and Environmental Management - Vol ...

African Journals Online (AJOL)

Variability with depth of some physico-chemical and biological parameters of Atlantic Ocean water in part of the coastal area of Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. YT Puyate, A Rim-Rukeh. http://dx.doi.org/10.4314/jasem.v12i1.55578 ...

Remote Patient Management in a Mammographic Screening Environment in Underserved Areas

Science.gov (United States)

2005-09-01

of 4,945 paired examinations. Radiology 2001; 218:873-880. 10. Malich A, Marx C, Facius M, Boehm T, Fleck M, Kaiser WA. Tumour 24. Venta LA, Hendrick...218:873-880. KF, Sickles EA. Mammographic character- factor determining the quality of com- 15. Venta LA, Hendrick RE, Adler YT, et al. iSicks of 115

Measurement of the top-Yukawa coupling and the search for ttH production

CERN Document Server

Vasquez, Jared; The ATLAS collaboration

2015-01-01

To test whether the observed Higgs boson follows the predictions of the SM, careful study and measurement of its properties are necessary. Due to the top quark's large mass, a measurement of the top-Yukawa coupling (Y_t) is paramount to an understanding of EWSB and could provide a viable probe for new physics. While most production processes provide only an indirect measurement of Y_t via loop effects, the ttH and tH production allow for a direct tree-level measurement of the coupling strength (which could differ due to new physics contamination). The ttH process is probed through various Higgs decay channels with several advantages. The H->bb channel allows for a coupling measurement of both 3rd generation quarks while profiting from the largest Higgs branching ratio. The h->γγ channel has a much smaller branching ratio but benefits from a fine diphoton mass resolution. The process is also probed in the multilepton channel, which is targeted at the off-shell Higgs coupling of H->WW* and H->ZZ* as well as t...

Influence of grade on the reliability of corroding pipelines

International Nuclear Information System (INIS)

Maes, M.A.; Dann, M.; Salama, M.M.

2008-01-01

This paper focuses on a comparative analysis of the reliability associated with the evolution of corrosion between normal and high-strength pipe material. The use of high strength steel grades such as X100 and X120 for high pressure gas pipeline in the arctic is currently being considered. To achieve this objective, a time-dependent reliability analysis using variable Y/T ratios in a multiaxial finite strain analysis of thin-walled pipeline is performed. This analysis allows for the consideration of longitudinal grooves and the presence of companion axial tension and bending loads. Limit states models are developed based on suitable strain hardening models for the ultimate behavior of corroded medium and high strength pipeline material. In an application, the evolution of corrosion is modeled in pipelines of different grades that have been subjected to an internal corrosion inspection after a specified time which allows for a Bayesian updating of long-term corrosion estimates and, hence, the derivation of annual probabilities of failure as a function of time. The effect of grade and Y/T is clearly demonstrated

Genetic differentiation of Octopus minor (Mollusca, Cephalopoda) off the northern coast of China as revealed by amplified fragment length polymorphisms.

Science.gov (United States)

Yang, J M; Sun, G H; Zheng, X D; Ren, L H; Wang, W J; Li, G R; Sun, B C

2015-12-02

Octopus minor (Sasaki, 1920) is an economically important cephalopod that is found in the northern coastal waters of China. In this study, we investigated genetic differentiation in fishery populations using amplified fragment length polymorphisms (AFLPs). A total of 150 individuals were collected from five locations: Dalian (DL), Yan-tai (YT), Qingdao (QD), Lianyungang (LY), and Zhoushan (ZS), and 243 reproducible bands were amplified using five AFLP primer combinations. The percentage of polymorphic bands ranged from 53.33 to 76.08%. Nei's genetic identity ranged from 0.9139 to 0.9713, and the genetic distance ranged from 0.0291 to 0.0900. A phylogenetic tree was constructed using the unweighted pair group method with arithmetic mean, based on the genetic distance. The DL and YT populations originated from one clade, while the QD, LY, and ZS populations originated from another. The results indicate that the O. minor stock consisted of two genetic populations with an overall significantly analogous FST value (0.1088, P octopus fisheries, so that this marine resource can be conserved for its long-term utilization.

Measurement of the charge asymmetry in highly boosted top-quark pair production in s=8 TeV pp collision data collected by the ATLAS experiment

Directory of Open Access Journals (Sweden)

G. Aad

2016-05-01

Full Text Available In the pp→tt¯ process the angular distributions of top and anti-top quarks are expected to present a subtle difference, which could be enhanced by processes not included in the Standard Model. This Letter presents a measurement of the charge asymmetry in events where the top-quark pair is produced with a large invariant mass. The analysis is performed on 20.3 fb−1 of pp collision data at s=8TeV collected by the ATLAS experiment at the LHC, using reconstruction techniques specifically designed for the decay topology of highly boosted top quarks. The charge asymmetry in a fiducial region with large invariant mass of the top-quark pair (mtt¯>0.75 TeV and an absolute rapidity difference of the top and anti-top quark candidates within −2<|yt|−|yt¯|<2 is measured to be 4.2±3.2%, in agreement with the Standard Model prediction at next-to-leading order. A differential measurement in three tt¯ mass bins is also presented.

Rare earth oxyhydrides and preparation process

International Nuclear Information System (INIS)

Diaz, H.

1986-01-01

Rare earth oxyhydrides of formula RE 1-q Th q Ni 5-p M p O x H y are claimed. RE is a rare earth, Th can be replaced by Yt, M is Cu, Mn, Al, Fe, Cr or Co, o O C and the hydrides are oxidized. They are catalysts for various chemical reactions [fr

Deconvoluting preferences and errors: a model for binomial panel data

DEFF Research Database (Denmark)

Fosgerau, Mogens; Nielsen, Søren Feodor

2010-01-01

In many stated choice experiments researchers observe the random variables Vt, Xt, and Yt = 1{U + δxs22A4Xt + εt

Improvements in medium range weather forecasting system of India

Indian Academy of Sciences (India)

system is based on the latest Grid Statistical Interpolation (GSI) scheme and it has the provision to use most of .... ified Simplified-Arakawa Scheme (SAS) (Han and. Pan 2010). ..... Kim Y-J and Arakawa A 1995 Improvement of orographic gravity wave ... Yang F, Mitchell K, Hou Y-T, Dai Y, Deng X, Wang Z and. Liang X-Z ...

Abundâncias espectroscópicas de simbióticas amarelas

Science.gov (United States)

Calbo, S. R.; Costa, R. D. D.

2003-08-01

Este trabalho consiste no estudo de uma amostra de estrelas simbióticas amarelas cujas componentes frias apresentam tipos espectrais G ou K. Uma amostra de 20 estrelas foi usada, o que corresponde ao conjunto completo de estrelas simbióticas amarelas visíveis no hemisfério sul presentes no catálogo de Belczynski et al (2000 A&A Suppl. 146, 407). Os espectros estelares foram obtidos por observações usando os telescópios de 1,6 m do LNA e 1,52 m do ESO e os dados fornecidos pelo satélite IUE (International Ultraviolet Explorer) e posteriormente reduzidos no IAG. Os fluxos das linhas medidas de cada espectro foram calibrados em fluxo (com as correções de avermelhamento baseados no trabalho de Pacheco e Costa 1992, A&A 257, 619), e os parâmetros físicos (temperatura e densidade eletrônica) das nebulosas que envolvem os sistemas simbióticos determinados, usando-se fluxos medidos de OIII e NII da parte visível do espectro. Para a determinação das razões de abundâncias de C/N e O/N aplicou-se o método de Nussbaumer et al. (1988, A&A 198, 179). As razões de abundâncias foram derivadas das linhas de emissão (NIV, CIV, OIII, NIII e CIII) dos espectros IUE. Numa última fase plotou-se o diagrama C/N-O/N onde comparou-se a abundância química das simbióticas amarelas obtidas neste trabalho com as de gigantes normais. Os resultados mostram abundâncias compatíveis com aquelas derivadas para nebulosas planetárias do bojo, indicando que o material nebular é originado das gigantes vermelhas de cada sistema, e não da fonte quente. (FAPESP, CNPq)

Wiedemann

Directory of Open Access Journals (Sweden)

Lorenzo Jaramillo

1985-10-01

Full Text Available Al mirar la obra de Guillermo Wiedemann lo que de entrada sorprende es la dificultad, si no imposibilidad de compararlo con otros pintores en Colombia. Wiedemann llega a nuestro país a la edad de 34 años y poco conocemos de su vida pasada. Al morir en 1969 deja una obra trunca en un momento de transición, interrumpiéndose un proceso que apenas comenzaba. Estos dos hechos enmarcan su obra en una nebulosa gris, en una especie de limbo. Ante la imposibilidad de juzgar a un artista independientemente de toda comparación, se impone encontrar algunos puntos que permitan reflexionar sobre la obra de nuestro pintor.

Modeling co-occurrence of northern spotted and barred owls: accounting for detection probability differences

Science.gov (United States)

Bailey, Larissa L.; Reid, Janice A.; Forsman, Eric D.; Nichols, James D.

2009-01-01

Barred owls (Strix varia) have recently expanded their range and now encompass the entire range of the northern spotted owl (Strix occidentalis caurina). This expansion has led to two important issues of concern for management of northern spotted owls: (1) possible competitive interactions between the two species that could contribute to population declines of northern spotted owls, and (2) possible changes in vocalization behavior and detection probabilities of northern spotted owls induced by presence of barred owls. We used a two-species occupancy model to investigate whether there was evidence of competitive exclusion between the two species at study locations in Oregon, USA. We simultaneously estimated detection probabilities for both species and determined if the presence of one species influenced the detection of the other species. Model selection results and associated parameter estimates provided no evidence that barred owls excluded spotted owls from territories. We found strong evidence that detection probabilities differed for the two species, with higher probabilities for northern spotted owls that are the object of current surveys. Non-detection of barred owls is very common in surveys for northern spotted owls, and detection of both owl species was negatively influenced by the presence of the congeneric species. Our results suggest that analyses directed at hypotheses of barred owl effects on demographic or occupancy vital rates of northern spotted owls need to deal adequately with imperfect and variable detection probabilities for both species.

Numerical Electromagnetic Code (NEC)-Basic Scattering Code. Part 2. Code Manual

Science.gov (United States)

1979-09-01

imaging of source axes for magnetic source. Ax R VSOURC(1,1) + 9 VSOURC(1,2) + T VSOURC(1,3) 4pi = x VIMAG(I,1) + ^ VINAG (1,2)+ VIMAG(l,3) An =unit...VNC A. yt and z components of the end cap unit normal OUTPUT VARIABLE VINAG X.. Y, and z components defining thesource image coordinate system axesin

Genetic diversity and germplasm resource research on tung tree ...

African Journals Online (AJOL)

SERVER

2008-04-17

Apr 17, 2008 ... a 2720 Thermal Cycler under the following cycle profile: 5 min at. 94oC ; followed by 45 cycles of 45 s at 94oC , 1 min at annealing temperature (Ta, depend on primers used, Table 2), .... chrome b5 to Either Endoplasmic Reticulum or Mitochondria. Plant. Cell. 16: 3002-3019. Henderson MP, Hwang YT, ...

Adomian decomposition method for nonlinear Sturm-Liouville problems

Directory of Open Access Journals (Sweden)

Sennur Somali

2007-09-01

Full Text Available In this paper the Adomian decomposition method is applied to the nonlinear Sturm-Liouville problem-y" + y(tp=λy(t, y(t > 0, t ∈ I = (0, 1, y(0 = y(1 = 0, where p > 1 is a constant and λ > 0 is an eigenvalue parameter. Also, the eigenvalues and the behavior of eigenfuctions of the problem are demonstrated.

ZASTOSOWANIE FUNKCJONAŁU HU-WASHIZU W PLASTYCZNEJ ANALIZIE MES PŁYT GRUBYCH

Directory of Open Access Journals (Sweden)

Jakub LEWANDOWSKI

2016-07-01

Full Text Available W pracy sformułowano oryginalny, autorski funkcjonał dla zagadnień teorii plastyczności. Podstawą był funkcjonał Hu-Washizu z teorii sprężystości. Przyrostowa postać funkcjonału pozwala w prosty sposób budować algorytmy MES. Zastosowanie funkcjonału przedstawiono na przykładzie płyty grubej. Zastosowano model warstwowy aby uwzględnić częściowe uplastycznienie przekroju płyty. Algorytm MES dla płyty grubej zbudowano w oparciu o trójkątny trzy węzłowy element skończony z liniowymi funkcjami kształtu dla wszystkich przemieszczeń uogólnionych. Naprężenia i odkształcenia w tego typu elemencie przyjmuje się jako stałe. Przedstawiony algorytm nie wymaga żadnych dodatkowych równań teorii plastyczności i jest równoważny stowarzyszonemu prawu płynięcia plastycznego. Algorytm prowadzi do nieliniowego, przyrostowego układu równań algebraicznych, który rozwiązuje się metodą Newtona. Kilka prostych przykładów pozytywnie weryfikuje przyjęte założenia i stosowane algorytmy.

Affiliate-markkinoinnin käytäntöjä ja haasteita

OpenAIRE

Rakkolainen, Oleg

2016-01-01

Jatkuvasti yhä enemmän digitalisoituvassa maailmassa yritykset etsivät parasta vastinetta markkinointibudjetilleen digitaalisista medioista. Affiliate-markkinointi tarjoaakin mainostajille vastinetta rahoilleen tulospohjaisella muodollaan; mitä enemmän tulosta kumppani, julkaisija, tuottaa, sitä suuremman palkkion hän saa. Affiliate-markkinoinnissa välikätenä toimivat usein affiliate-verkosto, jotka saattavat julkaisijat ja mainostajat tarjoamalla omia alustojaan kummankin osapuolen käyttöön....

Sydänmerkki-aterian käytön laajentaminen Vaasan ruokapalveluissa

OpenAIRE

Ylä-Häkkinen, Terhi

2013-01-01

Jokainen ihminen nauttii eläkeikään mennessä noin 15500 ateriaa työaikana (Suomen Sydänliitto ry), joten ei ole samantekevää, millaisia ne ovat. Joukkoruokailu voi osaltaan ehkäistä kansansairauksia valmistamalla sydänystävällisiä aterioita. Sydänmerkki-ateria sisältää oikean määrän suolaa, hyviä pehmeitä rasvoja, vähän kovia rasvoja sekä paljon kuitua. Se sisältää lisäkkeinä vähäsuolaista ja runsaskuituista leipää, kasvimargariinia, rasvatonta maitoa tai piimää, salaattia ja salaatinkastiket...

Derivation and analysis of the Feynman-alpha formula for deterministically pulsed sources

International Nuclear Information System (INIS)

Wright, J.; Pazsit, I.

2004-03-01

The purpose or this report is to give a detailed description of the calculation of the Feynman-alpha formula with deterministically pulsed sources. In contrast to previous calculations, Laplace transform and complex function methods are used to arrive at a compact solution in form of a Fourier series-like expansion. The advantage of this method is that it is capable to treat various pulse shapes. In particular, in addition to square- and Dirac delta pulses, a more realistic Gauss-shaped pulse is also considered here. The final solution of the modified variance-to-mean, that is the Feynman Y(t) function, can be quantitatively evaluated fast and with little computational effort. The analytical solutions obtained are then analysed quantitatively. The behaviour of the number or neutrons in the system is investigated in detail, together with the transient that follows the switching on of the source. An analysis of the behaviour of the Feynman Y(t) function was made with respect to the pulse width and repetition frequency. Lastly, the possibility of using me formulae for the extraction of the parameter alpha from a simulated measurement is also investigated

Yhdessä oleminen, toimiminen ja yhteyden tunteminen: Perheen kokemus lapsen syntymisestä kotona

OpenAIRE

Jouhki, Maija-Riitta

2017-01-01

Suomessa muutamat kymmenet naiset valitsevat vuosittain lapsensa syntymäpaikaksi oman kotinsa. Kotisynnytys ei kuulu Suomessa julkisen terveydenhuollon palveluihin, jotka ovat kaikille ilmaisia ja tulostensa perusteella tarkasteltuna laadukkaita. Palvelut eivät kuitenkaan näytä vastaavan kaikkien perheiden tarpeita. Tämän tutkimuksen tarkoituksena oli tuottaa kuvailevaa ja tulkitsevaa tietoa perheen kokemuksesta liittyen lapsen tai sisaruksen kotona syntymiseen ja muodostaa täs...

Myyntistrategian laatiminen tietoliikennesegmentille

OpenAIRE

Moilanen, Tomi

2015-01-01

Opinnäytetyön tavoitteena oli laatia yrityksen tietoliikennetoiminnan myyntistrategia vuodelle 2015. Strategian laadinnan kannalta oleellista oli selvittää yrityksen myyntiprosessin tekijät ja myyntiprosessin vaiheet. Lisäksi tunnistettiin myyntiprosessimallit ja selvitettiin myynnin johdon merkitys myyntitiimin osana. Tietoperustan ja käytännön tiedon avulla laadittiin tietoliikennesegmentin myyntistrategia. Myyntistrategian laatimisessa oleellista oli tunnistaa yrityksen toimintaympäris...

Algevekstpotensialmålinger i Hoffselva og Mærradalsbekken, mars 1986

OpenAIRE

Källqvist, T.

1986-01-01

Algevekstpotensialet i vannprøver fra forskjellige stasjoner i vassdragene ble undersøkt med og uten tilsetning av vekstmedium. I Hoffselva var vekstpotensialet lavt på de øverste stasjonene, men økte til et maksimum ved Nedre Smestaddam. Veksthemning ble påvist i Skådalsbekken, men vannet var ikke toksisk overfor vannlopper. I Mærradalsbekken var vekstpotensialet meget høyt. Oslo kommune

ACD-Tool Mobile : Diagnostiikkasovelluksen siirtäminen mobiiliympäristöön

OpenAIRE

Kokkonen, Lauri

2015-01-01

Tämän työn tavoitteena oli suunnitella ja toteuttaa Andritz Oy:lle jo olemassa olevan, tietokoneella ajettavan ACD-Tool-työpöytäsovelluksen pohjalta mobiililaitteella, kuten tablettitietokoneella tai matkapuhelimella ajettava sovellus. ACD-Tool on diagnostiikkasovellus, jonka avulla voidaan tehdä laitoksen mittausautomaation tuottaman prosessidatan perusteella muun muassa trendejä, laskentaa ja erilaisia analyysejä. Sovelluksen erilaisista toteutustavoista tehtiin toimeksiantajan toiveest...

Postoperatiivisen tetraplegiapotilaan asento-hoito Töölön sairaalan Traumatologisella Teho- ja Tehostetun valvonnan osastolla – Ohjeistus uusille sairaanhoitajille ja opiskelijoille

OpenAIRE

Suominen, Terhi; Pyrhönen, Niina

2011-01-01

Postoperatiivisen tetraplegiapotilaan asentohoito Töölön sairaalan Traumatologisella Teho- ja Tehostetun valvonnan osastolla – ohjeistus uusille sairaanhoitajille ja opiskelijoille Tämä projektiraportti on osa Laurea-ammattikorkeakoulun sekä Helsingin ja Uudenmaan sai-raanhoitopiirin (HUS) Helsingin yliopistollisen keskussairaalan (HYKS) operatiivisen tulosyksikön laadunkehittämishanketta. Hoitotyönlaadun kehittämishanke sijoittuu vuosille 2007–2012. Hankkeen pyrkimyksenä on parantaa näyt...

Digitaalisen markkinoinnin suunnitelma

OpenAIRE

Peura, Mikko

2014-01-01

Opinnäytetyön tarkoituksena oli perehtyä digitaalisen markkinoinnin kanaviin, sekä markkinointiviestintään ja toteuttaa elokuvateatteri Y-kinon markkinointiviestintäsuunnitelma digitaalisen markkinoinnin kanaville. Elokuvateatterin liiketoiminnasta on vuodesta 2012 alkaen vastannut IPE Oy. Y-kino pyrkii laajentamaan elokuvateatterin palvelutuotevalikoimaa, esimerkkinä yksityisnäytökset ja suorat lähetykset. Teoria osuudessa haluttiin selvittää markkinointiviestinnän suunniteluun vaadittav...

Liikennesuunnittelu eri kaavoitusvaiheissa

OpenAIRE

Verkamo, Harri

2008-01-01

Tässä insinöörityössä kartoitettiin eri kaavavaiheiden liikennesuunnitelmia ja niiden sisältöä. Kartoituksen pohjalta laadittiin ohjeistus Helsingin kaupunkisuunnitteluviraston liikennesuunnitteluosastolle. Nykyään kaupunkisuunnitteluvirastossa ei ole ohjeita suunnittelijoiden avuksi eri kaavavaiheiden liikennesuunnitelmien laadintaan, mutta sellaiselle on selkeä tarve. Johdonmukaisella ohjeistuksella saadaan luotua yhtenäisempi käytäntö eri kaavavaiheiden liikennesuunnitelmien laatimiselle. ...

Elucidation of the Mechanisms and Environmental Relevance of cis-Dichloroethene and Vinyl Chloride Biodegradation

Science.gov (United States)

2012-11-01

thus appears that Polaromonas sp. JS666 is a safe candidate for use in bioremediation , bioaugmentation or monitored natural attenuation. 3.1.6...of multiple chlorinated ethene sources in an industrialized area. A forensic field study using compound-specific isotope analysis." Environmental ...Degrading Bacterium, and Features of Relevance to Biotechnology .” Applied and Environmental Microbiology 74(20): 6405-6416. Maymó-Gatell, X., Y.-t

Mujer y religión: la "méter" en el umbral del III milenio

Directory of Open Access Journals (Sweden)

Ana IRIARTE

2010-02-01

Full Text Available RESUMEN: La problemática del culto a las antiguas diosas como vía de integración política para la mujer griega ayudará a contextualizar la polémica figura de la Meter que Atenas acoge en su agora. Una figura al tiempo nebulosa y persistente, cuyas huellas pueden detectarse en fenómenos culturales de nuestra época.ABSTRACT: The problematics involved in the cult of the ancient goddesses as a means of political integration for Greek women will help to contextualize the polemical figure of the Metroum that Athens harboured in its agora. It was a figure at the same time nebulous and persistent, whose traces can be detected in the cultural phenomena of our time.

The spider collection (Arachnida: Araneae of the Zoological Museum of the Iranian Research Institute of Plant Protection, with new species records for Iran

Directory of Open Access Journals (Sweden)

Zamani, Alireza

2015-11-01

Full Text Available The spider collection of the Zoological Museum of the Iranian Research Institute of Plant Protection was studied during the summer of 2014. A total of 180 specimens, belonging to 25 families, 60 genera and 77 species were documented. Of these, the following nine species could be recorded from Iran for the first time: Alopecosa schmidti (Hahn, 1835, Anyphaena accentuata (Walckenaer, 1802, Crustulina sticta (O. P.-Cambridge, 1861, Enoplognatha mordax (Thorell, 1875, Ero tuberculata (De Geer, 1778, Salticus zebraneus (C. L. Koch, 1837, Pardosa aenigmatica Tongiorgi, 1966, Pardosa nebulosa (Thorell, 1872 and Tmarus piochardi (Simon, 1866. Morphological and geographical data are provided for the newly recorded species. Two species (P. aenigmatica and T. piochardi are illustrated and a map of localities is given.

Demography of Northern Spotted Owls in southwestern Oregon

Science.gov (United States)

Zabel, Cynthia J.; Salmons, Susan E.; Forsman, Eric D.; DeStefano, Stephen; Raphael, Martin G.; Gutierrez, R.J.

1996-01-01

Northern Spotted Owls (Strix occidentalis caurina) are associated with lower elevation, commercially valuable, late-successional coniferous forests in the Pacific Northwest. Meta-analyses of demographic parameters indicate that Northern Spotted Owl populations are declining throughout their range (Anderson and Burnham 1992, Burnham et al. this volume). Recent research has attempted to determine whether management activities have affected the viability of Spotted Owl populations, and results have led to development of conservation plans for the species (Dawson et al. 1987, Thomas et al. 1990, Murphy and Noon 1992, USDI 1992, Thomas et al. 1993b).In the Recovery Plan for the Northern Spotted Owl (USDI 1992b) threats to the species were identified as small population sizes, declining populations, limited amounts of habitat, continued loss and fragmentation of habitat, geographically isolated populations, and predation and competition from other avian species. Weather and fire are natural processes that also may affect reproductive success of Spotted Owls. Weather may be a factor in the high annual variability in fecundity of Spotted Owls, as has been suggested for other predatory bird species (Newton, 1979, 1986). However, these factors have not been addressed in previous studies of Spotted Owls.Our objectives were to estimate survival, fecundity, and annual rates of population change (l) for resident, territorial female Spotted Owls at two study areas in the coastal mountains of southwestern Oregon. We tested if the amount of rainfall was correlated with reproduction of Spotted Owls. While surveying for Spotted Owls, we documented the increased presence of Barred Owls (Strix varia), a potential competitor of Spotted Owls.

RSA-salausmenetelmä

OpenAIRE

Sipola, T. (Tapani)

2017-01-01

Tiivistelmä Tutkielmassa esitellään lyhyesti salakirjoituksen perusperiaatteita. Tämän jälkeen perehdytään RSA-salauksen periaatteeseen, jonka toimivuus todistetaan. Lisäksi kerrotaan RSA-salauksen käytöstä digitaalisessa allekirjoituksessa. Lopuksi perustellaan RSA-salauksen turvallisuutta tutkimalla mahdollisia heikkouksia ja miten niitä voi välttää. RSA-salaus hyödyntää nopeaa potenssiinkorotusalgoritmia, jota sovelletaa...

Joulumarkkinoinnin suunnittelu : Ravintola.fi-mobiiliapplikaatio

OpenAIRE

Kinnunen, Sarita

2013-01-01

Opinnäytetyön aiheena oli Ravintola.fi-mobiiliapplikaation joulumarkkinointikampanjan suunnittelu. Kampanjan tarkoituksena oli kasvattaa mobiiliapplikaation latausmääriä. Kohdeyritys Restamax julkaisi kanta-asiakkailleen tarkoitetun Ravintola.fi-mobiiliapplikaation keväällä 2013. Opinnäytteen teoriaosassa perehdytään markkinoinnin suunnitteluun ja digitaalisen markkinoinnin eri osa-alueisiin, erityisesti mobiilimarkkinointiin sekä yrityksen käyt-tämiin sosiaalisen median muotoihin. Markki...

Toimintaterapeuttinen nukkekoti CP-vammaisille lapsille

OpenAIRE

Ruotsalainen, Ulla; Tokola, Eveliina

2009-01-01

Toiminnallisen opinnäytetyön tarkoitus oli suunnitella ja rakentaa toimintaterapeuttinen nukkekoti CP-vammaisille lapsille. Työn toimeksiantajana oli toimintaterapeutti Päivi Raitanen Terapiapajalta. Työn tavoitteena oli toteuttaa mukana kuljetettava ja lapsen pyörätuolin pöytälevylle sopiva nukkekoti, jolla leikkiminen tukee CP-vammaisen lapsen toimintaterapiaa. Yleisimpiä tavoitteita ovat muun muuassa hienomotoristen taitojen, leikkitaitojen, syy-seuraussuhteiden ja visuaalisen hahmott...

Multiple Microcomputer Control Algorithm.

Science.gov (United States)

1979-09-01

3350 ; 3360 SYT4 EOU 63101000 1 INSTRUCTION TYPE OF LONOWORD. 3370 I4 EOU 68001000 1 NOT LONGWORD. 3330 8 3390 9YT8 EOU 63101001 a INSTRUCTION TYPE OF...8217000GC ’)00O00O00000OOAz4.itE000 ALU PEG . DST.. DST .AODR.FLu. RO.DC2&RO*SHFYO FLAGS CONY ADFC ALU.REG. ..OSTADDaS. FLO -LIRD. CZERO. SNTO FLAGS fXPCD

PARAMETER IDENTIFICATION AND STOCHASTIC CONTROL ...

African Journals Online (AJOL)

parameta identification examples treated in PART I. OPTIMAL PREDICTION. As aJ.ady discussed in PART I, a discrete linear system cm be modeled by the polynomial. A(z-1)y., = z°""B(z-1)ut + C(z-1)wt (15) where Yt is the output seq~. u the control. ""'l'mcc. IOl:l ~a 2m>-lDC8ll white process noise with variance q. dis the ...

Asiakastyytyväisyystutkimus : Case: Lady Line Kirkkonummi

OpenAIRE

Leppänen, Pauliina; Hartikainen, Sanna

2011-01-01

Aidosti asiakaslähtöinen yritys ymmärtää asiakkaidensa arvon ja merkityksen yrityksen liiketoiminnan perustana. Asiakkaan ehdoilla toimiva yritys pystyy täten saavuttamaan vahvaa kilpailuetua alan muihin toimijoihin nähden. Asiakastyytyväisyystutkimukset tarjoavat yrityksille toimialasta riippumatta arvokasta tietoa asiakkaan tarpeiden, käyt-täytymismallien ja mielipiteiden analysoimiseksi. Asiakastyytyväisyystutkimuksen vaati-mat ajalliset ja taloudelliset resurssit pystytään saamaan moninke...

Some Econometric Results for the Blanchard-Watson Bubble Model

DEFF Research Database (Denmark)

Johansen, Soren; Lange, Theis

The purpose of the present paper is to analyse a simple bubble model suggested by Blanchard and Watson. The model is defined by y(t) =s(t)¿y(t-1)+e(t), t=1,…,n, where s(t) is an i.i.d. binary variable with p=P(s(t)=1), independent of e(t) i.i.d. with mean zero and finite variance. We take ¿>1 so...

Markkinointi murroksessa: Mistä on toimiva Facebook-markkinointi tehty? : Case: Infokone Oy

OpenAIRE

Korhonen, Taneli

2010-01-01

Opinnäytetyön tavoitteena oli kartoittaa Facebook-markkinoinnin toimivia käytänteitä B2B-yritykselle. Tutkimuksessa saatuja tuloksia on tarkoitus käyttää apuna toimeksiantaja Infokone Oy:n Facebook-strategian suunnittelussa. Käytetty tutkimusote oli kvalitatiivinen eli laadullinen tutkimus ja tutkimusmenetelmä teemahaastattelu. Tutkimukseen haastateltiin syys–lokakuussa 2010 kolmea B2B-yrityksen edustajaa, jotka olivat olleet mukana toteuttamassa edustamansa yrityksen Facebook-markkinoint...

On the Asymptotic Behavior of Positive Solutions of Certain Fractional Differential Equations

OpenAIRE

Said R. Grace

2015-01-01

This paper deals with the asymptotic behavior of positive solutions of certain forced fractional differential equations of the form DcαCyt=et+ft, xt, c>1, α∈0,1, where yt=atx′t′, c0=y(c)/Γ(1) =yc, and c0 is a real constant. From the obtained results, we derive a technique which can be applied to some related fractional differential equations.

TrashionTrick : Naistenvaatekokoelma rekonstruoimalla ja nollajätemetodia soveltamalla

OpenAIRE

Haukka, Matleena

2011-01-01

Opinnäytetyön tavoitteena oli naistenvaatekokoelman luominen miesten puvuista rekonstruointi ja nollajätteen soveltaminen metodeina. Työssä suunniteltu kokoelma toimii pohjana tekijän omalle tuotemerkille, jolle on tarkoitus löytää vuoden 2011 aikana jälleenmyyjiä. Kokoelman tuli olla uutuusarvoa omaava, uniikki ja persoonallinen. Kokoelman suunnitteluprosessin eteneminen on kuvattu Checklandin pehmeän systeemisuunnittelun mallin kautta. Ideointi tapahtui pohjamateriaalin innoi...

The relationship between fat depot-specific preadipocyte differentiation and metabolic syndrome in obese women

Directory of Open Access Journals (Sweden)

N V Mazurina

2013-03-01

Full Text Available Реферат по материалам статьи The relationship between fat depot-specific preadipocyte differentiation and metabolic syndrome in obese women. Park HТ, Lee ES, Cheon EP, Lee DR, Yang K-S, Kim YT, Hur JY, Kim SH, Lee KW, Kim T. Clinical Endocrinology 2012; 76, 59-66.

Työkierto : Mielipiteitä käytännöstä

OpenAIRE

Hietala, Teija; Lehtonen, Anna

2012-01-01

Tämän opinnäytetyön tarkoituksena oli selvittää hoitajien kokemuksia työkierrosta eräillä yliopistollisen sairaalan osastoilla. Tavoitteena oli antaa tietoa osastojen henkilökunnalle työkierron toimivuudesta. Tavoitteena oli, että kyselyn tuloksia voitaisiin käyttää apuna työkierron toimivuuden arvioinnissa ja mahdollisessa kehittämisessä. Opinnäytetyön tehtävinä oli selvittää mitä työkierto on, miten osaston työntekijät kokivat työkierron toimivuuden osastoilla ja miten osastojen työntekijät...

Onnellisuusvastuu : Tasapainon löytäminen itsen ja muiden auttamiseen olemaan onnellinen

OpenAIRE

Hartikainen, Mika

2016-01-01

Onnellisuusvastuu on oman itsen ja muiden auttamista olemaan onnellinen. Ihmisten olisi tärkeää auttaa ensiksi itseään ennen kuin auttaa liian monia muita. Oman itsen ja muiden auttaminen olisi tärkeää olla tasapainossa. Onnellisuusvastuu auttaa avaamaan ihmisten silmät näkemään auttamisen laajemmassa mittakaavassa tietoisesti. On olemassa monenlaisia tapoja ja tasoja auttaa. Onnellisuusvastuu elämäntavassa keskeistä on sisäisen ja ulkoisen ympyrän onnellisuusvastuun 20 portaan kehittäminen o...

Linear minimax estimation for random vectors with parametric uncertainty

KAUST Repository

Bitar, E

2010-06-01

In this paper, we take a minimax approach to the problem of computing a worst-case linear mean squared error (MSE) estimate of X given Y , where X and Y are jointly distributed random vectors with parametric uncertainty in their distribution. We consider two uncertainty models, PA and PB. Model PA represents X and Y as jointly Gaussian whose covariance matrix Λ belongs to the convex hull of a set of m known covariance matrices. Model PB characterizes X and Y as jointly distributed according to a Gaussian mixture model with m known zero-mean components, but unknown component weights. We show: (a) the linear minimax estimator computed under model PA is identical to that computed under model PB when the vertices of the uncertain covariance set in PA are the same as the component covariances in model PB, and (b) the problem of computing the linear minimax estimator under either model reduces to a semidefinite program (SDP). We also consider the dynamic situation where x(t) and y(t) evolve according to a discrete-time LTI state space model driven by white noise, the statistics of which is modeled by PA and PB as before. We derive a recursive linear minimax filter for x(t) given y(t).

Full-range stress–strain behaviour of contemporary pipeline steels: Part I. Model description

International Nuclear Information System (INIS)

Hertelé, Stijn; De Waele, Wim; Denys, Rudi; Verstraete, Matthias

2012-01-01

The stress–strain relationship of contemporary pipeline steels is often approximated by the relatively simple Ramberg–Osgood equation. However, these steels often show a more complex post-yield behaviour, which can result in significant errors. To address this limitation for cases where an accurate full-range description is needed, the authors developed a new ‘UGent’ stress–strain model which has two independent strain-hardening exponents. This paper compares the UGent model with the Ramberg–Osgood model for a wide range of experimental data, by means of least-squares curve fitting. A significant improvement is observed for contemporary pipeline steels with a yield-to-tensile ratio above 0.80. These steels typically exhibit two distinct stages of strain hardening. In contrast to the Ramberg–Osgood model, both stages are successfully described by the UGent model. A companion paper (Part II) discusses how to find appropriate model parameter values for the UGent model. - Highlights: ► Contemporary pipeline steels often show two strain-hardening stages. ► This phenomenon is progressively apparent as Y/T exceeds 0.80. ► Both stages cannot be simultaneously described by the Ramberg–Osgood model. ► A new “UGent” model provides significantly better descriptions. ► The improvement becomes more pronounced as Y/T increases.

Yukon River King Salmon - Ichthyophonus Pilot Study

Science.gov (United States)

Kocan, R.M.; Hershberger, P.K.

2001-01-01

When king salmon enter the Yukon River on their spawning migration in mid June, over 25% of the population are infected with Ichthyophonus. The percent of infected fish remains relatively constant until the fish pass river mile 1,319 at Dawson, Y.T., then it drops to 13% when they reach river mile 1,745 at Whitehorse, Y.T. When the sexes are examined separately, slightly more females are infected than males (29% vs 22%). The percent of fish exhibiting clinical signs (diseased) is 2-3% when they enter the river, but increases to over 20% at river mile 715 near Tanana, AK. Disease prevalence within the population remains constant at >20% until fish pass Dawson, then the percent of diseased fish drops to <9% at Whitehorse. When the sexes are examined separately, male disease prevalence is highest at Tanana (22.6%) then gradually drops to just 12.9% at Whitehorse. Females however, continue to show an increase in disease prevalence peaking at river mile 1,081 near Circle, AK, at 36.4%, then dropping to just 5.3% at Whitehorse. Data on infection and disease collected from kings at Nenana on the Tanana River more closely resembles that seen at Whitehorse than the lower and middle Yukon River.

Yoga for heart failure: A review and future research

Directory of Open Access Journals (Sweden)

Paula R Pullen

2018-01-01

Full Text Available Background: Complementary and alternative medicine is a rapidly growing area of biomedical inquiry. Yoga has emerged in the forefront of holistic medical care due to its long history of linking physical, mental, and spiritual well-being. Research in yoga therapy (YT has associated improved cardiovascular and quality of life (QoL outcomes for the special needs of heart failure (HF patients. Aim: The aim of this study is to review yoga intervention studies on HF patients, discuss proposed mechanisms, and examine yoga's effect on physiological systems that have potential benefits for HF patients. Second, to recommend future research directions to find the most effective delivery methods of yoga to medically stable HF patients. Methods: The authors conducted a systematic review of the medical literature for RCTs involving HF patients as participants in yoga interventions and for studies utilizing mechanistic theories of stretch and new technologies. We examined physical intensity, mechanistic theories, and the use of the latest technologies. Conclusions: Based on the review, there is a need to further explore yoga mechanisms and research options for the delivery of YT. Software apps as exergames developed for use at home and community activity centers may minimize health disparities and increase QoL for HF patients.

A new species of Aplectana (Nematoda: Cosmocercidae) parasite of Pleurodema nebulosum (Anura: Leptodactylidae) from the Monte desert, Argentina, with a key to Neotropical species of the genus Aplectana.

Science.gov (United States)

Gomez, Mauricio D Piñeiro; González, Cynthya E; Sanabria, Eduardo A

2017-03-27

Here we describe a new cosmocercid nematode, Aplectana nebulosa sp. nov., from the small and large intestines of Pleurodema nebulosum (Anura: Leptodactylidae), from the Monte desert of San Juan, Argentina. The new species belongs to the Aplectana group that possesses a gubernaculum and unpaired adcloacal papilla anteriorly to cloaca. It resembles A. membranosa, A. paraelenae and A. travassosi by the presence of four adcloacal papillae, but differs from those species by the following characters: number and arrangement of precloacal papillae; number and arrangement of postcloacal papillae; shape and size of spicules and gubernaculum, and by the presence of lateral alae in caudal region of males. The description of the new species is based on light microscopy and scanning electron microscopy (SEM) and we also provide a key to Neotropical species of Aplectana.

Mainosvideot Popot Sneaker Storelle

OpenAIRE

Perttilä, Miika

2012-01-01

Toiminnallisen opinnäytetyön tavoitteena oli tehdä Popot Sneaker Storea hyödyttäviä käytännön markkinoinnin toimenpiteitä tulevaisuuden markkinoinnin kanavassa. Popot Snea-ker Store on retrourheilukenkiä myyvä pieni yritys Helsingin Punavuoressa, joka on menestynyt hyvin aktiivisen markkinoinnin avulla. Tarkoitus oli jatkaa Popot Sneaker Storen aktiivista linjaa markkinoinnissa online-videomarkkinoinnin keinoin. Online-videomarkkinointi valikoitui toimintatavaksi sen vuoksi, että se on mu...

Autokorikorjaamon perustaminen

OpenAIRE

Ronkainen, Tapio

2017-01-01

Tässä opinnäytetyössä suunnitellaan autokorikorjaamon perustamista kirjoittajan kotipaikkakunnalle Kuusamoon. Työssä kuvataan korikorjaamon perustamistoimenpiteitä ja suunnittelua teoriassa sekä sovellettuna perustettavaan korikorjaamoon. Käytännön tavoitteena on oman korikorjaamon suunnittelu ja toteutus sekä yrityksen liiketoiminnan aloittaminen ja ennen kaikkea kannattavan liiketoiminnan pyörittäminen. Aluksi yritykselle täytyy valita paras sekä toimivin yritysmuoto. Seuraavaksi tar...

Autoteippaus

OpenAIRE

Tanskanen, Joonas

2013-01-01

Insinöörityö tehtiin Metropolia Ammattikorkeakoululle, ja työn tarkoituksena oli tutustua autoteippaamiseen sekä pohtia autoteippauksen harjoittelun soveltuvuutta yhdeksi mediatekniikan käytännön opetustunnin aiheeksi. Autoteippi on polyvinyylikloridista eli PVC:stä valmistettu joustava muovikalvo, jossa on akryyliliimapinta toisella puolella. Teippikalvon raaka-aineena käytettävä muovi pehmennetetään pehmittimillä, esimerkiksi ftalaateilla, ennen kuin siitä valmistetaan puhaltamalla, v...

Laser Resurfacing

OpenAIRE

Janik, Joseph P.; Markus, Jodi L.; Al-Dujaili, Zeena; Markus, Ramsey F.

2007-01-01

In a society desiring images of beauty and youthfulness, the world of cutaneous surgery offers the gifts of facial rejuvenation for those determined to combat the signs of aging. With the development of novel laser and plasma technology, pigmentary changes, scarring, and wrinkles can be conquered providing smoother, healthier, younger-looking skin. This review highlights five of the most popular resurfacing technologies in practice today including the carbon dioxide (CO2) laser, the erbium:yt...

Metropolialueen matkailun wellness –palveluiden kehitysympäristöselvitys

OpenAIRE

Taivassalo, Emma

2010-01-01

Kehitysympäristöselvityksessä kartoitetaan Metropolialueen wellness -matkailun toimijoita, nykyistä toimintaa, kehittämistilannetta ja tulevia kehittämisen tarpeita. Selvityksen tavoitteena on kartoittaa yritysten yhteistyön tilannetta, yhteistyöhalukkuutta ja osaamista kehittämistoimintaan sekä kehittämishaluja wellness -palveluja alueen matkailuelinkeinon tarpeita vastaaviksi. Tavoitteena on myös löytää Metropolialueen kehittäjien ja mahdollistajien kannalta ensisijaisia kehittämiskohteita....

Kunnan strateginen johtaminen - tutkimus Seinänaapurikuntien strategiaprosessien ominaispiirteistä ja kunnanjohtajista strategisina johtajina

OpenAIRE

Rannisto, Pasi-Heikki

2005-01-01

Tutkimusmenetelmät ja tutkimustehtävä Tutkimuksen tehtävänä on selvittää kunnan strategiaprosessi ja strateginen johtaminen kunnanjohtajan kannalta sekä kunnanjohtajan rooli strategian käytäntöön viemisessä. Tutkimuksen kohdekuntina ovat Etelä-Pohjanmaalle sijoittuvan Seinänaapurit -seutukunnan seitsemän kuntaa. Tutkimuksessa tarkastellaan ja arvioidaan kohdekuntien strategiaprosesseja ja kunnanjohtajien toimintaa strategioiden maastouttajina. Lähdeaineistona ovat kansainvälinen strat...

Asiakkaan palvelupolkuun perustuva verkkokaupan kehittäminen

OpenAIRE

Tennberg, Nora

2016-01-01

Verkosta on tullut merkittävin kauppapaikka. Yhä useammat yritys- ja kuluttaja-asiakkaat tekevät pääasiassa ostoksensa verkossa, koska se ei ole sidottu aikaan tai paikkaan ja tarjoaa laajan valikoiman tuotteita sekä palveluita. Yritysten kannalta kilpailu verkossa on kiivasta ja verkossa toimivien yritysten tuleekin löytää keinoja, joilla ne voivat erottautua kilpailijoistaan. Verkkokaupan onnistunut asiakaskokemus on keino, jolla voidaan vaikuttaa asiakkaiden ostoaikeisiin, parantaa asiakas...

Tietoturvallisuusauditointi ISO 27000-viitekehyksessä

OpenAIRE

Luoma, Ilmari

2015-01-01

Tiedon olemassaolo eri olomuodoissa muodostaa vaikeasti hallittavan uhkakentän, jonka käsittelyyn kansainvälisesti hyväksytty ISO 27000 -standardi on hyvä väline. Työn tarkoitus on perehtyä ISO/IEC 27000 -standardisarjaan, soveltaa standardin vaatimuksia laatimalla tietoturvallisuuden auditointiaineisto ja -menetelmä, sekä toteuttaa tietoturvallisuusauditointi käytännössä. Työssä esitellään tietoturvallisuuden kytkeytyminen yritysturvallisuuteen, tietoturvallisuuden osa-alueittainen ...

Perehdyttämisopas turvallisuuteen Break Sokos Hotel Edenin vastaanottoon

OpenAIRE

Rosenström, Nina-Maria

2014-01-01

Opinnäytetyön tavoitteena oli tuottaa perehdyttämisopas turvallisuuteen Break Sokos Hotel Edenin vastaanottoon. Tarkoituksena oli luoda käytännöllinen ja mahdollisimman kattava apuväline perehdyttämiseen ja tukemaan vastaanoton henkilökuntaa turvallisuustietoisessa työskentelyssä. Tarkoituksena oli koota hotellin turvallisuuteen oleellisesti liittyvä tietous eri kansioista ja paikoista yhteen konkreettiseen kansioon. Lisäksi oppaan laatimisessa pyrittiin saamaan hotellin turvallisuuteen liitt...

Kohti palveluliiketoimintaa, palvelumuotoilulla palvelua teollisuusyritykselle. : Tapaus KiiltoClean Oy

OpenAIRE

Turpeinen, Pekka

2017-01-01

Suuret muutokset maailmassa vaikuttavat suomalaiseen yrityselämään. Näitä muutoksia ovat muun muassa globalisaatio ja teknologioiden nopea kehittyminen. Muutokseen vaikuttavat digitalisaation tuomat mahdollisuudet liiketoiminnalle, kuten asioiden internet, Internet of Things (IoT) ja keinoälyn kehitys. Yrityksen kilpailuetuihin tulisi löytää uusia keinoja. Kehitys on antanut yrityksille mahdollisuuden luoda asiakkailleen entistä vaivattomammin palveluita. Useimmat asiakkaat eivät hae enää tuo...

Kytkimen valinta pinta-aaltoenergialaitteistoon

OpenAIRE

Pennonen, Antti

2014-01-01

Tässä työssä on tarkoituksena tarkastella ASWEC -2014 pinta-aaltoenergialaitteistoon mahdollisesti soveltuvia kytkimiä tai korvaavia ratkaisuja momentin siirtoon. Työn tarkoitus on valita soveltuva toteutustapa tai mahdollisesti olemassa oleva komponentti laitteiston momentin siirtoon. Aaltovoima on aurinko-, tuuli- ja vesivoiman rinnalla suhteellisen uusi tapa sähkön tuottamiseksi. Kuitenkin merkittävä osa maapallon energiasta voitaisiin menetelmien kehittyessä tuottaa aaltoenergiaa käyt...

Postmodernin kontekstit maantieteessä

OpenAIRE

Vilkko, Suvi

2005-01-01

Vaikeaselkoisuus ja kiistanalaisuus lyövät leimansa moniin yhteiskunta- ja sosiaalitieteiden kentillä nyt 2000-luvun taitteessa käytäviin keskusteluihin. Aivan erityisen hyvin tämä tieteellisen keskustelun hajanaisuus tulee ilmi käsiteltäessä sitä, mitä postmodernilla ajattelulla tarkkaan ottaen tarkoitetaan. Postmodernia ajattelua on totunnaisesti pidetty eräänlaisena käsitekuminauhana, jolla on viitattu esimerkiksi nykyisen taideteorian abstraktiuteen, yhteiskunnan nopeaan moniarvoistumiske...

Kuljetuskustannusten vertailu vientitoimituksissa Ruotsista Venäjälle : case: Yritys X, lohituotteet

OpenAIRE

Manner, Tatjana

2013-01-01

Tämä opinnäytetyö käsittelee kuljetuskustannusten vertailua vientitoimituksissa Ruotsista Venäjälle. Työn tarkoituksena on löytää case-yritykselle edulliset huolitsijat autokuljetuksin ja ovelta ovelle -lentokuljetuksin vietäviin lohituotteiden toimituksiin. Tutkimuksen osatavoitteena on kuvailla vientiin tarvittavia kuljetusasiakirjoja ja selvittää asiakirjojen laadinnasta aiheutuvia kustannuksia. Työn teoreettisessa osuudessa käsitellään logistiikkapalvelujen hankintaa, huolintaliikkeit...

Proceedings of the Discussion Meeting on Thermodynamics of Alloys Held in Barcelona, Spain on 23-26 May 1999. Series B. Volume 86

Science.gov (United States)

1990-05-01

V.T.K., Schubert K (1967): energye agency). Zeitsch. Metallk., 58, 558. - Meschter P.J., Worrel W.L.(1977): - Colinet C., Pasturel A., Hicter P...expressions. One Gibbs phase rail , reason why the sublattice model is not used more frequently is that it may not be obvious how to The G;ibbs energy in...from the mathematical surface. This dual representation allows efficiency of file storage y-t highly precise representations for display and combined

”Rakastava ja fiksu ihminen ja se keittää aina hyvät kahvit” : Yhteisöllinen valokuvaprojekti kehitysvammaisten ohjatun asumisen kodissa

OpenAIRE

Saarinen, Kirsi

2013-01-01

Opinnäytetyön tavoitteena oli toteuttaa kehitysvammaisten aikuisten ohjatun asumisen yksikössä Puistokodissa sen yhteisöllisyyttä ja viihtyisyyttä tukeva valokuvaprojekti. Projektin aikana kerätyn tutkimusaineiston avulla haluttiin lisäksi tuottaa tietoa valokuvatyöskentelyn toimivuudesta ja siihen liittyvistä hyvistä käytännöistä Puistokodin asukkaiden hyvinvoinnin tukemiseksi mahdollisesti myös tulevaisuudessa. Asukkaat osallistuivat valokuvaprojektin aikana kuuteen ryhmätapaamise...

Platelets Orchestrate Remote Tissue Damage After Mesenteric Ischemia-Reperfusion

Science.gov (United States)

2012-02-02

Platelet Depletion Two days before I/R injury, mice received a single intraperitoneal injection of a titred affinity purified endotoxin-free rabbit...Egan R, Chen J, le Lucca JJ, Juang YT, Tsokos GC. IL-17 producing CD4 T cells mediate accelerated ischemia/reperfusion- induced injury in...activation in rheumatoid arthritis. Clin Rheumatol 26: 768–771, 2007. 77. Wang Y, Li Y, le Lucca SL, Simovic M, Tsokos GC, le Lucca JJ. Decay accelerating

Sosiaalisen median riskit yritysmaailmassa

OpenAIRE

Kilpinen, Joni

2015-01-01

Sosiaalisen median palveluista on kirjoitettu lukuisia kirjoja ja artikkeleita, joissa niitä ylistetään varsinkin yritysnäkökulmasta. Vaikka sosiaalinen media on muuttanut olennaisesti tapaa, jolla keskustella, mainostaa, etsiä ja jakaa tietoa, piilee sen palveluiden käytössä kuitenkin erilaisia uhkakuvia. Yritykset ja asiantuntijat pelkäävät sosiaalisen median avoimuuden aiheuttavan suuria tietoturvariskejä. Lisäksi asiantuntijat ovat varoitelleet sosiaalisessa mediassa olevista haittaohjelm...

Validation of reference genes for quantitative RT-PCR studies of gene expression in perennial ryegrass (Lolium perenne L.

Directory of Open Access Journals (Sweden)

Thrush Anthony

2010-01-01

Full Text Available Abstract Background Perennial ryegrass (Lolium perenne L. is an important pasture and turf crop. Biotechniques such as gene expression studies are being employed to improve traits in this temperate grass. Quantitative reverse transcription-polymerase chain reaction (qRT-PCR is among the best methods available for determining changes in gene expression. Before analysis of target gene expression, it is essential to select an appropriate normalisation strategy to control for non-specific variation between samples. Reference genes that have stable expression at different biological and physiological states can be effectively used for normalisation; however, their expression stability must be validated before use. Results Existing Serial Analysis of Gene Expression data were queried to identify six moderately expressed genes that had relatively stable gene expression throughout the year. These six candidate reference genes (eukaryotic elongation factor 1 alpha, eEF1A; TAT-binding protein homolog 1, TBP-1; eukaryotic translation initiation factor 4 alpha, eIF4A; YT521-B-like protein family protein, YT521-B; histone 3, H3; ubiquitin-conjugating enzyme, E2 were validated for qRT-PCR normalisation in 442 diverse perennial ryegrass (Lolium perenne L. samples sourced from field- and laboratory-grown plants under a wide range of experimental conditions. Eukaryotic EF1A is encoded by members of a multigene family exhibiting differential expression and necessitated the expression analysis of different eEF1A encoding genes; a highly expressed eEF1A (h, a moderately, but stably expressed eEF1A (s, and combined expression of multigene eEF1A (m. NormFinder identified eEF1A (s and YT521-B as the best combination of two genes for normalisation of gene expression data in perennial ryegrass following different defoliation management in the field. Conclusions This study is unique in the magnitude of samples tested with the inclusion of numerous field-grown samples

Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA ⁺ ATPase domain of NtrC1 in both inactive and active states

Energy Technology Data Exchange (ETDEWEB)

Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

2003-04-10

Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF₃^-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

Evaluation of Pb–17Li compatibility of ODS Fe-12Cr-5Al alloys

Energy Technology Data Exchange (ETDEWEB)

Unocic, Kinga A., E-mail: unocicka@ornl.gov; Hoelzer, David T.

2016-10-15

The Dual Coolant Lead Lithium (DCLL: eutectic Pb–17Li and He) blanket concept requires improved Pb–17Li compatibility with ferritic steels in order to demonstrate acceptable performance in fusion reactors. As an initial step, static Pb-17at.%Li (Pb-17Li) capsule experiments were conducted on new oxide dispersion strengthened (ODS) FeCrAl alloys ((1) Y{sub 2}O{sub 3} (125Y), (2) Y{sub 2}O{sub 3} + ZrO{sub 2} (125YZ), (3) Y{sub 2}O{sub 3} + HfO{sub 2} (125YH), and (4) Y{sub 2}O{sub 3} + TiO{sub 2} (125YT)) produced at ORNL via mechanical alloying (MA). Tests were conducted in static Pb–17Li for 1000 h at 700 °C. Alloys showed promising compatibility with Pb–17Li with small mass change after testing for 125YZ, 125YH and 125YT, while the 125Y alloy experienced the highest mass loss associated with some oxide spallation and subsequent alloy dissolution. X-ray diffraction methods identified the surface reaction product as LiAlO{sub 2} on all four alloys. A small decrease (∼1 at.%) in Al content beneath the oxide scale was observed in all four ODS alloys, which extended 60 μm beneath the oxide/metal interface. This indicates improvements in alloy dissolution by decreasing the amount of Al loss from the alloy. Scales formed on 125YZ, 125YH and 125YT were examined via scanning transmission electron microscopy (S/TEM) and revealed incorporation of Zr-, Hf-, and Ti-rich precipitates within the LiAlO{sub 2} product, respectively. This indicates an inward scale growth mechanism. Future work in flowing Pb–17Li is needed to further evaluate the effectiveness of this strategy in a test blanket module. - Highlights: • Investigation of Pb-17Li compatibility of new ODS Fe-12Cr5Al. • Promising small mass change after static Pb-17Li exposure. • LiAlO{sub 2} formed on the surface during Pb-17Li exposure. • Oxide precipitates incorporated within the LiAlO{sub 2} product. • An inward scale growth mechanism was identified.

Pearl : konsepti ekologiselle puuteripakkaukselle

OpenAIRE

Nurmi, Susann

2016-01-01

Opinnnäytetyössäni tutkin ekologisuutta sekä kosmetiikan että pakkausmuotoilun näkökulmasta. Kosmetiikan puolella kerron luonnonkosmetiikasta ja sen nykyisistä tuottajista. Materiaalitutkimuksen osuudessa tutkin keinoja luoda pakkauksesta ekologisempaa uusien materiaalien avulla. Pohdin myös mitkä seikat vahvistavat tai heikentävät kuluttajan mielikuvaa ekologisuudesta pakkauksessa. Muotoiluprosessissani käytän paljon käyttäjätestausta suunnitteluni apuna. Suunnittelun tavoitteena on luod...

Yksityisestä elinkeinonharjoittajasta osakeyhtiöksi

OpenAIRE

Laurila, Pietari

2015-01-01

Opinnäytetyön aiheena oli tutkia yritysmuodon muutosta toiminimestä osakeyhtiöksi. Toimeksianto tuli kiinteistönhuoltoalalla toimivalta yksityiseltä elinkeinonharjoittajalta. Tutkimusongelmana oli selvittää, onko kohdeyrityksen taloudellisesti kannattavaa muuttaa yritysmuotoaan yksityisestä elinkeinonharjoittajasta osakeyhtiöksi ja kuinka se käytännössä tapahtuu. Kirjallisten dokumenttien lisäksi aineistoa opinnäytetyöhön saatiin haastattelemalla yrittäjää sekä aiheeseen erikoistunutta yr...

Final Report for Geometric Observers and Particle Filtering for Controlled Active Vision

Science.gov (United States)

2016-12-15

rather than discrete objects. This has a simplifying effect on the formalism, which becomes grid independent. On the other hand models based on...ft(xt, ut) where ut is i.i.d. random noise with known pdf. At discrete times, observations Yt ∈ Rp become available. These measurements are related to...Tannenbaum, “Minimizing flows for the Monge–Kantorovich problem,” SIAM J. Math . Analysis 35 (2003) pp. 61-97. [10] S. Angenent, G. Sapiro, and A

RFID- TEKNIIKAN MAHDOLLISTAMAT TYÖAIKASÄÄSTÖT HUONEKALUTEOLLISUUDESSA : - CASE INCAP FURNITURE OY

OpenAIRE

Taskinen, Jarkko

2009-01-01

Opinnäytetyön tarkoituksena oli selvittää RFID- tekniikan eli radiotaajuudella toimivan etätunnistamisen mahdollistamia työaikasäästöjä huonekaluteollisuudessa. Toimeksiantaja oli Incap Furniture Oy. Incap Furniture Oy on yksi suurimmista mäntyhuonekalusopimusvalmistajista maailmassa. Pääasiakas on Ikea. Incap Furniture Oy on aloittanut projektin, jonka tarkoitus on tutkia RFID- tekniikan mahdollisuuksia ja hyötyjä tehtaiden toiminnassa. Opinnäytetyö oli osa projektia. Opinnäyt...

Talouspalvelukeskuksen asiakastyytyväisyystutkimus - Kouvolan kaupunki

OpenAIRE

Ranne, Jonna

2011-01-01

Tutkimuksen tarkoituksena oli selvittää Kouvolan kaupungin Talouspalvelukeskuksen asiakastyytyväisyyden odotusarvot ja tämänhetkinen tyytyväisyyden taso sekä löytää kehityskohteita, joilla tyytyväisyyttä voitaisiin tulevaisuudessa parantaa. Talouspalvelukeskuksen asiakasorganisaatioissa työskenteleville yhteyshenkilöille lähetettiin sähköpostilla linkki tyytyväisyyskyselyyn, johon saatiin yhteensä 273 vastausta. Kokonaistyytyväisyydeksi kouluarvosana-asteikolla mitattuna saatiin 7,8, mikä...

Näkyvyyttä ja uusia markkinointikeinoja ranskalaiselle La Cantine-ravintolalle

OpenAIRE

Holopainen, Niina; Jännäri, Noora; Tuokko, Jarrad

2013-01-01

Tämän opinnäytetyön tarkoituksena oli tehdä markkinointisuunnitelma La Cantine-ravintolalle, joka sijaitsee Munkkiniemessä. Markkinointisuunnitelman tavoitteena oli havainnollistaa yrityksen nykytilannetta markkinoinnin näkökulmasta sekä tutkia yritykselle sopivia markkinointiviestinnän keinoja. Opinnäytetyö koostuu käytännönläheisestä ja teoreettisesta osiosta. La Cantine ravintola on perustettu vasta vuoden 2013 tammikuussa ja ravintolalla ei ole vielä toimivaa markkinointisuunnitelmaa...

On the Logical Development of Statistical Models.

Science.gov (United States)

1983-12-01

1978). "Modelos con parametros variables en el analisis de series temporales " Questiio, 4, 2, 75-87. [25] Seal, H. L. (1967). "The historical...example, a classical state-space representation of a simple time series model is: yt = it + ut Ut = *It-I + Ct (2.2) ut and et are independent normal...on its past values is displayed in the structural equation. This approach has been particularly useful in time series models. For example, model (2.2

Selvitys palkanlaskennan ulkoistamisen hyödyistä ja haasteista

OpenAIRE

Pohjonen, Anna

2013-01-01

Opinnäytetyön tavoitteena oli selvittää sekä oman palkanlaskennan että ulkoistetun palkanlaskennan hyödyt ja haasteet. Analyysin pohjalta oli tarkoituksena ehdottaa toimeksiantajan tarpeisiin sopivaa toimintamallia palkanlaskennan toteuttamiseen. Selvityshetkellä oli käytössä sisäinen palkanlaskentapalvelu, jonka toteuttamisesta vastasi yksi henkilö. Ulkoistetun palkanlaskennan vaihtoehto oli noussut toimeksiantajayrityksessä esille nykyisen palkanlaskijan eläkeiän lähestyessä. Myös muiden sa...

Asiakkaan turvallisuuskokemus majoitusliikkeessä : Case Hotel Rantasipi Pohjanhovi

OpenAIRE

Kilpeläinen, Iida-Maria

2014-01-01

Opinnäytetyön tarkoituksena oli selvittää, miten asiakkaiden turvallisuus toteutuu turvallisuuden arvoketjun osiossa majoitusliike. Tavoitteena oli kartoittaa, millaisia ovat hotellin tekemät panostukset turvallisuuden saavuttamiseksi ja miten nämä panostukset vaikuttavat asiakkaan kokemukseen turvallisuudesta. Lisäksi pyrin löytämään yleisimpiä tekijöitä, jotka vaikuttavat asiakkaan turvallisuuskokemuksen syntymiseen. Opinnäytetyön toimeksiantajana toimi Lapin matkailun turvallisuusjärje...

Tutkimus raumalaisten naisten sisustustuotteiden ostokäyttäytymisestä

OpenAIRE

Vartio, Jenni

2011-01-01

Opinnäytteen aiheena oli raumalaisten naisten sisustustuotteiden ostokäyt-täytyminen. Tutkimuksen tavoitteena oli saada selville, mitä raumalaiset naiset ostavat ja etsivät raumalaisista sisustusalan liikkeistä ja kuinka paljon he käyttävät verkkokauppoja sisustustuotteiden ostamiseen. Samalla kartoitettiin, onko Raumalla tarvetta uusille sisustusliikkeille. Myös perheen osallistumista ostopäätökseen kysyttiin. Tällä hetkellä on muodissa ekologisuus ja eettisyys kaikessa kuluttamisessa ja sik...

Identification of Novel Molecular Targets for Pleckstrin Homology (PH) Domains Found in Oncogenes Implicated in Breast Cancer

Science.gov (United States)

2008-03-01

roles as a positive regulator of IL- 2 gene induction in T cells (Deckert et al, 1998), NK cell-mediated cytotoxicity (Jevremovic et al, 2001), and FcRI...Identification of a gene encoding a human oxysterol-binding protein-homologue: a potential general molecular marker for blood dissemination of solid...Biol. 6(5), 384-385. Scanlan, MJ, Gout , I, Gordon, CM, Williamson, B, Stockert, E, Gure, AO, Jager, D, Chen, YT, Mackay, A, O’Hare, MJ, and Old LJ

Hyvinvointipalveluiden tuotteistaminen : palveluinnovaatioiden kehittämismallin toteuttaminen

OpenAIRE

Heikkinen, Sami; Freundlich, Heidi; Heininen-Reimi, Taina; Savolainen, Heidi; Saarela, Ulla; Ruuhinen, Miia

2016-01-01

Hyvinvointialan kehittämisalusta ja palveluinnovaatiot -hanke toteutettiin Lahden ammattikorkeakoulun sosiaali- ja terveysalalla 1.4.2015–31.3.2016. Euroopan aluekehitysrahaston tukemassa hankkeessa vahvistettiin päijäthämäläisen hyvinvointitoimialan yhteistyötä ja kasvuedellytyksiä sekä edistettiin pitkäjänteisen kehittämistyön jatkoa. Hankkeen tavoitteena oli muodostaa alueelle hyvinvointialan kehittämisalusta ja löytää palveluinnovaatioita, joita kaupallistettaisiin yhdessä palveluntarjoaj...

Multivalued stochastic delay differential equations and related ...

African Journals Online (AJOL)

We study the existence and uniqueness of a solution for the multivalued stochastic differential equation with delay (the multivalued term is of subdifferential type):. dX(t) + aφ (X(t))dt ∍ b(t,X(t), Y(t), Z(t)) dt. ⎨ +σ (t, X (t), Y (t), Z (t)) dW (t), t ∈ (s, T). X(t) = ξ (t - s), t ∈ [s - δ, s]. Specify that in this case the coefficients at time t ...

Internet-kulttuuri nykytaiteessa

OpenAIRE

Höyssä, Timo

2016-01-01

Internet-kulttuuri nykytaiteessa Tutkimuksessa tarkastellaan internet-taiteen historiaa ja nykyisiä esityskäytäntöjä sekä sitä miten globaali internet-kulttuuri on muokannut nykytaidetta sekä galleriassa että webissä. Tutkimuksessa kysytään miten internetin kehitys on vaikuttanut internet-taiteeseen sekä post-internet-taiteen syntyyn? Mikä on internetin paikka nykytaiteessa sekä populaarikulttuurissa? Internet culture in contemporary art A study on the history of Internet art and it’...

Targeting Tim-1 to Circumvent Immune Tolerance in Prostate Cancer

Science.gov (United States)

2012-09-01

responses to PSA self- antigen in transgenic mice. Prostate 70:1002. 7. Koh, Y. T., A. Gray, S. A. Higgins, B. Hubby, and W. M. Kast . 2009. Androgen...15766662] 14. Koh YT, Gray A, Higgins SA, Hubby B, Kast WM. Androgen ablation augments prostate cancer vaccine immunogenicity only when applied after...Mercader M, Bodner BK, Moser MT, Kwon PS, Park ES, Manecke RG, Ellis TM, Wojcik EM, Yang D, Flanigan RC, Waters WB, Kast WM, Kwon ED. T cell

Chaotic time series prediction: From one to another

International Nuclear Information System (INIS)

Zhao Pengfei; Xing Lei; Yu Jun

2009-01-01

In this Letter, a new local linear prediction model is proposed to predict a chaotic time series of a component x(t) by using the chaotic time series of another component y(t) in the same system with x(t). Our approach is based on the phase space reconstruction coming from the Takens embedding theorem. To illustrate our results, we present an example of Lorenz system and compare with the performance of the original local linear prediction model.

Nintendo Wii-pelikonsolin käyttö ikääntyneiden tasapainon tukemisessa

OpenAIRE

Pere, Olli; Suihkonen, Juho; Kärkkäinen, Taneli

2017-01-01

Opinnäytetyömme tavoitteena oli lisätä tietoa Nintendo Wii-pelikonsolin käytöstä ikääntyneiden tasapainoharjoittelussa. Opinnäytetyössämme teimme kirjallisuuskatsauksen kokoamalla aiemmin tutkittua tietoa aiheesta. Selvittääksemme ikääntyneiden käyttökokemuksia tasapainoharjoittelusta Nintendo Wiipelikonsolilla, teimme palvelutalo Karpalokodilla aiheesta tapaustutkimuksen. Tapaustutkimukseen osallistui kolme 80-89-vuotiasta henkilöä. Aineiston tapaustutkimukseen keräsimme haastattelulla. ...

Markkinointisuunnitelma Carean Helmi -kahvilalle

OpenAIRE

Pöyhönen, Terhi

2013-01-01

Tämän opinnäytetyön tarkoituksena oli tuottaa Helmi Cafelle markkinointisuunnitelma, jota se voi hyödyntää markkinoinnissaan. Tavoitteena oli tuoda esiin seikkoja, joiden avulla Helmi Cafe saa kasvatettua tunnettuuttaan ja tuotua toimintaideologiaansa ihmisten tietoisuuteen. Työn tavoitteena oli myös kehittää kahvilalle keinoja markkinoida palvelujaan tehokkaammin. Työ toteutettiin kirjoituspöytätyyppisenä tutkimuksena, jossa tutustuttiin markkinoinnin teorioihin ja sovellettiin niitä Hel...

3D- Visualisointipalveluiden toimintaedellytysten selvittäminen Jyväskylän seudulla

OpenAIRE

Lahtinen, Johanna

2013-01-01

Opinnäytetyössä tutkittiin, millaisilla markkinoilla toimeksiantaja, Visualisointipalvelu Divion toimii kilpailun näkökulmasta ja miten nämä asiat vaikuttavat yrityksen tulevaisuuden suunnitelmiin. Tutkimuksen tavoitteena oli selvittää, mitä alalla toimivat kilpailijat ajattelevat itsestään ja omista ja kilpailijoidensa toiminta mahdollisuuksista nyt ja tulevaisuudessa. Aihe oli toimeksiantajalle tarpellinen, sillä yrityksellä ei ollut käytössään aiempaa kilpailijatietoutta, jonka avulla se v...

Encountering Difference. The experience of highly skilled Nordic citizens in India

OpenAIRE

Foulkes Savinetti, Nicol

2015-01-01

Erilaisuutta kohtaamassa Korkeastikoulutettujen pohjoismaiden kansalaisten kokemuksia Intiassa Väitöskirjatyössä tarkastellaan Intiassa tilapäisesti työskenteleviä suomalaisia ja tanskalaisia korkeasti koulutettuja henkilöitä ja selvitetään kuinka muuttaminen Mumbain, Delhin ja Bangaloren haasteellisiin miljoonakaupunkeihin vaikuttaa heidän kansalaisuuteensa, suhteessa niin julkiseen valtaan, työmarkkinoihin, ja laajemmin yhteisöihin ja fyysiseen ympäristöön. Käytän Rainer Bauböckin ka...

Die Fantasie Tarot : konsepti Tarot-korttipakalle

OpenAIRE

Hanninen, Kai

2014-01-01

Tässä opinnäytetyössä käsittelen Tarot-korttipakkaa, sen historiaa ja symboliikkaa. Tarkoituksenani on luoda konsepti kaupallisesti julkaistavalle korttipakalle joka on yhtenevä korteista jo julkaistujen tulkintojen kanssa. Käytän työssäni sekä perinteisiä että nykyaikaisia kuvitustekniikoita. Asiasanat: kuvitus, symboliikka, Tarot, hah- mosuunnittelu, konseptisuunnittelu In this graduation project I’m covering the history, symbolicism and use of Tarot-Decks. The purpose of the project ...

Allasterapia osana neurologista kuntoutusta

OpenAIRE

Laaksonen, Aino; Lahti, Janina; Saastamoinen, Maarit; Salmi, Sirja

2009-01-01

Opinnäytetyön tarkoituksena oli koota teoriatietoa allasterapiasta ja erityisesti sen soveltuvuudesta neurologisille kuntoutujille. Opinnäytetyö toteutettiin vuoden 2009 aikana. Opinnäytetyön aineisto koottiin kirjallisuuskatsauksen ja avoimen teemahaastattelun avulla. Kirjallisuutta ja tutki-mustietoa neurologisesta allasterapiasta on vähän, ja se irrallista, joten teemahaastatteluista laaditulla vapaamuotoi-sella yhteenvedolla opinnäytetyöhön saatiin mukaan myös käytännönkokemuksia. Opinnäy...

Mekaniikkasuunittelijoiden metakognitiivisen tietoisuuden kehittäminen

OpenAIRE

Kyttänen, Pasi-Pekka

2007-01-01

Tutkimuksen tarkoituksena oli tarkastella mekaniikkasuunnittelijoiden metakognitiivista tietoisuutta ja kehittää sitä tukevia käytäntöjä ja välineitä. Tarve tutkimuksen tekemiseen tuli havaituista ongelmista, jotka liittyivät suunnittelijoiden osaamiseen, oppimiseen, itsensä kehittämiseen sekä suunnittelutehtävän hallintaan. Mekaniikkasuunnittelijan työ on itsenäistä ja vastuullista, suuren ja kompleksisen tiedon kognitiivista käsittelyä. Suunnittelumaailma on hektinen ja jo...

Kattilantestauslaboratorion huolto- ja kunnossapitosuunnitelma

OpenAIRE

Muurikainen, Matias

2017-01-01

Jyväskylän ammattikorkeakoululla on kattilantestauslaboratorio Biotalousinstituutissa Saarijärvellä. Biotalousinstituutilla ei ollut viralliselle kattilantestauslaitteistolle huolto- ja kunnossapitosuunnitelmaa. Opinnäytetyön tarkoituksena oli luoda helppokäyttöinen ja helposti muokattava Excel-tiedosto, mistä henkilökunta voi löytää kunkin laitteen yksityiskohtaiset ohjeet. Kattilantestauslaboratoriossa on suuri määrä laitteita, jotka eivät liity välittömästi kattilantestaustoimintaan. Tä...

Psykofyysiset menetelmät kroonisen kivun hoidossa : Työelämävalmiuksia tukevan ryhmätoiminnan suunnittelu kroonisista kivuista kärsiville pitkäaikaistyöttömille

OpenAIRE

Jämsä, Silja

2016-01-01

Opinnäytetyön tarkoituksena oli kuvata psykofyysisen harjoittelun mahdollisuuksia kroonisesta kivusta kärsivien asiakkaiden kuntoutuksessa sekä suunnitella ryhmätoiminnan käytännön toteutus pitkäaikaistyöttömille pitkittyneistä kiputiloista kärsiville kuntoutujille. Työn tavoitteiksi asetettiin 1) perehtyminen teoreettiselta näkökannalta psykofyysiseen fysioterapiaan ja krooniseen kipuun sekä tutustuminen psykofyysiseen viitekehykseen kuuluviin lähestymistapoihin, menetelmiin ja harjoitteisii...

Use of raptors for biomonitoring of heavy metals: gender, age and tissue selection.

Science.gov (United States)

Castro, I; Aboal, J R; Fernández, J A; Carballeira, A

2011-03-01

The concentrations of cadmium, mercury and lead were determined in liver, kidney and feathers of Accipiter gentilis, Buteo buteo and Strix aluco. No significant differences in the concentrations of metals were observed in relation to either age or gender. Cadmium levels in feathers and in kidney were significantly correlated (p < 0.01 or p < 0.05) in all species. In B. buteo, cadmium concentrations in feathers and in liver were also correlated (p < 0.01), as were the concentrations of lead in feathers and in liver (p < 0.05). The low correlation coefficients let to reject the possibility of predicting metals concentrations in viscera from the concentrations in feathers.

Predators control post-fledging mortality in tawny owls, Strix aluco

DEFF Research Database (Denmark)

Sunde, Peter

2005-01-01

, primarily due to predation from raptors and mammals (predominantly foxes Vulpes vulpes). Predation by mammals occurred within the first few days after fledging, with young leaving the nest at an early age being at particularly high risk. Young that had received extra food as nestlings were also at higher...... risk of being preyed upon by mammals, possibly because they were easier to locate on their smell. Total mortality risk (control broods) increased with fledging date from 14% in April to >58% in June due to an increasing raptor predation risk. Individual attributes such as sex, condition......, immunocompetence or prevalence of blood parasites did not predict total or cause-specific mortality risk. Survival during the post-fledging dependency period was therefore primarily a function of variation in predation pressures, particularly from raptors. Increasing raptor predation of late broods appears...

Dynamic PET scanning and compartmental model analysis to determine cellular level radiotracer distribution in vivo

International Nuclear Information System (INIS)

Smith, G.T.; Hubner, K.F.; Goodman, M.M.; Stubbs, J.B.

1992-01-01

Positron emission tomography (PET) has been used to measure tissue radiotracer concentration in vivo. Radiochemical distribution can be determined with compartmental model analysis. A two compartment model describes the kinetics of N-13 ammonia ( 13 NH 3 ) in the myocardium. The model consists of a vascular space, Q 1 and a space for 13 NH 3 bound within the tissue, Q 2 . Differential equations for the model can be written: X(t) = AX(t) + BU( t), Y(t)= CX(t)+ DU(t) (1) where X(t) is a column vector [Q 1 (t); Q 2 (t)], U(t) is the arterial input activity measured from the left ventricular blood pool, and Y(t) is the measured tissue activity using PET. Matrices A, B, C, and D are dependent on physiological parameters describing the kinetics of 13 NH 3 in the myocardium. Estimated parameter matrices in Equation 1 have been validated in dog experiments by measuring myocardial perfusion with dynamic PET scanning and intravenous injection of 13 NH 3 . Tracer concentrations for each compartment can be calculated by direct integration of Equation 1. If the cellular level distribution of each compartment is known, the concentration of tracer within the intracellular and extracellular space can be determined. Applications of this type of modeling include parameter estimation for measurement of physiological processes, organ level dosimetry, and determination of cellular radiotracer distribution

Il viaggio utopico nella fantascienza sovietica: La Nebulosa di Andromeda di I.A. Efremov

Directory of Open Access Journals (Sweden)

Beatrice Zenobi

2007-12-01

Full Text Available The Utopian Journey in Soviet Science Fiction. The Andromeda nebula by I. a: Efremov Tumannost’ Andromedy by I.A. Efremov, a novel set in the 30-th century, can be interpreted in its utopic entreaties according to the theme of journey, in order to emphasize its strong link with the composite and problematic cultural climate during the Thaw. The journey can be considered as a technical device to depict the changed landscapes of a future communist society that will create a planet Earth totally resembling human rationality, in Efremov’s project. From the structural point of view, the journey is necessary to face the new and to enlarge one’s conceptual system: thanks to the plausible scientifi c hypothesis, the writer casts his project in the 30-th century, extrapolating the present premises and developing them in a better future. The reader is entrusted with the task of gradually discovering the criticisms of contemporaneity, while the definition of it remains rather ambiguous, since many of its aspects are omitted or denied. The evaluation of science as the concrete instrument with which to reach happiness gives the possibility to read the journey as the metaphor of the impulse towards knowledge and the unknown, as well as to the transcendent. In this perspective, the pages of the novel re-echo the Cosmist’s ideals, as the research of a friendly contact with other worlds, and the human victory against space and time represented by the colonization of the Universe.

DESENVOLVIMENTO DE UMA TIPOLOGIA HIDROGEOMORFOLÓGICA DE NASCENTES BASEADA EM ESTATÍSTICA NEBULOSA MULTIVARIADA

Directory of Open Access Journals (Sweden)

Miguel Fernandes Felippe

2014-09-01

Full Text Available As nascentes de cursos d’água são sistemas hidrogeomorfológicos complexos, caracterizados por uma grande variabilidade de seus elementos estruturantes. Esta heterogeneidade ainda pouco conhecida cria dificuldades para os processos de gestão ambiental, pois, em teoria, cada nascente responde a perturbações de maneira diferente. Nesse sentido, este trabalho tem como objetivo desenvolver uma tipologia de nascentes com base em suas características hidrogeomorfológicas que sistematize sua heterogeneidade, sem perder seus aspectos individuais. Para atingir esta meta um método de máxima verossimilhança baseado na teoria dos conjuntos nebulosos foi usado para criar perfis multivariados para 79 nascentes catalogadas em três parques urbanos de Belo Horizonte - MG. Após uma série de testes estatísticos, propuseram-se seis tipos básicos no qual as nascentes podem ser enquadradas. No entanto, o principal avanço desta técnica é permitir a comparação entre os diferentes graus de pertencimento de cada nascente em cada tipo criado, auxiliando na compreensão da sua diversidade, sem esconder a sua heterogeneidade.

Etätyökäytäntöjen kehittäminen

OpenAIRE

Haverinen, Liisa

2017-01-01

Opinnäytetyön tavoitteena oli luoda selvitys kohdeyritykselle siihen, kannattaako yrityksessä tehdä etätöitä laajemmin. Lähtötilanne oli, että etätöitä tehdään yrityksessä osittain. Etätöitä tekeviä työntekijöitä on kuitenkin vähän, ja etätöitä tehdään myös määrällisesti vähän. Työn alussa kerrotaan etätyöstä ilmiönä ja käsitteenä. Teoriaosuudessa selvitetään vastuita, hyötyjä ja haasteita liittyen etätöihin. Selvitetään myös etäjohtamisen ominaispiirteitä. Teoriaosuudessa käydään läpi e...

Imatralaisten nuorten terveyskysely mielialasta ja päihteiden käytöstä

OpenAIRE

Markkanen, Jonna; Pinomaa, Suvi; Pajunen, Piia

2010-01-01

Tämä opinnäytetyö liittyy Sydän- ja verisuonitautien ennaltaehkäisyprojektiin (SYVE), joka toteutettiin Imatralla vuosina 2005–2008. Yksityisellä lahjoituksella toteutetun projektin avulla haluttiin vaikuttaa nuorten elämäntapoihin ja terveyskäyttäytymiseen sekä lisätä nuorten tietoa sydän- ja verisuonitautien riskitekijöistä. Yhteistyössä toimi Imatran Sydänyhdistys ry, Imatran koulutoimi, Etelä-Karjalan ammattikorkeakoulun ja ammattiopiston sosiaali- ja terveysala sekä Oppimiskeskus Motiivi...

Lantionpohjan toimintahäiriöt : Fysioterapeuttiset hoitokäytännöt

OpenAIRE

Halinen, Erika; Pulkkinen, Sari

2011-01-01

Lantionpohjan toimintahäiriöt ovat merkittävä naisten elämänlaatua heikentävä vaiva. Lantionpohjan toimintahäiriöitä ovat virtsaamiseen, ulostamiseen ja seksuaalitoimintoihin liittyvät häiriöt sekä laskeumat ja lantionpohjan alueen kiputilat. Suurimmat riskitekijät toimintahäiriöiden synnylle ovat raskauksien, synnytysten ja ikääntymisen mukanaan tuomat lantionpohjan lihas-, sidekudos- ja hermovauriot tai -muutokset. Lantionpohjan eri rakenteet ja toiminnat ovat läheisessä yhteydessä toisiins...

Verkkokauppojen kilpailija-analyysi

OpenAIRE

Nissinen, Antti

2014-01-01

Tämä opinnäytetyö on tehty liiketalouden koulutusohjelmassa. Opinnäytetyön tarkoituksena oli selvittää verkkokaupan nykytilaa, analysoida verkkokauppojen ansaintalogiikkaa ja erilaisia liiketoimintamalleja sekä suorittaa kilpailija-analyysi selvitykseen valittujen neljän verkkokaupan osalta. Kyseessä on toiminnallinen opinnäytetyö, jossa käytettäviä tutkimusmenetelmiä ovat havainnointi ja kirjoituspöytätutkimus. Selvityksessä käydään ensin läpi aiheen teoreettista viitekehystä verkkokaupa...

USSR Report, Military Affairs, No. 1711.

Science.gov (United States)

1982-10-05

Meet iqmortantlYt that they becose real personsi, that they’ learn to love work and that they wol4 be able to look anyone straiqht in the ee gut don’t... human quality we call purposefulness. were is another passage from a letter written by the commander of the unit in which Vladivlav serves: *Be likes...replenish them, to ensure compliance with sanitary norma in shelters, to conduct current disinfection of buildings and to render first aid to shelter

Mikrokiteisen selluloosan käyttö keittomakkaran valmistuksessa

OpenAIRE

Vainio, Mika

2016-01-01

Tutkielman kirjallisuusosiossa käsiteltiin keittomakkaran rasvankorvaajia. Siinä kuvattiin mikrokiteisen selluloosan valmistusta, ominaisuuksia sekä käyttökohteita. Myös muita tällä hetkellä käytössä olevia keittomakkaran rasvankorvaajia käsiteltiin, joita ovat hydrokolloidit ja kasveista saatavat proteiinit. Kirjallisuusosiossa selvitettiin myös keittomakkaran laadun määrittämiseen käytettyjä menetelmiä. Kokeellisen osion tavoitteena oli selvittää kahden eri mikrokiteisen selluloosalaadu...

Kanta-asiakasohjelman kehittäminen : case Crocs Stores Oy

OpenAIRE

Manninen, Mirka

2014-01-01

Kanta-asiakkuuden tavoitteena on molemminpuolinen arvon tuottaminen asiakkaan ja yrityksen välillä. Tämän tutkimuksen tavoitteena on selvittää, millainen kanta-asiakasohjelma olisi toimeksiantajayrityksen kannalta toimivin. Tutkimus on tapaus- eli case -tutkimus, jonka toimeksiantaja on Crocs Stores Oy. Toimeksiantajalla on tällä hetkellä käytössään kanta-asiakasohjelma, joka ei palvele yrityksen tarpeita. Paremman kanta-asiakasohjelman kehittämisen lisäksi tavoitteina on selvittää asiakkaide...

WOM ja eWOM : pankit ja negatiivinen eWOM

OpenAIRE

Stigzelius, Teemu

2015-01-01

Tämä opinnäytetyö käsittelee Word of Mouth ja electronic Word of Mouth –viestintää. Word of Mouthin tehokkuus perinteiseen markkinointiin on jo pitkään ollut yritysten ja tutkijoiden tiedossa. Internetin käytön yleistyminen avaa yrityksille uusia mahdollisuuksia edulliseen ja tehokkaaseen markkinointiin. Toisaalta se aiheuttaa yrityksille myös uusia uhkia mahdollisten negatiivisten viestien levitessä arvaamattomasti ja hallitsemattomasti verkossa. Opinnäytetyö on tehty osana NEMO-hanketta...

Facebook-yhteisöpalvelun hyödyntäminen yrityksen markkinointiviestinnässä

OpenAIRE

Pajamäki, Ida

2014-01-01

Tämän opinnäytetyön tavoitteena oli selvittää, miksi yritysten olisi kannattavaa olla Facebook-yhteisöpalvelussa ja millaisia keinoja niillä on käytössään Facebook-palvelussa markkinoidessaan. Opinnäytetyössä rakennettiin työn toimeksiantajalle, Mainostoimisto Gurulle, oma Facebook-sivu. Guru on Turun ammattikorkeakoulun sisäinen mainostoimisto, jossa suunnitellaan kaikenlaista markkinointiviestintää opiskelijavoimin. Teoriaosassa käsiteltiin lyhyesti sosiaalista mediaa ja Facebook-palvel...

Tietoturvatyökalujen tuominen osaksi testausprosessia

OpenAIRE

Saastamoinen, Vesse

2016-01-01

Opinnäytetyö tehtiin Codemate-nimiselle suomalaiselle ohjelmistoyritykselle, joka tarvitsi hyvää vertailua nykyisistä tietoturvatestaukseen suunnitelluista työkaluista. Vertailun tavoitteena oli löytää ja valita sopivat työkalut, joita voidaan hyödyntää Codematen testausprosessissa. Vertailua oli tarkoituksena tehdä lähinnä web-sovelluksiin suunnattuihin työkaluihin, mutta lisäksi mukaan otettiin myös muutamia verkko- ja palvelinskannereita ja Content Management System –skannereita. Vert...

Johdannaiset sijoitusinstrumenttina

OpenAIRE

Ylinen, Markus

2015-01-01

Opinnäytetyön teoriaosuudessa käsiteltiin sijoittamisen eri muotoja: osake-, rahasto- ja korkosijoitukset, johdannaiset, joukkovelkakirjalainat, kiinteistöt, raaka-aineet ja valuutat. Sijoitusstrategioista kerrottiin yleisesti käytössä olevia strategioita, eli osinko-, arvo-, cost averaging- ja value averaging -strategiat sekä hajauttaminen. Sijoittajan käyttäytyminen käytiin läpi pääpiirteittäin. Johdannaisiin keskityttiin muita sijoitusmuotoja enemmän opinnäytetyön aiheen vuoksi. Johda...

Asiakkuudenhallinta : Asiakkuudenhoitomallien kehittäminen organisaation asiakaslähtöisyyden lisäämiseksi

OpenAIRE

Niemi, Lauri

2010-01-01

Tämän tutkimuksellisen kehittämishankkeen tarkoituksena oli perehtyä asiakkuudenhallintaan ja kehittää asiakkuudenhoitomalleja, jotka lisäävät organisaation asiakaslähtöisyyttä. Toimeksiantajana ja taustaorganisaationa kehittämishankkeessa oli Elisa Oyj. Työ suoritettiin tutkimuksellisena kehittämishankkeena. Työn tutkimusongelmana oli kartoittaa asiakkuudenhoitomallien hyödyllisyyttä ja sitä kuinka aktiivisessa käytössä ne ovat olleet asiakasrajapinnassa sekä tunnistaa niistä selkeitä kehity...

Military Review. Volume 57, Number 5, May 1977

Science.gov (United States)

1977-05-01

of the Uuited States for F16rnl Yt·nr 1977, 20 .Jnnuury J97G, pP 5·6. 0 Donald H. Rumsfeld, Ann11ul Dc/l’JI8l’ D().JJt!Th11().1!t Rcvort Fiscal Year...3,938 4,711 5,220 Portugal Escudos 12,538 14,699 16,046 16,736 25,108 19,898 18,500 Turkey Liras 6,237 8,487 9,961 12,192 15,831 United Kingdom

Det «overbestemte» livet?: Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California

OpenAIRE

Singstad, Birgit Nestvold

2011-01-01

Det “overbestemte” livet? Balansering av arbeid og familieliv i IT-bransjen i Norge, Malaysia og California. Denne avhandlingen undersøker hvordan ansatte i IT-bransjen balanserer arbeid og familieliv i Norge, Malaysia og California. Jeg har valgt å undersøke dette i en gruppe høyt utdannede arbeidstakere, og har spurt: Er det slik at et interessant, morsomt og fleksibelt, men krevende arbeidsliv skaper tidsklemmer og balanseproblemer? Eller er det vårt senmoderne samfunn som skaper for m...

Kioton hankemekanismit ja jätehuoltosektori – tietopaketti yrityksille. Uudet jätteenkäsittelykonseptit kasvihuonekaasupäästöjen vähentämisessä ja niiden kehittäminen liiketoiminnaksi keskipitkällä aikavälillä (UJKON)

OpenAIRE

Ahonen, Hanna-Mari

2006-01-01

Tämän julkaisun tavoitteena on esitellä Kioton pöytäkirjan hankemekanismit eli yhteistoteutus (JI) ja puhtaan kehityksen mekanismi (CDM) niiltä osin kuin ne kytkeytyvät jätehuoltoratkaisuihin. Hankemekanismit tarjoavat mahdollisuuksia kestävän kehityksen edistämiseen ja kasvihuonekaasujen kustannustehokkaaseen vähentämiseen. Nämä mekanismit parantavat ilmastonmuutosta hillitsevien teknologioiden ja toimenpiteiden kilpailukykyä sallimalla niitä koskevien hankkeiden tuottamien päästövähennysten...

Markkinointiviestintäsuunnitelma Case: MK Kivipiha Oy

OpenAIRE

Ruohomaa, Sami

2011-01-01

Tämän opinnäytetyön tarkoituksena on ollut markkinointiviestintäsuunnitelman laatiminen MK Kivipiha Oy:lle. Opinnäytetyö toteutettiin projektityönä, jonka lisäksi benchmarkkaus osiossa hyödynnettiin kvalitatiivista eli laadullista analyysiä. Lähtökohtana pidettiin suunnitelman realistisuutta ja käytännön toteuttamisen mahdollisuutta. Opinnäytetyö rakentuu kahdesta eri osiosta: teoreettisesta viitekehyksestä sekä empiirisestä osuudesta. Teoriana käytettiin katsausta perinteisen markkinointivie...

Muhoksen kunnan viheralueiden hoitoluokitus

OpenAIRE

Lämsä, Jaana

2013-01-01

Tämän opinnäytetyön tavoitteena oli kartoittaa Muhoksen kunnan taajama-alueella sijaitsevat yleiset viheralueet ja laatia niille viheralueiden hoitoluokitus. Viheralueiden hoito on tärkeää aluei-den viihtyisyyden, turvallisuuden ja käytön takaamiseksi. Hoidosta syntyy paljon kustannuksia, joten viheralueiden hoidon suunnittelu ja kehittäminen auttavat pitämään kustannuksia kurissa. Työn tuloksena kartoitetuista viheralueista syntyi hoitoluokituskartta. Työn tilaaja oli Muhoksen kunnan tekn...

Työpajaviikot 2005 - 2006 : Kirkkomännikön koulu

OpenAIRE

Kalmari, Sanna

2006-01-01

Liikunta on hermoston ohjaamaa lihasten toimintaa. Se on tahdonalaista ja toteutamme sitä tiettyjen tavoitteiden saavuttamiseksi. Lasten tavoitteet ovat erilaisia kuin aikuisten ja liittyvät usein uusien taitojen oppimiseen tai peleissä pärjäämiseen. Sopivan harrastuksen löytäminen voi viedä vuosia. Tutkimusten mukaan lasten terveyden kehittyminen on kääntynyt laskuun ja täysin liikkumattomien, passiivisten lasten joukko kasvaa nopeasti. Nykyään vain joka kolmas lapsi liikkuu tarpeeksi. Olin ...

Selvitys palkanlaskennan ongelmatilanteista : case: UPM-Kymmene Oyj

OpenAIRE

Rantanen, Marjaana

2010-01-01

Tässä opinnäytetyössä tutustuttiin UPM-Kymmene Oyj:n palkkahallinnon kehitysprojektiin ja projektin vaikutuksiin yrityksen palkkahallinnossa. Palkkahallinnon kehitysprojekti kattaa palkkahallinnon keskittämisen yhteen palvelukeskukseen ja uuden palkkajärjestelmän käyttöönottoprosessin. Tämän raportin tavoite oli selvittää projektiin liittyen palkanlaskijoiden ongelmatilanteet jokaisen palkanlaskijan oman palkkajärjestelmän ja omien käytäntöjen kautta. Ilmi tulleet ongelmatilanteet koottiin lo...

Taloushallinnon ohjelmistorobotiikan käyttöönotto Joensuun alueen tilitoimistoissa

OpenAIRE

Pietarinen, Petra; Parviainen, Taina

2017-01-01

Opinnäytetyön tarkoituksena on selvittää taloushallinnon ohjelmistorobotiikan käytön nykytilannetta Joensuun alueen tilitoimistoissa. Tutkimus on kvalitatiivinen eli laadullinen ja aineistonkeruumenetelmänä käytetään teemahaastattelua. Tutkimustulos osoittaa, että kaikki haastateltavat pitivät sähköisen taloushallinnon kehittymistä positiivisena muutoksena. Ohjelmistorobotiikan käyttöönotto on vielä alkuvaiheessa ja sitä hyödynnetään toistaiseksi vain isommissa tilitoimistoissa. Ohjelmist...

Entsymaattisen Abbott Architect c8000 HbA1c -menetelmän validointi

OpenAIRE

Karjalainen, Laura

2013-01-01

Opinnäytetyö suoritettiin THL:n Tautiriskiyksikön analyyttisen biokemian laboratoriossa (TLAB). Työssä validoitiin uusi entsymaattinen Abbott Architect c8000 HbA1c -menetelmä, jota käytetään diabetekseen liittyvissä tutkimuksissa. Validoinnilla haluttiin varmistaa uuden mittaustekniikaltaan erilaisen menetelmän toimivuus. Menetelmävertailussa komparatiivisena menetelmänä oli laboratoriossa rutiinikäytössä ollut Abbottin immunoturbidimetrinen HbA1c-menetelmä. Uusi entsymaattinen menetelmä peru...

Investigation of Novel Molecular Targets for Pleckstrin Homology (PH) Domains Found in Oncogenes Implicated in Breast Cancer

Science.gov (United States)

2007-03-01

protein’s PI3K-dependent roles as a positive regulator of IL- 2 gene induction in T cells (Deckert et al, 1998), NK cell-mediated cytotoxicity...82. Fournier, MV, Guimaraes da Costa, F, Paschoal, ME, Ronco, LV, Carvalho, MG, and Pardee, AB. (1999) Identification of a gene encoding a human...Ipl and Tih1. J Biol Chem. 277(51), 49935-44. Scanlan, MJ, Gout , I, Gordon, CM, Williamson, B, Stockert, E, Gure, AO, Jager, D, Chen, YT, Mackay, A

Korttitilityspalveluiden kartoitus : Case: Hotelli Haikon Kartano

OpenAIRE

Kokko, Saara

2015-01-01

Tämä opinnäytetyö toteutettiin toimeksiantona Hotelli Haikon Kartanolle. Opinnäytetyön tarkoituksena oli toteuttaa yritykselle kehittämishanke, jonka tavoitteena oli kartoittaa nykypäivän tarjonnasta yritykselle toimivin ja edullisin korttitilityspalvelu sekä löytää ratkaisuja korttitilitysprosessin automatisoimiseksi. Sysäyksen opinnäytetyöhön antoi työni Hotelli Haikon Kartanon taloushallinnon osastolla myyntireskontran hoitajan tehtävissä. Opinnäytetyö on projektiluontoinen ja tutkielm...

LoRa IoT -radion soveltuvuus käytettyjen työkoneiden tiedonsiirtoon

OpenAIRE

Hasu, Lassi

2017-01-01

Opinnäytetyön tarkoituksena oli tutkia LoRa-radiotekniikan soveltuvuutta lastinkäsittelylaitteiden tuottaman datan tiedonsiirtoon. LoRa on teollisen internetin sovelluksia varten kehitetty pitkän kantaman radiotekniikka. Tavoitteena oli löytää käyttötapauksia, joihin LoRa-tekniikka soveltuu etsittäessä kustannustehokasta radiotekniikkaa erityisesti käytettyihin lastinkäsittelylaitteisiin. Työn toimeksiantaja oli Cargotec Finland Oy:n Kalmar-liiketoimintayksikkö. Työn tutkimusmenetelmänä käyte...

Kuuntele ja osallistu - Sosiaalinen media myynnin ja markkinoinnin tukena

OpenAIRE

Lönnblad, Hanna

2010-01-01

Sosiaalinen media on tullut jäädäkseen. Viimeisen kymmenen vuoden aikana IRC-Gallerian, Habbo Hotelin ja Facebookin kaltaiset palvelut ovat omineet itselleen kasvavan osan nykyihmisen ajankäytöstä niin töissä, kouluissa kuin vapaa-ajalla. Sosiaalisen median palveluita pidetään teinien leikkipaikkoina, mutta tosiasiassa uusi media tarjoaa rajattomasti potentiaalia myös yritystoiminnan kehittämiseen ja kasvattamiseen kaiken-kokoisille yrityksille. Virtuaalista maailmaa ei tule väheksyä. Opi...

Mayariggauksen Mekanismit : mihin Maya-rigin perustoiminnot pohjautuvat

OpenAIRE

Reimi, Roope

2015-01-01

Tämä on tutkielma Mayan yleisimpien riggaustyökalujen ja mekanismien toiminnasta ja yleinen katsaus Mayan pohjarakenteeseen. Maya on Autodeskin yleiskäytännöllinen 3D-ohjelmisto, joka on saanut teollisuuden aloilla maineen luotettavana, mutta haastavana animaatioalustana. Tässä tutkielmassa aion selvittää muutamia konsepteja, jotka saattavat hämmentää Mayassa ja avata sen logiikkaa toimintojensa takana. Aion myös pureutua syvemmin muutamien Mayan perus riggaustyökalujen toimintaan ja millaine...

Mobiilisovelluksen toteutus web-tekniikoilla PhoneGap-kehykselle

OpenAIRE

Heikka, Kai

2012-01-01

Opinnäytetyön tavoitteena oli tutkia tablet-laitteiden sopivuutta kartoittaessa rannikoiden tilaa öljyvahinkojen sattuessa, jotta tilanteesta saadaan mahdollisimman ajantasainen ja oikea tieto tilanteen johtamiseen. Ensisijaisesti tutkimuksen kohteena oleva tablet-laite oli iPad 2, mutta tutkimuksen aikana todettiin myös muidenkin tablet-laitteiden käytön olevan mahdollista käyttämällä esimerkiksi web-tekniikoihin perustuvaa PhoneGap-kehystä. PhoneGap-kehys oli sopiva opinnäytetyön tarpe...

Koira-avusteinen terapia lasten psyykkisten häiriöiden hoidossa

OpenAIRE

Tuovinen, Susanna

2014-01-01

Tuovinen, Susanna. Koira-avusteinen terapia lasten psyykkisten häiriöiden hoidossa. Kevät 2014. 61 sivua, 1 liite. Diakonia-ammattikorkeakoulu, Hoitotyön koulutusohjelma, Sairaanhoitaja (AMK). Koira-avusteinen psykoterapia on maailmalla tunnettu hoitomuoto psyykkisten häiriöiden hoidossa. Suomessa se ei kuitenkaan ole vielä saavuttanut samanlaista suosiota. Tämä opinnäytetyö kertoo koira-avusteisesta terapiasta ja sen käytöstä yhtenä lasten psyykkisten häiriöiden hoitomuotona. O...

Mustialan maanviljelysopiston ja sen lähiympäristön vanhojen omenapuiden kulttuurinen ja geneettinen monimuotoisuus

OpenAIRE

Ahinko, Heli

2016-01-01

Luonnonvarakeskuksen (Luke) Nurkkapuuhanke käynnistettiin tammikuussa 2012 keräämään ja täydentämään tarhaomenan paikallislajikkeisiin liittyvää tietoa. Opinnäytetyö on osa Nurkkapuuhanketta ja sen toimeksiantajana toimii Luonnonvarakeskus. Opinnäytetyön tavoitteena oli löytää ja tunnistaa Tammelan kunnassa sijaitsevan Mustialan entisen Maanviljelysopiston, nykyisen Hämeen ammattikorkeakoulun (HAMK) Mustialan yksikön- sekä sen lähialueella kasvavat vanhat omenapuut. Omenapuiden tunteminen mah...

Viestintä ja sen vaikutus palveluun opiskelijaravintolassa

OpenAIRE

Ilvonen, Satu

2015-01-01

Sain ajatuksen opinnäytetyöhön huomatessani puutteita useiden opiskelijaravintoloiden tiedottamisessa. Tavoitteena oli löytää keinoja parantaa palvelun laatua vaikuttamalla asiakkaiden valintoihin ja käyttäytymiseen toimivalla viestinnällä. Työn teoriaosuus kertoo viestinnästä ja tiedottamisesta. Viestinnän merkitys on suuri ja sen puuttuminen kokonaan tai osittain voi aiheuttaa suurtakin vahinkoa. Palveluyrityksessä sisäinen viestintä on elinehto ja siihen tulisi panostaa jo tuottavuusnä...

Harrasta terveellisesti ja turvallisesti itsepuolustuslajeja

OpenAIRE

Bäckström, Daniela; Arras, Pia

2012-01-01

TIIVISTELMÄ Arras, Pia & Bäckström, Daniela. Harrasta terveellisesti ja turvallisesti itsepuolustuslajeja. Helsinki, syksy 2012, 45 s., 2 liitettä. Diakonia-ammattikorkeakoulu, Diak Etelä Helsinki. Hoitotyön koulutusohjelma, sairaanhoitaja (AMK). Opinnäytetyö käynnistettiin Helsingin itsepuolustuskoulun kanssa. Yhteisen hankkeen taustalla ovat samat mielenkiinnon kohteet ja havaittu tarve ensiaputaitojen kehittämiseen. Työelämälähtöisen opinnäytetyön tavoitteena oli tuottaa käytännölli...

Big data -teknologian perusteet ja mahdollisuudet

OpenAIRE

Juurinen, Susanna

2013-01-01

Työn tarkoituksena oli tutkia tiedonhallintaa ja big data -ratkaisujen käytännön toteutusta, mahdollisuuksia, haasteita ja hyötyjä. Työssä kuvataan tiedon määrän kehitystä, keräysprosesseja ja -menetelmiä sekä pohditaan tiedonhallinnan vaatimuksia ja tietoturvallisuutta. Työn tarkoitus oli selvittää tiedonhallinnan ja analytiikan uusimman trendin, big datan, vaikutusmahdollisuuksia organisaatioiden toimintaan. Tiedon analytiikkaa voidaan valjastaa liiketoiminnan tai muiden toimialueiden t...

Virtual violin in the digital domain : physical modeling and model-based sound synthesis of violin and its interactive application in virtual environment

OpenAIRE

Holm, Jan-Markus

2004-01-01

Viulun mallintaminen on tunnustettu maailmanlaajuisesti erittäin haasteelliseksi ongelmaksi. Väitöskirjan syntymistä ja tutkimuksessa esitettyjen uusien tekniikoiden kehittämistä ovatkin ohjanneet pitkälle käytännön syyt. On ollut tarve pyrkiä luomaan aiempaa luotettavampia ja todenmukaisempia fysikaalisia malleja, mm. äänisynteesiä varten syntetisaattoreihin ja esimerkiksi mobiililaitteisiin, Jan-Markus Holm kertoo viulun fysikaalista mallintamista käsittelevän väitöstyönsä taustoista....

Ravintola konseptia etsimässä : Eksynyt Willi Hirvi

OpenAIRE

Mäntynen, Kaisu

2014-01-01

Opinnäytetyön tarkoituksena oli selvittää, millaisia palveluita Hotelli Jämsä Oy:n ravintolan Willi Hirven tulisi tarjota saadakseen toimintansa kannattavaksi. Ravintolan konsepti hakee suuntaansa, ja yritys halusi toiminnan suunnittelun avuksi tietoa palveluiden käyttäjiltä, sekä heiltä jotka eivät niitä käytä. Tutkimuksen kohteena olivat työnsä puolesta hotellissa majoittuvat asiakkaat ja paikalliset asukkaat, joita haluttaisiin palvella paremmin. Tutkimus oli otteeltaan kvalitatiivinen....

Akseligeneraattorin hybridikäyttö

OpenAIRE

Haukka, Jari

2014-01-01

Opinnäytetyön tavoitteena oli tuottaa selkeä informaatiopaketti koskien akseli-generaattorin hybridikäyttöä. Informaatiopaketin tarkoituksena oli tuoda ilmi akseligeneraattorin hybridikäytön toimintaa ja mahdollisuuksia lähtemällä liikkeelle vertailun mahdollistavista erilaisista olemassa olevista propulsiotyypeistä. Vertailukohteista opinnäytetyö eteni järjestelmän tärkeimpiin yksittäisiin komponentteihin ja niiden toimintaan, päätyen lopulta itse akseligeneraattorin hybridikäyttöön kokonais...

ZERAFF - tekstiileiden myyntikaluste

OpenAIRE

Palomäki, Hanne

2013-01-01

Opinnäytteen tehtävänä oli luoda kannettava ja pieneen tilaan mahtuva myyntikaluste tekstiilituotteille. Opinnäytteen toimeksiantajana oli Tekstiiliverstas, joka valmistaa kudonta-tekniikalla huiveja ja peitteitä. Tekstiiliverstas myy tuotteitaan pääasiassa erilaisissa myyn-titapahtumissa, mutta sillä ei ole käytössään tapahtumiin soveltuvaa kalustetta. Tarve tekstiilituotteet huomioon ottavalle kalusteelle oli ilmeinen. Täydellinen tuote Tekstii-liverstaan käyttöön on kevyt, kannettava ja...

Virtuaalisen yhteisöllisyyden vaikutus fyysiseen aktiivisuuteen : tyypin 2 diabeetikoilla

OpenAIRE

Ruuska, Juha-Pekka; Wirtanen, Jenni-Henrietta

2012-01-01

Ihmisten fyysinen aktiivisuus on huomattavasti vähentynyt viime vuosikymmenten aikana. Tämän sekä nykyisten ravitsemustottumusten seurauksena tyypin 2 diabeteksesta on tullut hyvinvointimaissa kasvava terveydenhuollon haaste ja taloudellisesti kuormittava ongelma. Liikunnalla on todettu olevan suotuisia vaikutuksia tyypin 2 diabeteksen ehkäisyssä ja hoidossa. Tästä syystä on tärkeää löytää keinoja joilla voidaan vaikuttaa ihmisten liikuntatottumuksiin. Tämän opinnäytetyön tarkoituksena oli...

Makuuhuonekalusteiden suunnittelu Kiteen Huonekalutehtaalle

OpenAIRE

Toivanen, Riitta-Liisa

2011-01-01

Opinnäytetyöni aiheena oli makuuhuonekalusteiden suunnittelu Kiteen Huonekalutehtaalle. Toimeksiannon lähtökohtana oli yrityksen tarve kehittää uusia makuuhuonekalusteita markkinoitaviksi jälleenmyyjille. Suunnittelun pääkohteena oli sänky, jonka jälkeen tuotesarjaan lisättiin yöpöytä tai lipasto. Työ alkoi tiedonhaulla, jolla kartoitettiin toimeksiantajan tuotevalikoimaa, tuotantoa ja mahdollisia asiakaskuntia. Aihetta lähestyttiin myös tutustumalla tämän hetken trendeihin, kuluttajien ...

Digitaalinen markkinointi pk-yrityksessä inbound-markkinoinnin keinoin CASE: Customer Intelligence Finland Oy

OpenAIRE

Lassila, Anna-Sofia

2016-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia kuinka digitaalista markkinointia kannattaa tehdä inbound-markkinoinnin keinoin. Tutkimuksen ensisijaisena tavoitteena oli löytää tehokkaimmat keinot inbound-markkinoinnin toteuttamiseen. Toisena tavoitteena oli antaa tuloksiin pohjautuen suosituksia digitaalisen markkinoinnin jatkotoimenpiteistä inbound-metodia hyödyntäen. Tämän opinnäytetyön toimeksiantajana toimi Customer Intelligence Finland Oy (CIFI). Tämän opinnäytetyön tutkimusmenetelmän...

Käden pakotettu käyttö : vaikuttava aivohalvauspotilaan kuntoutusmenetelmä

OpenAIRE

Hänninen, Kati; Näsi, Minna

2007-01-01

Opinnäytetyön tarkoituksena oli käsitellä käden pakotettua käyttöä aivohalvauspotilaan kuntoutusmenetelmänä ja tuoda esille sen vaikuttavuutta halvaantuneen yläraajan toimintakyvyn edistämisen kannalta. Tavoitteena oli kirjallisuuskatsauksen ja tapausesimerkin avulla luoda kattava kokonaisuus käden pakotetun käytön kuntoutuksesta. Lähdeaineistona käytettiin uusimpia aiheeseen liittyviä tutkimuksia, monipuolista kirjallisuutta sekä tapausesimerkin henkilökohtaisia tiedonantoja. Opinnäytetyössä...

Verkkomainonta

OpenAIRE

Taipalus, Lauri

2011-01-01

Työn tarkoituksena oli selvittää yritysten asenteita verkkomainontaa kohtaan, sekä verkkomainonnan käyttöä yrityksissä. Ensimmäisenä tavoitteena oli perehtyä verkkomainonnan eri muotoihin. Toisena tavoitteena oli toteuttaa tutkimus yritysten verkkomainonnan käytöstä. Teoreettisessa viitekehyksessä perehdyttiin siihen, mitä verkkomainonta pitää sisällään, ja mikä on verkkomainonnan osuus koko mainoskakusta. Tarkemmin teoriassa tutustuttiin erilaisiin tapoihin mainostaa verkossa. Käsitellyt...

Modelo teórico e experimental da reciclagem do Carbono-13 em tecidos de mamíferos e aves Theorical and experimental model for Carbon-13 turnover in mammalian and avian tissues

Directory of Open Access Journals (Sweden)

Carlos Ducatti

2002-03-01

Full Text Available A diferença entre fontes alimentares da ordem de 14‰, originárias de plantas com ciclos fotossintéticos Carbono-3 (C3 e Carbono-4 (C4 e seus subprodutos, abre novas perspectivas para o estudo do metabolismo do carbono em aves e animais de pequeno porte. Os autores propõem um modelo teórico e experimental capaz de exprimir os resultados de enriquecimento relativo, delta per mil (delta‰ da razão 13C/12C versus tempo em diferentes tecidos. Utilizou-se a equação y(t = (y0 -- q/k e-kt + q/k onde, y(t é a concentração isotópica no tempo desejado, y0 a concentração isotópica inicial existente no tecido, k é uma constante de troca isotópica com unidade 1/tempo, t é unidade de tempo e q é a taxa de entrada de metabólitos que contém carbono, com valores de delta‰/tempo. Para fígado de galinhas que tiveram a ração de ciclo fotossintético C4 substituída por dieta C3 obteve-se a equação delta13C = -24,74‰ + 12,37‰ e-0.237(nT, com meia-vida (T de 2,9 dias. O patamar de equilíbrio de substituição do carbono foi alcançado em --24,48‰, de modo que praticamente 98,4% do conteúdo isotópico do C4 no fígado foi substituído por C3 após 5,6 meias-vidas. O modelo foi adequado para determinar o tempo de reciclagem total ou parcial da concentração de carbono nos tecidos em estudo.Food source differences of about 14‰ from plants with carbon-3 (C3 and carbon-4 (C4 photosynthetic cycles and their derived products make carbon metabolism studies possible in birds and small mammals. The authors suggest a theorical and experimental model for determining the relative enrichment results, delta per thousand (delta‰ of the 13C/12C ratio as a function of time for different tissues. The following equation was used: y(t = (y0 -- q/k e-kt + q/k where, y(t is the isotopic concentration at time t, y0 is the initial isotopic concentration in the tissue, k is the turnover constant expressed in 1/time, and q is the input of metabolites

Chapter 4: Northern spotted owl habitat and populations: Status and threats

Science.gov (United States)

Lesmeister, Damon B.; Davis, Ramond J; Singleton, Peter H; Wiens, David

2018-01-01

The northern spotted owl (Strix occidentalis caurina) was listed as threatened under the Endangered Species Act in 1990 (USFWS 1990). Providing adequate amounts of suitable forest cover to sustain the subspecies was a major component of the first recovery plan for northern spotted owls (USFWS 1992) and a driver in the basic reserve design and old-forest restoration under the Northwest Forest Plan (NWFP, or Plan) (USDA and USDI 1994). The reserve design included large contiguous blocks of late-successional forest, which was expected to be sufficient to provide habitat for many interacting pairs of northern spotted owls. As such, the selection of reserves generally favored areas with the highest quality old-growth

Abundância química de simbióticas na direção do bojo galáctico

Science.gov (United States)

Luna, G. J. M.; Costa, R. D. D.

2003-08-01

O estudo da distribuição de metalicidades de gigantes K no Bojo indica um largo intervalo com valores entre 0.1 a 10 vezes o valor solar. As razões elementais Ca/Fe, Si/Fe, Mg/Fe são típicas de estrelas do halo, apontando para um processo rápido de enriquecimento, via estrelas masssivas (SN's tipo II). No entanto, este cenário não combina com os resultados derivados de nebulosas planetárias do bojo tais como os de Ratag et al. (1992, A&A,255,270), Cuisinier et al.(2000, A&A,353, 543), Escudero e Costa (2001, A&A,380, 300),que obtêm abundâncias análogas às do disco. Neste cenário, o estudo de estrelas simbióticas possibilita uma abordagem particularmente apropriada para o problema das abundâncias químicas de estrelas de massa intermediária em estágios avançados da evoluçao estelar. Apresentamos aqui os resultados da determinacão das abundâncias do grupo do CNO numa extensa amostra de simbióticas do bojo. Aliás, com a disponibilidade de espectros no visível determinamos também abundâncias de Ar, Ne, S e He, fundamentais para analisar os processos de enriquecimento químico ocorridos ao longo da evolução estelar, bem como a evolução química do meio interestelar. Com os espectros UV do satelite IUE obtivemos abundâncias de C, necessárias no estudo da evolução dos sistemas. As relaçoes C/N-O/N mostram que o material nebular é produto do vento da componente gigante e não dos eventos de nova que às vezes acontecem nestes sistemas, como foi mostrado por Nussbaumer et al (1988,A&A,198,179). As abundâncias de Ar, S, Ne e O são compativeis com resultados de fontes no disco e bojo, seguindo o gradiente proposto por muitos autores na literatura a partir de diferentes objetos como cefeidas, nebulosas planetárias e anãs G. (CAPES,FAPESP,CNPq)

Green Factor -työkalun kehittäminen vanhoille, täydennysrakennettaville asuinalueille : - Case Kaukovainio

OpenAIRE

Pehkonen, Leena

2015-01-01

Tämä opinnäytetyö on tehty Ympäristöministeriön rahoittaman Tulevaisuuden Kaukovainio -hankkeen KAKETSU (Kaukovainion kestävä tulevaisuus) -osahankkeelle. KAKETSU -hankkeen tavoitteena on kehittää asukaslähtöistä suunnittelua, ekologisten suunnitteluratkaisujen sekä viheraluesuunnittelua palvelevien mallien löytämistä. Opinnäytetyössä tutkittiin Green Factor -laskentamenetelmän käyttökelpoisuutta Kaukovainion asuinalueella, laskentamenetelmän yksittäistä elementtiä tai asiaa korostavan ...

What makes a beautiful website? : factors influencing perceived website aesthetics

OpenAIRE

Noponen, Sampo

2017-01-01

Verkkosivujen estetiikka on merkittävä osa sivustojen käyttäjäkokemusta. Kauniiksi mielletty sivusto vaikuttaa positiivisesti verkkosivun käytöstä johtuneeseen kokonaisvaltaiseen kokemukseen. Estetiikkaa on paljon tutkittu ihmisen ja tietokoneen välisessä vuorovaikutuksessa, sekä hieman myös tietojärjestelmätieteen saralla. Tästä huolimatta ei ole olemassa yleisesti hyväksyttyjä periaatteita, miten suunnitella kauniita verkkosivustoja. Täten tässä tutkimuksessa selvitettiin mitkä tekijät vaik...

Kehitysehdotusten tuottaminen palvelupolun parantamiseksi - Case Expert ASA Oy

OpenAIRE

Berg, Esa

2011-01-01

Kodintekniikka-alan kiristyvä kilpailutilanne ja maailmantalouden epävakaat ajat vaativat alalla toimivilta yrityksiltä keinoja löytää kilpailuetuja verrattuna muihin alan toimijoihin. Tämä tilanne johtaa siihen, että yritysten tulee entistä enemmän kiinnittää aitoa kiinnostusta asiakkaiden tarpeisiin ja toiveisiin, jotta yritys voisi palvella heitä paremmin. Tämän opinnäytetyön tavoitteena on ollut asiakkaan palvelupolun kehittämiseen tähtäävien kehitysideoiden tuottaminen Service ...

Linux sulautetuissa järjestelmissä.

OpenAIRE

AUTIO, HENRI

2003-01-01

Sulautettuja järjestelmiä löytää nykyään kaiken tyyppisistä laitteista, joihin törmäämme jokapäiväisessä elämässämme. Ne on tarkoitettu kustannustehokkaaksi ratkaisuksi tiettyyn ongelmaan ja niiden laitteisto on rakennettu nimenomaan tiettyä tarkoitusta varten ja vastaavasti ohjelmistopuolella sovellusohjelmat on suunniteltu hyödyntämään mahdollisimman tehokkaasti kyseisen laitteiston tarjoamia ominaisuuksia. Suurimmaksi ongelmaksi, jota vastaan sulautettujen järjestelmien suunnittelijat...

Työnopastuksen kehittäminen Varuskuntaravintola Kotkassa

OpenAIRE

Hälikkä, Mari-Anna

2016-01-01

Tämän opinnäytetyön tavoitteena oli kehittää työnopastusta Varuskuntaravintola Kotkassa. Leijona Catering Oy:llä on olemassa oma perehdyttämisrunko ja materiaali uuden työntekijän yleiseen perehdyttämiseen ja koko organisaation toimintaan, mutta Varuskuntaravintola Kotkan kirjallinen materiaali toimipaikkakohtaiseen työnopastukseen oli puutteellinen ja osittain vanhentunut. Tässä työssä laadittiin toimeksiantajalle, Varuskuntaravintola Kotkalle, työnopastuksen käytäntöä tukeva työnopastusmate...

24 Pesulan seurantaohjelmisto

OpenAIRE

Lumme, Tristan

2017-01-01

Insinöörityö tehtiin 24 Pesula Oy:n projektista, joka suoritettiin Helsingissä. Projektin tarkoituksena oli luoda sovellus listaamaan yrityksen toimipisteiden koneet ja niiden käyttökerrat automatisoidusti tietokantaan. 24 Pesula Oy on vuonna 1999 perustettu yritys ja Suomen ainoa itsepalvelupesulaketju. Aikaisemmin koneiden käytönseuranta hoidettiin siten, että käyttödata haettiin paikan päältä lukemalla yksittäisten koneiden lokitiedot. Yrityksen koneissa käytettiin myös Atmelin modifio...

Kerää Disney Klassikot -kampanja : Verkkokauppa hypermarketin haastajana

OpenAIRE

Sarajisto, Mari-Susanna

2015-01-01

Tämän opinnäytetyön tarkoituksena oli tutkia Disney Klassikot –keräilykampanjaa 2015, keskittyen Suomen ensimmäiseen kvartaaliin Q1. Työn toimeksiantaja toimi The Walt Disney Company Nordic Suomen toimisto. Opinnäytetyön tavoitteena oli tuottaa toimeksiantajalle tietoa kampanjatoteutuksista ja Disney-brändin vaalimisesta valituissa jakeluteissä. Ensimmäistä kertaa Disney kampanjan kohdalla jakelutiet pääsivät vaikuttamaan kampanjatoteu-tukseen. Tutkimuksen tarkoituksena oli löytää uutta tutki...

Instagram-kuvaohjeisto brändille : Instagram muotimarkkinoinnin välineenä

OpenAIRE

Tolkki, Enni

2016-01-01

Opinnäytetyössä tutkittiin Instagramia muotimarkkinoinnin välineenä vuonna 2016. Tarkoituksena oli löytää vastaus siihen, millaiset Instagram-kuvat olisivat tehokkaimpia pohjoismaisia vapaa-ajanvaatteita tarjoavan muotibrändin markkinointitarpeisiin. Tutkimuksessa etsittiin keinoja, joilla aktivoida useampia brändin seuraajia tykkäämään kuvista, sekä tehtyjen parannusten myötä kasvattaa asiakkaan seuraajamäärää ja asiakaskuntaa. Tutkimusmenetelminä työssä olivat benchmarking ja kuva-analy...

Vähittäismyymälän markkinoinnin kehittäminen : case Mattomies Oy

OpenAIRE

Hellstén, Maren

2015-01-01

Opinnäytetyön tavoitteena oli löytää toimeksiantajana toimineelle Mattomies Oy Ruohola & Ruoholalle konkreettisia keinoja yrityksen vähittäismyymälän markkinoinnin kehittämiseksi. Teoriaosassa käytiin läpi 4P-mallin mukaiset markkinoinnin kilpailukeinot. Toteutusosassa analysoitiin Mattomies Oy Ruohola & Ruoholan myymälän nykytilaa, myymälän merkitystä liiketoiminnalle sekä koottiin myymälälle markkinointimix, jossa annettiin konkreettisia ehdotuksia markkinoinnin kehittämiseksi. Ehdo...

Opiskelijanuorten mielipiteitä verenluovutuksesta, verenluovutusta edistäviä ja estäviä tekijöitä Mikkelin ammattikorkeakoulun opiskelijoiden kokemana

OpenAIRE

Pöyry, Jenni

2013-01-01

Opinnäytetyö tehtiin Suomen Punaisen Ristin Veripalvelulle. Opinnäytetyön tarkoituksena oli selvittää Mikkelin ammattikorkeakoulussa eri koulutusohjelmissa opiskelevien nuorten mielipiteitä verenluovu-tuksesta. Työn tavoitteena oli löytää tekijöitä, joihin huomiota kiinnittämällä Veripalvelun olisi mahdol-lista rekrytoida uusia nuoria verenluovuttajia. Verenluovutus on Suomessa vapaaehtoista ja tällä hetkellä verentarve ja tarjonta ovat tasapainossa. Kui-tenkin ikääntyvä väestö, ihmisten ...

Elektroninen kompassi

OpenAIRE

Moisio, Petri

2014-01-01

Tämän opinnäytetyön aiheena oli elektronisen kompassin suunnittelu ja toteutus sulautettuun järjestelmään. Työ tehtiin Trelab Oy:lle, joka suunnittelee ja valmistaa seuraavan sukupolven langattomia mittalaitteita. Kompassi oli suunniteltava siten, että se toimisi osana Trelabin Oloni-järjestelmää ja täyttäisi yrityksen vaatimukset langattoman mittalaitteen ohjelmiston suhteen. Koska varsinainen mittalaite sensoreineen oli jo olemassa, elektronisen kompassin toteuttaminen oli käytännössä ohjel...

Time-Reversal Based Range Extension Technique for Ultra-Wideband (UWB) Sensors and Applications in Tactical Communications and Networking

Science.gov (United States)

2008-10-16

signal from the signal generator is also used to synchronize DSO to record the data of the received signal. The tapped -delay-line model of CIR will...between each filter tap . The output y(t) — h(t) *x(t) is then uniformly sampled with sampling period Ts. 1 ’s follows the relation Ta/Th — q, where q... eft ) ProbtagPake ^ p(l> ’HO PriHretuHg Figure 5.5: An equivalent block diagram of channel estimation The success of recovery relies on the

Varainhoitopalveluiden edut ja haitat piensijoittajalle verrattuna suoriin osakesijoituksiin

OpenAIRE

Viitanen, Mikko

2014-01-01

Rahoitusmarkkinoilla yleisen alhaisen korkotason vuoksi moni suomalainen miettii vaihtoehtoa tilisäästämiselle ja määräaikaan sidotuille korkeakorkoisille tileille. Tämän opinnäytetyön tarkoituksena on tarjota tietoa suhteellisen uusien varainhoitopalveluiden hyödyistä ja haitoista piensijoittajalle. Työssä vertaillaan suoraa osakesijoittamista ja varainhoitopalveluita piensijoittajan kannalta. Työn tuloksena pyritään löytämään hyötyjä ja haittoja varainhoitopalveluista suoriin osakkeisi...

Palkkahallinnon toimintatapojen tehostaminen päätöksenteon ilmiöitä hyödyntäen

OpenAIRE

Kosonen, Virpi

2017-01-01

Opinnäytetyön tavoitteena on löytää keinoja palkkahallinnon toimintatapojen tehostamiseen. Palkkahallinto joutuu työskentelemään jatkuvasti tiukkojen aikataulujen puitteissa. Työntekijöiden palkat on saatava ajallaan ja oikein työntekijöiden tileille. Heti, kun palkat on saatu pankkiin, on ne myös ajettava kirjanpitoon tietyn aikataulun mukaan ja tehtävä viranomaisille tarvittavat tilitykset, kuten ennakonpidätys-, sotu-, jäsenmaksu- ja ulosottotilitykset. Koska kaikilla toimenpiteillä on oma...

Alumnitoiminnan kehittäminen

OpenAIRE

Linko, Susanna

2016-01-01

Tämän opinnäytetyön toimeksiantaja oli Lahden ammattikorkeakoulu. Opinnäytetyön tarkoitus oli selvittää alumnitoiminnan parhaimmat ja toimivimmat käytänteet suomalaisissa ammattikorkeakouluissa ja yliopistoissa sekä miten ja millä keinoin alumnitoiminta Lahden ammattikorkeakoulussa saadaan aktiiviseksi. Tuloksia hyödynnetään alumnitoiminnan aloittamiseksi, ylläpitämiseksi ja kehittämiseksi sekä opiskelijoiden sitouttamiseksi alumneiksi jo opintojen aikana. Erittäin tärkeänä osana alumnitoimin...

The eSourcing Capability Model for Service Providers: Knowledge Manage-ment across the Sourcing Life-cycle

OpenAIRE

Laaksonen, Pekka

2011-01-01

Laaksonen, Pekka The eSourcing Capability Model for Service Providers: Knowledge Manage-ment across the Sourcing Life-cycle Jyväskylä: Jyväskylän yliopisto, 2011, 42 s. Tietojärjestelmätiede, kandidaatintutkielma Ohjaaja(t): Käkölä, Timo Tässä kandidaatintutkielmassa selvitettiin sitä, miten the eSourcing Capability Model for Service Providers-mallin käytännöt (practices) ovat liittyneet tietä-myksenhallinnan neljään prosessiin: tiedon luominen, varastointi/noutaminen, jakamine...

Jännityselokuvan dramaturgia

OpenAIRE

Kaukiainen, Emma

2011-01-01

Opinnäytetyö käsittelee elokuvan dramaturgiaa. Työ koostuu elokuvatutkimuksesta ja liitteenä olevasta omasta elokuvakäsikirjoituksesta. Tutkimus keskittyy rikos- ja jännitys-elokuvien genreen, erityisesti trillereihin. Tarkastelen genrelle tyypillisiä juonikuvioita, aiheita, rakenteita ja tapoja luoda jännitystä. Työn tarkoituksena on pohtia, miten genrekonventioita voi käyttää hyväkseen oman käsikirjoituksen tekemisessä. Käytän lähdeaineistona genren elokuvia sekä käsikirjoitusta ja elokuvaa...

Prosessijätevesien puhdistaminen flotaation avulla

OpenAIRE

Autio, Antti

2010-01-01

Flotaatio on yleisesti käytössä oleva jätevesien puhdistusmenetelmä, jossa käsiteltävään jäteveteen puhalletaan ilmakuplia, jolloin jätevedessä olevat kiintoaineet törmäilevät ilmakupliin ja tarttuvat toisiinsa. Ilmakuplat nostavat partikkelit pintaan, mistä ne poistetaan ylitteenä, ja kirkastettu vesi jatkaa alitteena eteenpäin. Flotaatiota voidaan tehostaa erilaisilla lisäaineilla, jolloin saavutetaan parempia tuloksia aineiden tai niiden yhdistelmien mukaan. Työn toimeksiantajana toimi OMG...

Lihan kahden jalostusasteen laadullinen ja kustannuksellinen vertailu Käpylän palvelukeskuksen ruokapalvelussa

OpenAIRE

Ikonen, Mika

2006-01-01

Tämä opinnäytetyö vertailee lihan jalostusasteiden, raaka ja kypsä, kustannuksia ja laadun ja työmenetelmien eroavaisuuksia. Tutkimuksen kohteena on seitsemän vastaavaa lihatuotetta kummastakin jalostusasteesta. Tarkoituksena on selvittää jalostusasteiden käytännöllisyys ruokapalvelussa. Teoriaosassa selvitetään ruokatuotantoprosessin kulkua ja työmenetelmiä lihaa käytettäessä ruokapalvelussa. Teoriakehyksessä selvitetään myös kustannuksien muodostuminen kypsennettäessä. Lihaan vaikuttavat la...

Tietoisuustaitoihin perustuvat menetelmät toimintaterapiassa : kirjallisuuskatsaus

OpenAIRE

Norring, Jaana

2013-01-01

Tämän opinnäytetyön tarkoituksena oli helpottaa tietoisuustaitoihin perehtyneen suomalaisen toimintaterapeutin mahdollisuutta ottaa tietoisuustaidot terapiakäyttöön. Opinnäytetyö selvittää, miten tietoisuustaitoja on käytetty toimintaterapian asiakastyössä. Siinä esitetään tietoa siitä, mitä tietoisuustaitoihin perustuvia menetelmiä on tutkittu toimintaterapiassa ja minkä asiakasryhmien parissa tutkimusta on tehty sekä arvioidaan tutkimusten näytön tasoa. Opinnäytetyö toteutettiin integro...

1800-LUVUN LOPUN SEINÄPUHELIMEN RESTAUROINTI

OpenAIRE

Ranta, Heidi

2011-01-01

Ensimmäinen patentti puhelimelle myönnettiin vuonna 1876 Alexander Graham Bellin ansiosta. Siitä lähtien puhelimen kehitys on ollut todella nopeaa. Puhelinta alettiin heti kehittää toimivammaksi ja käytännöllisemmäksi. Ei aikaakaan kun puhelin levisi sen kotimaasta, Amerikasta, mantereen yli Eurooppaan. Suomeen uutinen kiri jo samana vuonna, kun puhelin keksittiin ja vuonna 1877 myös Suomessa käytiin ensimmäinen puhelinkeskustelu. Suomi on ollut yksi maailman kärkimaista puhelintoimen alalla....

Anniskelun palvelukäsikirja Kaukametsän tilausravintoloille

OpenAIRE

Tervo, Jukka-Pekka

2007-01-01

Kaukametsän ravintolat on Kajaanin Mamselliin kuuluva ravintolayksikkö, joka toimii pääsääntöisesti tilausravintolana. Kajaanin Mamsellin laatiman Laatukäsikirjan mukaan jokaisen Mamsellin omistaman ravintolan on suunniteltava toimipisteelleen palvelukäsikirja, jonka mukaan toimipisteessä toimitaan. Tässä opinnäytetyössä tarkoituksena oli kehittää ja tarkentaa Kaukametsän ravintolan palvelukäsikirjan alkoholijuomia koskevaa kohtaa paremmin käytännön työtä palvelevaksi. Erityise...

Tulevaisuuden rekrytointimenetelmät

OpenAIRE

Tuomi, Janna; Lehtonen, Linda

2014-01-01

Rekrytointiala muuttuu vauhdilla ja näin ollen uusia keinoja saavuttaa potentiaaliset työnhakijat tulee koko ajan lisää. Internetin sekä sosiaalisen median käytön lisääntyessä uusille rekrytointikanaville aukeaa koko ajan uusia mahdollisuuksia. Uudet ja vanhat kanavat tasapainottelevat keskenään, tavoitteenaan saada irti se hyöty, mitä uudet mahdollisuudet tuovat mukanaan Opinnäytetyössä tutkittiin erilaisia rekrytointikeinoja ja pyrittiin saamaan kokonaisvaltainen kuva siitä mitä rek...

Structures to Resist the Effects of Accidental Explosions

Science.gov (United States)

1969-06-01

a VL tan Oily an12 L tan 120Lytn tn2 2L ta (ta L120\\12 L tannfv+G tan tan Ltan-~n&ý 12 YtAn12*+(H-y)tafl12o.tn-8 t~Fl..i. I H - tae+(- fta ~v-tn y/L7" 2...ONE SIDE FRE I d) FOUR SIDES SUPPORTED Fgw -. ipcLIci., fmd iea d deine. l cing. 1: 77 9~#4 󈧄 HORIZ. / HORI. LVERTuw l I [ VERT. IR EDA OE SE F VER

Yksisivuisten web-sovellusten kehittäminen Angular 2 -sovelluskehyksellä

OpenAIRE

Kujala, Miika

2016-01-01

Yksisivuiset web-sovellukset ovat yleistyneet viime vuosina. Niiden kehityksessä hyödynnetään usein JavaScript-sovelluskehystä. Angular 2 on Google:n kehittämä JavaScript-sovelluskehys. Tämän tutkielman tavoitteena on tarkastella Angular 2 -sovelluskehystä ja sen soveltuvuutta yksisivuisten web-sovellusten ke- hityksessä. Tutkielmassa käydään läpi Angular 2 -sovelluskehyksen ominaisuuksia sekä Angular 2 -sovelluskehyksen käytössä ilmeneviä etuja ja haittoja.

TOIMINNANOHJAUSJÄRJESTELMÄN VAIHTO HAANPAAN EAST-LIIKETOIMINTAYKSIKÖN NÄKÖKULMASTA

OpenAIRE

Aarnikoivu, Lasse; Rantanen, Johanna

2012-01-01

Työn tarkoituksena oli selvittää ja pohtia kansainvälisen logistiikka-alan yrityksen toiminnanohjausjärjestelmän vaihdon syitä, hyötyjä, haittoja, käytännön toteutusta ja siihen liittyviä haasteita. Työ toteutettiin nestemäiseen logistiikkaan erikoistuneen Haanpaan East-liiketoimintayksikölle. Työn teoreettinen tarkastelu perustuu toiminnanohjausjärjestelmien teoriaan. Toiminnanohjausjärjestelmä eli ERP on integroitu, toiminnanohjauksessa käytetty tietojärjestelmä, jonka avulla yrityksen ...

Uusi sukupolvi X asiakkaana

OpenAIRE

Mannila, Katja

2012-01-01

Tämän opinnäytetyön tavoitteena on luoda uudelle yritykselle lähtökohdat asiakasstrategian tekemiseen. Käytännössä yritykselle valitaan markkinoille sopiva tapa segmentoida sekä potentiaalinen kohderyhmä, jota lähdetään syvällisemmin tutkimaan. Teoriaosissa käsitellään kaksi eri kokonaisuutta. Ensimmäisessä osiossa tutustutaan erilaisiin tapoihin segmentoida ja segmentoinnin merkitykseen liiketoiminnalle. Toisessa osassa otetaan kohteeksi itse kuluttaja ja pohditaan kulutuskäyttäytymisen s...

Kompostoidut kierrätysmateriaalit nurmikon perustamisessa

OpenAIRE

Aattela, Evita

2013-01-01

Opinnäytetyön aihe liittyy EU:n Life + -ohjelman hankkeeseen LCA in Landscaping eli Elinkaarianalyysin soveltaminen kestävään, kierrätysmateriaaleja hyödyntävään viherrakentamiseen. Hankkeen tavoitteena on elinkaarianalyysin käytön kehittämisen lisäksi selvittää uusien kierrätysmateriaalien käyttöä nurmikon perustamisessa ja hoidossa sekä esitellä uudenlaisia kierrätyspohjaisia materiaaleja ammattimaiseen viherrakentamiseen. Työn toimeksiantaja oli Maa- ja elintarviketalouden tutkimuskeskus (...

DirectX 11 -grafiikkamoottori ja BRDF-mallit

OpenAIRE

Niemi, Teemu

2017-01-01

Opinnäytetyön tavoitteena oli luoda grafiikkamoottori, jolla voidaan esitellä yleisempiä tietokonegrafiikassa käytettyjä BRDF-malleja. Työssä luotu grafiikkamoottori suunniteltiin niin, että sillä on helppo valita eri BRDF-malleja tarkastelua varten kevyen käyttöliittymän avulla. Toisena päätavoitteena työssä oli tutustua BRDF-mallien taustalla olevaan matematiikkaan sekä BRDF-mallien toteuttamiseen näytönohjaimessa suoritettavilla varjostinohjelmilla. Työn teoriaosassa kerrotaan BRDF-mall...

Paloauton ohjaus ohjelmoitavalla logiikalla

OpenAIRE

Mäkilä, Tero

2010-01-01

Paloautoja valmistetaan tarpeista riippuen pienistä pakettiautokokoluokan autoista isoihin säiliöautoihin. Toimilaitteiden lisääntyminen ja monimutkaistuminen ovat tuoneet mukanaan myös ohjaustarpeiden kasvamiseen. Tämän opinnäytetyön tarkoituksena oli suunnitella kosketusnäytöllä varustettu logiikkaohjaus kevytpaloauton järjestelmien ohjaukseen. Työn tuloksena saatiin logiikkaohjelma, joka ohjaan paloauton toimintoja, sekä käyttöpaneelin ohjelma, joka välittää käyttäjälle informaatio...

Partneriverkoston johtaminen osana hankinnan johtamista

OpenAIRE

Hyrynen, Katja

2010-01-01

Tämän opinnäytteen tarkoitus oli luoda kohdeyritykselle teorian kautta johdettu ajatusmalli ja työkaluja, joiden avulla partneriverkosto saadaan liitettyä sujuvasti osaksi hankintatoimen johtamista ja osaksi hankinnan ja koko yrityksen prosessia. Tavoitteena oli, että partneriverkoston johtamisen avulla pystytään mahdollisimman tehokkaasti löytämään omaa organisaatiota hyödyttävät tekijät, sekä taloudellista kehitystä että osaamispääoman kasvattamista tukevat. Partneriverkoston johtamis...

Ei haukku haavaa tee : koiran vaikutus lapsen toimintaan ja toiminnallisuuden kehitykseen

OpenAIRE

Ansamaa, Katariina; Kaitila, Emmi

2014-01-01

Eläinten vaikutuksesta ihmisen terveyteen ja hyvinvointiin on olemassa paljon tutkimuksia. Myös eläinavusteisesta terapiasta on tutkimuksia, mutta koira-avusteisen terapian tutkimustieto on vielä vähäistä. Toimintaterapiassa koiran avulla voidaan pyrkiä löytämään ja mahdollistamaan asiakkaalle arjen merkityksellisiä toimintoja. Tämän opinnäytetyön tarkoituksena oli kerätä tietoa lasten koira-avusteisesta toimintaterapiasta. Teoreettinen viitekehys muodostuu eläin- ja koira-avusteisen terapian...

Kuntien itsehallinnollinen asema kaavoituksessa

OpenAIRE

Prusi, Tuija

2013-01-01

Kuntien oikeutta ja velvollisuutta vastata maankäytön suunnittelustaan kutsutaan ”kaavoitusmonopoliksi”. Nykyisin käytetään myös käsitettä ”suunnittelumonopoli”, jota rajoittavat ensinnäkin rakennuslainsäädännön aineelliset, harkintaa rajoittavat säännökset, toiseksi valtakunnalliset alueidenkäyttötavoitteet ja kolmanneksi maakunnallisten suunnitelmien ohjausvaikutus. Maankäyttö- ja rakennuslaissa (MRL) on asetettu kuntatason kaavojen laatimiselle menettely- ja sisältövaatimukset, joita on as...

Film noir -elokuvien vaikutus 1950- ja 1960-lukujen suomalaiseen rikoselokuvaan

OpenAIRE

Seppänen, Nina

2010-01-01

Opinnäytetyössä tutkittiin, onko yhdysvaltalainen elokuvasuuntaus film noir vaikuttanut suomalaiseen 1950- ja 1960-lukujen rikoselokuvaan. Film noir –elokuvat ovat synkkäsävyisiä rikosdraamoja, joiden henkilögalleriaan kuuluu kovapintaisia yksityisetsiviä, vietteleviä femme fataleja ja murhanhimoisia rikollisia. Tutkimuksen tavoitteena on verrata kahta elokuvasuuntausta keskenään ja pyrkiä löytämään niiden erot ja yhtäläisyydet sekä syyt näille. Tutkimus suoritettiin kvalitatiivisin menet...

Prosessipuhdistusmenetelmät laivoilla

OpenAIRE

Karvali, Ville

2017-01-01

Prosessipuhdistusta käytetään laajasti teollisuuden tarpeisiin, mutta laivoilla sen käyt-tö rajoittuu laivan rakentamisen ja telakoinnin yhteyteen. Suuri tekijä tähän on tiedon puute erilaisista puhdistusmahdollisuuksista. Työssä selvitetään erilaisten työtapojen käyttömahdollisuuksia laivalla myös satamassa ja merellä ollessa. Tiedon lisääntyessä erilaisten puhdistusmahdollisuuksien käyttö helpottuu. Lähdemateriaalina prosessipuhdistusmenetelmille on käytetty toimeksiantajalta tullut-ta ...

Processo de enfermagem: seqüências no cuidar, fazem a diferença

Directory of Open Access Journals (Sweden)

Maria Angélica Mendes

2003-06-01

Full Text Available A ênfase desta investigação qualitativa foi conhecer o sistema de significados, com valores e crenças, no confronto do enfermeiro com a nova proposta metodológica do cuidar, em Instituição Hospitalar, na ótica desse profissional. Na coleta de dados utilizou-se da entrevista etnográfica e a análise de dados foi fundamentada nos estudos de James Spradley. Na imersão dos dados e abordagem de inventário emergiu o tema: "Colocar seqüências no cuidar faz a diferença" configurando-se como o ponto central deste estudo. Esta pesquisa proporcionou oportunidades de refletir sobre e desvendar uma atividade ainda nebulosa e reticente no palco da enfermagem brasileira, no sentido de levar os atores-enfermeiros a uma nova perspectiva de compreensão e ação sobre a metodologia assistencial.

Detection of Toxolasma gondii in captive wild felids.

Science.gov (United States)

Buddhirongawatr, Ruangrat; Tungsudjai, Siriporn; Chaichoune, Kridsada; Sangloung, Charoonluk; Tantawiwattananon, Nitipan; Phonaknguen, Rassameepen; Sukthana, Yaowalark

2006-01-01

Toxoplasma gondii can infect all species of warm-blooded animals, including humans, and causes serious diseases in immunocompromized hosts. Live tachyzoites derived from serial passage in HeLa culture were used in the Sabin-Feldman dye test for detection of Toxoplasma gondii antibody in serum samples of 21 captive wild felids including one fishing cat (Prion nailurus viverrina), one leopard (Panthera pardus), two flat-headed cats (Prion nailurus planiceps), 6 tigers (Panthera tigris), two leopard cats (Felis bengalensis), two clouded leopards (Felis nebulosa), 3 pumas (Puma concolor), and 4 jungle cats (Felis chaus). Antibodies to Toxoplasma gondii were founded in 9 of 21 felids (42.8%). This study revealed that cell culture-derived tachyzoites can be used successfully as a source of live organisms in a gold standard Sabin-Feldman dye test, which is simpler, cheaper and less ethically sensitive than in vivo inoculation.

A model stomach system to investigate disintegration kinetics of solid foods during gastric digestion.

Science.gov (United States)

Kong, F; Singh, R P

2008-06-01

Knowledge of the disintegration kinetics of food particulates in the human stomach is essential for assessing the bioaccessibility of nutrients in solid foods and understanding stomach emptying. The objective of this study was to develop a model stomach system and to investigate the kinetics of food disintegration. Our system consisted mainly of a turntable and a jacketed glass chamber containing simulated gastric juice in which plastic beads were added to simulate food particulates as well as provide a suitable mechanical destructive force on food samples. The mechanical force on the samples was simultaneously measured using the load cell of a TA-XT2 texture analyzer. Cylindrical carrots and ham samples were used as representative foods. The system is capable of simulating the in vivo stomach in terms of providing a wide range of continuous and periodic forces comparable to those measured in vivo. The modified power exponential function of the form y(t)= 1 - (1 -e(-kt))(beta), where y(t) is the mass retention ratio at time t, provided a reasonable description for the disintegration performance of tested foods. The mass retention curve can be either a sigmoidal decay with an initial delay or an exponential decay, which are decided largely by the hardness of the foods during digestion and the extent of physical force acting on the foods. A good match was observed between the kinetics of food disintegration and in vivo stomach emptying.

Yritysideasta yritykseksi

OpenAIRE

Kolmonen, Kimmo

2013-01-01

Tämä opinnäytetyö on uudenlainen portfolio-opinnäytetyö, missä opiskelija kerää opintojaksoilla, harjoittelun sekä opiskelijavaihdon yhteydessä tehtyjä tuotoksia eli projekti- tai muita oppimistehtäviä yhteen ja laatii niiden pohjalta kokoavan raportin, jonka liitteeksi tulevat tuotokset. Tämä opinnäytetyö käsittelee liiketoiminnan käynnistämisen prosessia käytännön esimerkin kautta. Opinnäytetyössä seurattava yritys on Personal Digiguide. Personal Digiguide -yrityksen yritysideana on tar...

Virtuaalitodellisuuden hyödyntäminen tapahtumissa

OpenAIRE

Emenike, Johannes

2017-01-01

Opinnäytetyöni on konstruktiivinen kehittämishanke, jonka tavoitteena on tutkia ja kehittää virtuaalitodellisuuden käyttöä erilaisissa tapahtumissa niin, että käytöstä saadaan tapahtuman järjestäjälle tai osallistuvalle yritykselle taloudellista hyötyä. Toisin sanoen tavoite on tuottaa toimintamalleja ja tunnistaa elementtejä, joiden avulla virtuaalitodellisuuden käyttöä tapahtumissa voidaan tehostaa järjestäjän tai osallistuvan yrityksen näkökulmasta. Työn tilaaja on suomalainen virtuaalitod...

Heisenberg Uncertainty Relation in Quantum Liouville Equation

Directory of Open Access Journals (Sweden)

Davide Valenti

2009-01-01

Fourier transform of the density matrix ρ(z,y,t = ψ∗(z,tψ(y,t. We find again that the variances of x and v obtained by using ρ(z, y,t are respectively equal to the variances of X^ and P^ calculated in ψ(x,t. Finally we introduce the matrix ∥Ann′(t∥ and we show that a generic square-integrable function g(x,v,t can be written as Fourier transform of a density matrix, provided that the matrix ∥Ann′(t∥ is diagonalizable.

Facebook ja tietoturva

OpenAIRE

Konttila, Jukka

2011-01-01

Insinöörityössä käsiteltiin sosiaalisia medioita, joista valittiin tarkempaan tutkimukseen yksi suosituimmista, Facebook. Tavoitteena oli tutustua Facebookin perusteisiin ja tutkia mahdollisia tietoturva- sekä muita ongelmia esimerkkitapausten kautta. Esimerkkien kautta esille tuotuihin ongelmiin oli tavoitteena löytää tai selvittää ratkaisu. Työssä selvitettiin sekä käyttäjän omaan toimintaan liittyviä riskitekijöitä että sellaisia ongelmia, joihin käyttäjä ei voi vaikuttaa Facebookin tur...

Lohkoketjuteknologian hyödyntäminen toimitusketjun hallinnassa

OpenAIRE

Risteli, Tuomas

2017-01-01

Insinöörityön tavoitteena oli tutkia lohkoketjuteknologiaa ja sen hyödyntämistä toimitusketjunhallinnassa. Tarkoituksena oli perehtyä kyseiseen aiheeseen ja löytää yhteys lohkoketjuteknologian ominaisuuksien ja toimitusketjunhallinnan ongelmien välillä. Perehtymisen jälkeen selvisi, että lohkoketjun hyödyntäminen parantaa läpinäkyvyyttä toimitusketjuissa ja siten lisää myös luottamusta osapuolten välille. Lohkoketjuteknologia on uudenlainen tapa tallentaa ja siirtää dataa, joka eliminoi t...

Speculations on niches occupied by fungi in the sea with relation to bacteria

Digital Repository Service at National Institute of Oceanography (India)

Raghukumar, S.

Yt.1JnJlTl-~.{l..::,'1-r'<.:nhdait,l()lJC::5 ~:§~~~qJ:onoon:=Br«:scttff~i~lt~9~~i)j-=-.T-~-=~~"-.------------------------------------------------------------------- --;;~~,Fell J Wino Master I M'1980 TheaSsOciafioii-aiid-potel1tfanoli--"of(ungi"u(~ngfoV:e-'de... of thraustochytrids and their subsequent growth within the cell lumen. Miller and Jones (1983) have observed thraustochytrids within the kelp, Fucus serratus L. Inspite of numerous reports, detailed studies on the role of thraustochytrids in the decomposition...

Lounaslistan kehittäminen ja markkinointi : Ravintola Huviretki Kuopio

OpenAIRE

Mehtonen, Heli

2017-01-01

”Markkinointi on vastuullinen, suhteisiin ja yhteisöllisyyteen pohjautuva ajattelu- ja toimintatapa, jonka avulla luodaan myyvä, kilpailukykyinen ja eri osapuolille arvoa tuottava tarjooma vuorovaikutteisesti toimien.” Yrityksen perustehtävänä on tuottaa voittoa omistajilleen ja markkinoinnin osuus tästä on lisätä myyntivolyymiä ja mahdollistaa parempi myyntikate. On tärkeää tuoda asiakaskeskeisyys käytäntöön eikä vain ajatella olevansa asiakaskeskeinen. Lisäksi on tärkeää saada asiakkaat ost...

YouTube osuuskaupan markkinointiviestinnässä

OpenAIRE

Lindevall, Tytti

2014-01-01

Tämän opinnäytetyön tavoitteena on luoda toimeksiantaja Suur-Seudun Osuuskauppa SSO:lle suunnitelma YouTuben hyödyntämiseksi markkinointiviestinnässään. Työn avulla on tarkoitus löytää keino, miten SSO voisi hyödyntää YouTubea markkinointiviestinnässään ja mitä asioita tulisi huomioida omaa kanavaa perustettaessa. Tarkoituksena on tuottaa raportti mahdollisista käyttötarkoituksista sekä ohjeistus oman kanavan perustamiseen ja hallinnointiin liittyvistä asioista. Työn alkupuolella taustoite...

RFID-tunnisteiden havaitseminen liikkuvasta ajoneuvosta : case: Fidera Oy

OpenAIRE

Artukka, Riku

2016-01-01

Tämän opinnäytetyön tarkoituksena on testata ja dokumentoida suoritettuja RFID- ajoneuvomittauksia eli ajoneuvojen ja henkilöiden automaattista tunnistusta hyödyntämällä RFID-tunnisteita. Opinnäytetyö on tehty toimeksiantona Fidera Oy:lle. Yrityksellä on jo käytössä automaattinen henkilötunnistusjärjestelmä, tarve olikin soveltaa samaa tekniikkaa ajoneuvojen ja niiden sisällä olevien henkilöiden tunnistukseen. Opinnäytetyön tavoitteena on luoda kuva RFID-tekniikan perusteista ja toimia s...

Korpikuusen kannon alla : Hahmosuunnittelun anatomia

OpenAIRE

Toivola, Laura

2012-01-01

Teksti on tutkimus hahmosuunnittelun metodeista ja siitä, mistä muodostuu ja kuinka luodaan ”hyvä” hahmo. Käytännön osiossa muunnetaan sarjakuvastripeissä käytetty hahmo tekijän alter egosta itsenäiseksi 3D-animaatiohahmoksi. Hahmon suunnittelu on jaettu kahteen osaan; hahmon taustan ja henkilöhistorian suunnitteluun sekä hahmon visuaalisen ulkomuodon ja habituksen luomiseen. Tekstissä käsitellään erilaisia näkökulmia, joita voi käyttää hyväkseen hahmoa luodessa ja pohditaan viitekirjal...

Selvitys hampaiden valkaisumenetelmistä

OpenAIRE

Seppälä, Stiina

2015-01-01

Tämä opinnäytetyö käsittelee hampaiden valkaisua sekä sen erilaisia menetelmiä. Hampaiden valkaisun suosio on kasvanut viime vuosien aikana huimasti. Hampaiden valkaisusta on kuitenkin ollut vaikea löytää luotettavaa, puolueetonta ja ajankohtaista tietoa, ja tämän työn tarkoituksena oli tarttua tähän ongelmaan. Työ on kirjallisuuskatsaus, joka toteutettiin etsimällä tietoa eri kirjallisuus- ja Internet-lähteistä. Uusia valkaisumenetelmiä tulee markkinoille koko ajan. Opinnäytetyössä pere...

Kuvaus 3D-tulostamisesta hammastekniikassa

OpenAIRE

Munne, Mauri; Mustonen, Tuomas; Vähäjylkkä, Jaakko

2013-01-01

3D-tulostaminen kehittyy nopeasti ja yleistyy koko ajan. Tulostimien tarkkuuksien kehittyessä 3D-tulostus on ottamassa myös jalansijaa hammastekniikan alalta. Tämän opinnäytetyön tarkoituksena on kuvata 3D-tulostamisen tilaa hammastekniikassa. 3D-tulostaminen on Suomessa vielä melko harvinaista, joten opinnäytetyön tavoitteena on koota yhteen kaikki mahdollinen tieto liittyen 3D-tulostamiseen hammastekniikassa. Tavoitteena on myös 3D-tulostimen testaaminen käytännössä aina suun skannaami...

Konepajatyön laadun vaikutus teräsrakenteen kuumasinkitykseen

OpenAIRE

Ahola, Kimmo

2008-01-01

Tämän opinnäytetyön aiheena oli Konepajatyön vaikutus teräsrakenteen kuumasinkitykseen. Lujien teräksien käytöllä saavutetaan säästöjä materiaalikustannuksissa ja valmistuksessa. Lopputuotteiden kapasiteettia käyttötarkoituksessa saadaan joissain tapauksissa nostettua. Uusimman sukupolven lujia teräksiä käyttämällä on mahdollista muotoilla yhä lujempia ja kevyempiä rakenteita. Muovattavien ja hitsattavien rakenneterästen myötölujuusluokka on saatu nostettua jo suuruusluokkaan 1000MPa. K...

Työntekijärekisterin luominen ja käyttöönotto

OpenAIRE

Kurkola, Matias

2010-01-01

Logistiikan turvallisuudesta huolehtiminen on tärkeä osa kuljetuksiin erikoistuneiden yritysten toimintaa. Yleisesti käytössä olevien turvallisuustyökalujen, kuten esimerkiksi kulunvalvonnan lisäksi toiminnan laatu vaatii tarkkaa henkilö- ja tavarakontrollia. Tämän opinnäytetyön tavoitteena oli luoda TNT Suomi Oy:n Turun toimipisteeseen helppokäyttöinen työntekijärekisteri, joka vähentäisi esimiesten työmäärää vapauttamalla resursseja henkilöstöhallinnosta varsinaiseen esimiestyöhön. Yrity...

Kuntouttavan korvaushoitoyksikön arviointimenetelmien kartoitus

OpenAIRE

Heinistö, Terhi; Vento, Tia

2015-01-01

Opinnäytetyön aiheena on asiakkaiden toimintakykyä mittaavien arviointimenetelmien kartoitus Helsingin Diakonissalaitoksen päihde- ja mielenterveystyön yksikön kuntouttavan korvaushoidon toimipisteessä. Pääpaino työssä on kartoittaa vastuuhoitajien käytössä olevia menetelmiä sekä toimintakyvyn osa-alueiden tarkemman arvioinnin tarvetta yksikössä. Lisäksi työssä etsitään uusia moniammatillisesti käytettäviä arviointimenetelmiä. Opinnäytetyön tuloksia voivat hyödyntää kuntouttavan korvaushoidon...

Ongelmajätepalveluiden toiminnanohjauskäsikirja

OpenAIRE

Helminen, Tapio

2011-01-01

Tässä opinnäytetyössä on pyritty luomaan toimiva ja käytännöllinen toiminnanohjauskäsikirja Lassila & Tikanoja Oyj:n Maalahden ongelmajätepalvelutoimipisteeseen. Tarkoituksena oli selvittää ja kerätä yleisimpien ongelmajätelajien käsittely ja tunnistamisohjeet yhteen, jotta kaikki ohjeet olisivat yhdessä paikassa ja helposti saatavilla. Työn teoriaosassa on perehdytty ongelmajätteen määrittelyyn, luokitteluun ja velvollisuuksiin ongelmajätteiden käsittelyprosessissa. Valtaosa ongelmajättei...

Hatefulle ytringer. Delrapport 3: Grenseoppgangen mellom ytringsfrihet og strafferettslig vern mot hatefulle ytringer

OpenAIRE

Wessel-Aas, Jon; Fladmoe, Audun; Nadim, Marjan

2016-01-01

De siste årene har hatefulle ytringer på internett fått økt oppmerksomhet i den offentlige debatten. Denne rapporten inneholder en juridisk utredning som har som formål å redegjøre for det strafferettslige vernet mot hatefulle ytringer, basert på gjeldende rett. Gjennomgangen synliggjør dessuten hvilke grupper som er gitt slikt vern. Et forbud mot hatefulle ytringer er et inngrep i ytringsfriheten. Spørsmålet om hvor grensen mellom ytringsfriheten og hva man skal slippe å tåle av hatefulle yt...

5S-toimintamallin kehittäminen nostintuotannossa

OpenAIRE

Laine, Atte

2017-01-01

TIIVISTELMÄ Opinnäytetyön aiheena oli kehittää 5S-toimintamallia Konecranes Finland Oy:n nostintuotannossa Hämeenlinnan nostintehtaalla. Konecranesilla käytetään Lean Six Sigma -menetelmiä prosessien ja liiketoiminnan kehittämiseen ja 5S-toimintamalli on yksi näistä Lean Six Sigmaan kuuluvista menetelmistä. Se on jo osittain käytössä Hämeenlinnan nostintehtaalla ja nyt tehtaan nostinkokoonpanoon oli saatava sama toimintamalli kuin muillakin tehtaan osastoilla. Opinnäytetyössä perehdyttiin...

Sähköinen palkkahallinto yrityksen, tilitoimiston ja palkanlaskijan kannalta

OpenAIRE

Majava, Tero

2010-01-01

Opinnäytetyön tavoitteena oli tutkia sähköisen palkkahallinnon vaikutuksia ja näkökulmia yrityksen, tilitoimiston ja palkanlaskijan kannalta verrattuna perinteiseen palkkahallintoon. Tarkoituksena oli kartoittaa sähköisen palkkahallinnon hyödyt ja haitat kaikista kolmesta eri näkökulmasta ja sitä, onko kannattavaa siirtyä sähköisen palkkahallinnon pariin. Tutkimus on tehty kvalitatiivista tutkimusmenetelmää käyttäen, pohjautuen kirjoituspöytätyöhön, tutkien ja analysoiden aiheeseen liitty...

Kehonkuvaa eheyttämässä - kehonkuva psykofyysisessä fysioterapiassa

OpenAIRE

Härkälä, Emilia

2014-01-01

Kuntoutuslainsäädännön mukaan fysioterapia kuuluu lääkinnälliseen kuntoutukseen, jonka tavoitteena on vaikuttaa ihmisen toimintakykyyn ja normaalin elämän edellytyksiin. Käytännössä ihmisen toimintakykyä arvioidaan sen mukaan, millaiset fyysiset, psyykkiset ja sosiaaliset edellytykset yksilöllä on selviytyä päivittäisistä toiminnoista ja askareista, kuten työstä, opiskelusta, sosiaalisista suhteista ja vapaa-ajan toimista. Toimintakyky on siis laaja käsite, ja tähän kuuluvat oleellisesti fyys...

Manipulaation merkit : tulkinta toisen maailmansodan propagandajulisteista semioottisen kuva-analyysin keinoin

OpenAIRE

Salohalla, Lassi

2014-01-01

Tämä opinnäytetyön tavoitteena on tarkastella toisen maailmansodan aikaisten propagandajulisteiden viestintää ja tutkia julisteiden välittämien viestien merkitysten muodostumista. Pyrkimyksenä on löytää propagandajulisteiden kuvituksista ja teksteistä viestinnällisiä piilomerkityksiä ja pohtia viestien lähettäjien päämääriä. Toisen maailmansodan aikaisilla propagandajulisteilla tässä työssä tarkoitetaan vuosien 1939 ja 1945 välillä sotamenestyksen tai kansantalouden edistämistarkoituksiin...

Median vaikutukset 0-12 -vuotiaiden lasten terveyteen ja hyvinvointiin : Kirjallisuuskatsaus

OpenAIRE

Paalimäki, Niina

2015-01-01

Digitaalinen media, kuten tietokone ja televisio, ovat nykyisin merkittävä osa lapsen arkipäivää iästä riippumatta. Lähes jokaisessa länsimaalaisessa perheessä on televisio ja lisäksi lapset altistuvat usein muullekin medialle, kuten videopeleille ja internetille, niin kotona kuin kodin ulkopuolella. Myös lehdet ja kirjat ovat edelleen osa lapsen mediaympäristöä. Mediankäytön lisääntymisen myötä media on entistä useammin noussut puheenaiheeksi eri konteksteissa ja viime aikoina etenkin lasten...

Social Phobia among Finnish Adolescents: Assessment, Epidemiology, Comorbidity, and Correlates

OpenAIRE

Ranta, Klaus

2008-01-01

Sosiaalisten tilanteiden pelko (STP) on ahdistuneisuushäiriö, jonka keskeisenä oireena on voimakas pelko joutua kielteisen arvioinnin kohteeksi sosiaalisessa tai esiintymistilanteessa. Häiriö johtaa kärsimykseen näissä tilanteissa ja usein sosiaalisten tilanteiden välttämiseen. Aiempi tutkimus viittaa siihen, että STP kliinisenä häiriönä kehittyy valtaosin nuoruusiän aikana, on kulultaan pitkäaikainen ja edeltää masennustilojen, myöhempien ahdistuneisuushäiriöiden ja päihteiden käytön puhkeam...

Luomulihan käyttö ammattikeittiöissä

OpenAIRE

Lehtinen, Markus

2012-01-01

Eettisien ja ekologisien arvojen huomioiminen elintarvikkeissa sekä niiden valmistuksessa ovat kasvaneet nykypäivänä kulutuksen myötä. Kuluttajat haluavat yhä enemmän tietää käyttämiensä elintarvikkeiden alkuperästä ja tuotantotavoista. Tutkimuksen tarkoituksena oli selvittää Portaat Luomuun -ohjelmassa olevien keittiöiden luomulihan käyttöä, halukkuutta luomulihan käytön lisäämiseen sekä asiakkaiden mahdollisia vaatimuksia. Lisäksi haluttiin selvittää, mitä luomulihatuotteita ammattikeit...

Sarjakuvan uudet muodot : Motion Comic ja Motion Novel

OpenAIRE

Lassila, Ilkka

2011-01-01

Sarjakuva on kehittynyt sen ensimmäisestä julkaisusta 1800-luvun lopusta huimasti vuoteen 2011. Tutkielmassa haluan tuoda esille, miten sarjakuva on viimeisen kahdenkymmenen vuoden aikana muuttanut muotoaan printatusta taiteesta digitaaliseen muotoon sekä miten se on löytänyt viimevuosien aikana myös uuden muodon, Motion Comicin, joka on eräänlainen elävä sarjakuva. Pohdin myös tämän uuden tekniikan tulevaisuuden näkymiä sekä ongelmia joita tämä uusi tekniikka joutuu kohtaamaan. Vaikka s...

Hoivayrittäjyys — yrityksen perustaminen ja neuvontapalvelut

OpenAIRE

Långstedt, Kyllikki

2013-01-01

Opinnäytetyön aiheenvalintaan vaikuttivat kiinnostukseni perustaa hoiva-alan yritys sekä osaltaan Laurean hallinnoiman yrityshautomon asiakaskyselyn tulokset. Tämän laadullisen opinnäytetyön tarkoituksena oli kuvata hoivayrittäjyyttä ja sitä, miten aloittava yrittäjä voi hyödyntää olemassa olevia yritysneuvontapalveluja. Tutkimuksen osaongelmina oli selvittää, mitä tukipalveluja toiminimellä aloittava hoiva-alan yrittämiseen tarvitsee, mistä yrittäjä löytää tietoa yrityksen perustamiseen ja m...

Aineenkoetuskoneen kehittäminen tutkimus- ja opetuskäyttöön

OpenAIRE

Lassila, Mika

2016-01-01

Tässä opinnäytetyössä tutustuttiin Centria-ammattikorkeakoulun konelaboratoriossa käytössä olevaan aineenkoetuskoneeseen ja sen käyttöön. Työssä käytiin lyhyesti läpi eri tyyliset aineenkoetuskoneet ja perehdyttiin tarkasti vetokokeeseen. Vetokoe on olennainen osa materiaalitekniikkaa ja sen avulla saadaan hyvin paljon tietoa eri materiaaleista ja kappaleista. Työssä käytiin läpi vetokokeen eri arvojen määrittäminen ja tutustuttiin vetokokeessa käytettäviin koesauvoihin. Aineenkoetuskonee...

Markkinointisuunnitelma Case: Ringetteseura Blue Rings

OpenAIRE

Seppälä, Minna

2012-01-01

Tämän opinnäytetyön tarkoituksena on markkinointisuunnitelman laatiminen ringetteseura Blue Ringsin edustusjoukkueelle. Lähtökohtana on pidetty suunnitelman toteutuskelpoisuutta käytännössä sekä suunnitelman reaalisuutta. Opinnäytetyö on toteutettu projektityönä, jossa on käytetty benchmarkkauksen lisäksi sekä kvalitatiivisia että empiirisiä tutkimusmenetelmiä. Opinnäytetyö koostuu kahdesta osiosta; teoreettinen viitekehys sekä empiirinen osio. Teoriana opinnäytetyössä on käytetty markkinoinn...

Pinterest affiliate-markkinoijan työkaluna

OpenAIRE

Ratilainen, Arto

2016-01-01

Opinnäytetyön tarkoituksena oli kartoittaa affiliate-markkinoijien Pinterestin käyttöä ja siitä saatuja tuloksia. Opinnäytetyö toteutettiin All About Dumbbellsille, joka harjoittaa affiliate-markkinointia. Tutkimuksessa haettiin vastauksia siihen, miten affiliate-markkinoijat käyttävät Pinterestiä, miten hyödylliseksi he kokevat sen ja miksi Pinterestin ulkopuolelle jääneet affiliate-markkinoijat eivät käytä sitä. Opinnäytetyön keskeisimmät teoriaosuudet olivat affiliate-markkinointi ja P...

Algebran ja geometrian yhdyskohtia lukio-opetuksessa ja kuution tilavuuden kahdentaminen

OpenAIRE

Tuohilampi, Antti

2012-01-01

Työ kertoo kuinka voimme kehittää lukio-opetuksessa algebran ja geometrian yhdyskohtia. Tämä on tarkoitettu lukion pitkän matematiikan analyyttisen geometrian kurssin yhteyteen, tai lisä materiaalina tämän jälkeen esimerkiksi matematiikka kerhoon. Kerron työssäni ensiksi geometrian aksioomista ja aksiomaattisesta todistamisesta. Seuraavaksi tutkin janojen suhteita, verrantoja ja kolmion sivujen suhteita. Jatkan tästä kuution tilavuuden tuplaamiseen. Tarkoituksena on löytää tapa esittää nämä a...

Manufacturing leisure - Innovations in happiness, well-being and fun

OpenAIRE

Pantzar, Mika; Shove, Elizabeth

2005-01-01

Kulutus ja vapaa-ajan talous ovat nousseet useissa länsimaissa elinkeinopoliittisen keskustelun huomion kohteeksi viime vuosina. Talouden kasvu on nähty yhä enemmän tapahtuvan ns. elämystalouden ja viihdeteollisuuden virittämänä. Manufacturing leisure - Innovations in happiness, well-being and fun lähestyy vapaa-ajan klusteria kuluttajien vapaa-ajan käytäntöjen näkökulmasta. Saksalaiset, englantilaiset ja suomalaiset tutkijat pyrkivät vastaamaan muun muassa seuraaviin kysymyksiin: · Minkälais...

Ravintola Xn markkinointisuunnitelma : Nykytilan kartoitus ja kehitysideoita

OpenAIRE

Koivunen, Saara

2015-01-01

Tämän työn tarkoitus oli kartoittaa koulu Yn opetusravintola Ravintola Xn markkinoinnin nykytilanne ja etsiä siihen uusia näkökulmia kehitysehdotusten avulla. Työn tavoitteena oli luoda ravintolalle sen toiminta-ajan ensimmäinen käytännön markkinointisuunnitelma, jota ravintolan johto voi käyttää työkalunaan. Suunnitelmassa keskityttiin ulkoiseen markkinointiin ja painotettiin valittuja kilpailukeinoja, jotka pohjautuvat 5P-malliin. Työ toteutettiin tutkimuksellisena kehittämistyönä lähes...

Ostotoiminnan laadunvarmistus ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä

OpenAIRE

Hiltunen, Jarmo

2012-01-01

Opinnäytetyön aiheena oli ostotoiminnan laadunvarmistuksen ja toiminnanohjauksen kehittäminen Mantsinen Group Ltd Oy:ssä. Työssä on perehdytty erityisesti niihin ostotoiminnan laadun kehittämisen haasteisiin mitkä liittyvät alihankintaostamisen osa-alueeseen. Opinnäytetyön päätavoitteena oli luoda työkaluja hankinnan laadun jatkuvan parantamisen avuksi. Lisäksi tavoitteena oli perehtyä hankintojen mittaamisen teoriaan. Opinnäytetyön tutkimusmenetelmänä on käytetty käytännön tietoa ostam...

MEDRIAN VEL’PHONE-POIKIMASENSORIN TARVE SUOMESSA

OpenAIRE

Hulkko, Karoliina

2015-01-01

Tämä opinnäytetyö tehtiin FABAn toimeksiannosta esiselvityksenä ranskalaisen Medria Technologies SAS -yhtiön poikimasensorin tarpeesta suomalaisilla nautakarjatiloilla. Opinnäytetyössä oli yhteistyössä myös Finnlacto Oy, joka ryhtyi maahantuojaksi opinnäyteprosessin aikana. Teoreettinen viitekehys sisältää tietoa Medrian poikimasensorista, tietojärjestelmästä, ohjelmiston käytöstä, poikimasensorin asennuksesta ja käyttöönotosta ja kannattavuudesta. Opinnäytetyössä selvitettiin poikimasens...

Terveydenhoitaja lapsen fyysiseen kaltoinkohteluun puuttujana

OpenAIRE

Piilola, Marianne; Valli, Marja-Liisa

2011-01-01

Opinnäytetyön tarkoituksena oli selvittää, mitä lastenneuvolan ja alakoulun terveydenhoitaja tekee, kun hänellä herää epäily lapsen fyysisestä kaltoinkohtelusta. Opinnäytetyössä tutkittiin, mitä puuttumisen keinoja on, mitä terveydenhoitajat niistä tietävät sekä mikä estää tai edistää puuttumista. Lisäksi tutkittiin onko Vaasassa käytössä toimintamalli lapsen fyysiseen kaltoinkohteluun puuttumisessa. Tutkimus oli luonteeltaan kvalitatiivinen, mutta muutaman kysymyksen osalta myös kvantita...

Integration of non-Gaussian fields

DEFF Research Database (Denmark)

Ditlevsen, Ove Dalager; Mohr, Gunnar; Hoffmeyer, Pernille

1996-01-01

The limitations of the validity of the central limit theorem argument as applied to definite integrals of non-Gaussian random fields are empirically explored by way of examples. The purpose is to investigate in specific cases whether the asymptotic convergence to the Gaussian distribution is fast....... and Randrup-Thomsen, S. Reliability of silo ring under lognormal stochastic pressure using stochastic interpolation. Proc. IUTAM Symp., Probabilistic Structural Mechanics: Advances in Structural Reliability Methods, San Antonio, TX, USA, June 1993 (eds.: P. D. Spanos & Y.-T. Wu) pp. 134-162. Springer, Berlin...

Web-sovelluskehityksen tekniikat

OpenAIRE

Kettunen, Werner

2015-01-01

Web-sovelluskehitykseen käytettäviä tekniikoita, työkaluja ja ohjelmakirjastoja on olemassa useita erilaisia ja niiden lähestymistapa web-sovelluskehitykseen poikkeaa jonkin verran toisistaan. Opinnäytetyössä selvitetään teoriassa ja käytännön esimerkkiprojektin avulla yleisimmin web-sovelluskehityksessä käytettyjä tekniikoita ja kirjastoja. Työssä esimerkkinä luodussa web-sovelluksessa käytettiin Laravel-ohjelmakehystä ja alkuosassa käsiteltyjä työkaluja ja kirjastoja, kuten Bootstrap ja ...

Peitattujen teräslevyjen korroosiosuojauksen kehittäminen

OpenAIRE

Pulli, Mikko

2012-01-01

Tämän opinnäytetyön toimeksiantaja on Ruukki Metals Oy. Peitattujen teräslevyjen korroosiosuojauksen kehitystarpeet tekivät opinnäytetyön tekemisen aiheelliseksi. Työn tavoite oli löytää korroosiota aiheuttavat tekijät teräslevyjen varastoinnin ja kuljetuksen aikana sekä valita tai kehittää tarvittavat parannukset korroosiosuojaukseen ja pakkaamiseen. Käytettävä tietoperusta saatiin Ruukki Metalsin tuotannon ja tutkimuskeskuksen henkilöstöltä, OAMK:n Raahen kampuksen ja Ruukki Metalsin Raahen...

Tuotannon layoutin suunnittelu Flinkenberg OY:lle

OpenAIRE

Puotiniemi, Olli

2013-01-01

Opinnäytetyön aiheena on layoutsuunnittelu Flinkenberg Oy:lle. Yrityksen on tarkoitus tulevaisuudessa hankkia uusi työstökone nykyisiin toimitiloihin. Siitä seurasi tarve saada uusi layoutsuunnitelma tuotantohallista vanhan tilalle. Myös vanha layout kaipasi päivitystä. Opinnäytetyössä on pyritty soveltamaan jo olemassa olevaa teoriaa ja käytäntöä layoutsuunnittelussa. Teoriaa oli tarjolla paljon, ja olikin tärkeää osata perehtyä vain olennaiseen. Siihen tässäkin tutkimuksessa on pyritty....

Tieto- ja viestintätekniikan opetuskäyttö opettajaksi opiskelevien harjoittelutilanteissa ja siihen vaikuttaneet tekijät

OpenAIRE

Fagerlund, Janne

2015-01-01

Tässä tutkimuksessa selvitettiin luokanopettajaopiskelijoiden kokemuksia tieto- ja viestintätekniikan (TVT) opetuskäytössä opettajankoulutuksen mahdollistamissa harjoittelutilanteissa sekä käyttöön vaikuttaneita tekijöitä. TVT:n opetuskäyttö on eräs kasvatuksen ja koulutuksen ajankohtaisimmista ja tutkituimmista osa-alueista, sillä sen hyötyjä opetuksessa ja oppimisessa voidaan perustella monista pedagogisista näkökulmista. TVT:n opetuskäyttö on sekä kansainvälisten että valtakunnallisten tut...

Tehoa pienyrityksen markkinointiin Facebookista. Case: Vaateliike Leija

OpenAIRE

Ruismäki, Anna

2016-01-01

Opinnäytetyön tavoitteena oli selvittää Facebook-markkinoinnin keinoja. Työssä on laadittu yksityiskohtaiset ohjeet markkinoinnin aloittamiselle sekä siinä huomioonotettaville tekijöille. Työn toimeksiantajana toimi Suomessa toimiva vaatetusalan yritys. Työ oli toimeksiantajayritykselle tarvelähtöinen, sillä yrityksellä ei ollut ennalta kokemusta tai tietotaitoa Facebook-markkinoinnista. Työn tavoitteena oli myös löytää perusteita sille, että Facebook on toimeksiantajan ja tämän kohderyhmän k...

Treatment-Induced Autophagy Associated with Tumor Dormancy and Relapse

Science.gov (United States)

2017-07-01

Monogr. 10021, 57e71. http://dx.doi.org/10.1093/jncimonographs/lgh014. McWhinney, S.R., Goldberg , R.M., McLeod, H.L., 2009. Platinum neurotoxicity... variations on a common theme of self-eating? Nat Rev Mol Cell Biol 13: 7 – 12 Cohen-Kaplan V, Livneh I, Avni N, Fabre B, Ziv T, Kwon YT, Ciechanover A (2016...Hippo kinases STK3/STK4 is essential for autophagy. Mol Cell 57: 55 – 68 Wing SS, Chiang HL, Goldberg AL, Dice JF (1991) Proteins containing peptide

Vedonlyöntiä virtuaalipyssyillä – anteeksi mitä? : Pelaajien näkemyksiä ja kokemuksia skinivedonlyönnistä

OpenAIRE

Valkama, Suvi

2016-01-01

Rahapelaaminen ja digipelaaminen elää nykyään jo eräänlaisessa symbioosissa. Verkkorahapelaaminen ammentaa vaikutteita molemmilta sektoreilta. Mahdollisten pelihaittojen ja -ongelmien ehkäisemisen vuoksi on tärkeää, että kasvattajat ja vanhemmat, sosiaalialan ammattilaiset ja muut toimijat tällä saralla saavat ajantasaista tietoa uusista ilmiöistä koskien raha- ja digipelaamista. Tämän opinnäytetyön tavoitteena oli tuottaa uutta tietoa virtuaalisilla esineillä käytävästä vedonlyönnistä. T...

Nokkoskuidun tunnistusmenetelmät

OpenAIRE

Suomela, Jenni

2015-01-01

Nokkosta (Urtica dioica) on käytetty tekstiilikuituna muiden runkokuitujen ohella. Sen kulttuurihistoriallinen merkitys on osittain hämärän peitossa, koska tutkimusta on tehty sen osalta vähäisesti. Merkittävimpänä syynä tähän on se, että nokkoskuitu on mikroskooppisilta ominaisuuksiltaan hyvin samankaltainen muiden runkokuitujen kanssa, joten sen tunnistus on saattanut olla puutteellista. Tämän tutkielman tarkoitus on ollut löytää nokkoselle ominaiset tunnuspiirteet ja menetelmät joilla n...

Vanhempien kasvatustyylit nuorten kokemina – Yhteydet koettuun elämäntyytyväisyyteen, yksinäisyyteen ja itsetuntoon

OpenAIRE

Savolainen, Juska

2017-01-01

Nykyyhteiskunnan modernisoituminen ja valinnan mahdollisuuksien kasvaminen ovat edes-auttaneet vanhempien yksilöllisten kasvatusratkaisujen tekemistä. Tämän hetken vanhem-muutta kuvailevat valinnanmahdollisuudet, mutta myös yhä kasvavat haasteet pätevästä kasvattamisesta. Toisaalta tutkijat myös raportoivat yhä enemmän nuorten kasvavia hyvinvoinnin riskejä, kuten yksinäisyyttä ja pahaa oloa. Tämä tutkimus pyrkii löytämään yhteyksiä vanhempien käyttämien eri kasvatustyylien ja nuorten kokemien...

Nuorten sosiaalisen median käyttö tiedonhankinnassa

OpenAIRE

Simolin, Annina

2017-01-01

Opinnäytetyön toimeksiantajana on Hämeen ammattikorkeakoulun strateginen viestintä, joka vastaa muun muassa opiskelijahankinnasta. HAMKilla on tällä hetkellä käytössään useita sosiaalisen median kanavia, ja työllä haluttiin selvittää mistä kanavista ja mitä tietoa nuoret erityisesti hakevat jatko-opintoja suunnitellessaan. Lisäksi haluttiin selvittää miten nuoret haluavat itse olla yhteydessä oppilaitoksiin hakuaikana. Teoriaosiossa on käsitelty nuorten mediakäyttäytymistä sekä useita sosiaal...

Siivouksen laadunhallinta asuinkiinteistöissä

OpenAIRE

Huhmarkangas, Riikka

2013-01-01

Työssäni kehitettiin siivouksen laadunhallintaa VTS-kotien asuinkiinteistöissä. Pääpaino oli VTS Kiinteistöpalvelu Oy:n käytössä olevan laadunarviointiohjelman kehittämisessä. Työssäni kartoitettiin, mitä ja miten pitää kehittää asuinkiinteistösiivouksen laadunhallintaa myös tulevaisuudessa. Lähtökohtana oli se, että siivouksen taso tulee saada samalle linjalle kaikkien palveluntuottajien kanssa riippumatta siitä, kuka palvelua tuottaa. Jokaisessa VTS-kodissa tulisi siivouksen lopputulos ...

Markkinointiviestinnän kehityssuunnitelma tilausravintolan syys- ja talvikaudelle : Case: Yritys X

OpenAIRE

Riikonen, Esa

2013-01-01

Tämän opinnäytetyön aiheena oli markkinointiviestinnän kehityssuunnitelma tilausravintolalle. Toimeksiantajayritys on alle kymmenhenkinen, vuonna 2006 perustettu elämysravintola Lappeenrannan Linnoituksessa. Ravintola on varsin suosittu kesäsesongin aikana, jolloin se pitää ovensa auki asiakkailleen päivit-täin aamusta iltaan. Syys- ja talvikaudella 1.9–30.4 ravintola on ainoastaan tila-uskäytössä. Syys- ja talvikaudella ravintolassa pyritään järjestämään paljon eri-laisia tapahtumia, ja ravi...

Body mass dynamics in hand reared clouded leopard (Neofelis nebulosa) cubs from birth to weaning.

Science.gov (United States)

Nájera, Fernando; Brown, Janine; Wildt, David E; Virolle, Laurie; Kongprom, Urarikha; Revuelta, Luis; Goodrowe-Beck, Karen

2015-01-01

To study the dynamics of body mass changes in hand reared clouded leopards, we analyzed 3,697 weight data points during the first 3 months of life in 49 cubs from 24 zoo-born litters from 2003 through 2012. All cubs were fed the same formula mixture after a similar weaning protocol. The hand rearing process was divided into three periods based on feeding protocols: Stage 1: formula only (Days 1-28; Day 0 = day of birth); Stage 2, formula supplemented with protein (e.g., turkey baby food; Days 29-42); Stage 3, formula in decreasing amounts supplemented with meat (chicken and/or beef; Days 43-90). Weights at birth were 11.2% higher (P weight gain was slowest (P  0.05) growth and weaning weights compared to healthy counterparts. These are the first data documenting, on a large scale, the growth patterns for zoo born, hand reared clouded leopard cubs. Findings are valuable as an aid in managing this rare species, including for helping identify early onset of medical issues and further determining key factors regulating the first 3 months of development. © 2015 Wiley Periodicals, Inc.

Investigating a method of producing "red and dead" galaxies

Science.gov (United States)

Skory, Stephen

2010-08-01

In optical wavelengths, galaxies are observed to be either red or blue. The overall color of a galaxy is due to the distribution of the ages of its stellar population. Galaxies with currently active star formation appear blue, while those with no recent star formation at all (greater than about a Gyr) have only old, red stars. This strong bimodality has lead to the idea of star formation quenching, and various proposed physical mechanisms. In this dissertation, I attempt to reproduce with Enzo the results of Naab et al. (2007), in which red and dead galaxies are formed using gravitational quenching, rather than with one of the more typical methods of quenching. My initial attempts are unsuccessful, and I explore the reasons why I think they failed. Then using simpler methods better suited to Enzo + AMR, I am successful in producing a galaxy that appears to be similar in color and formation history to those in Naab et al. However, quenching is achieved using unphysically high star formation efficiencies, which is a different mechanism than Naab et al. suggests. Preliminary results of a much higher resolution, follow-on simulation of the above show some possible contradiction with the results of Naab et al. Cold gas is streaming into the galaxy to fuel starbursts, while at a similar epoch the galaxies in Naab et al. have largely already ceased forming stars in the galaxy. On the other hand, the results of the high resolution simulation are qualitatively similar to other works in the literature that show a somewhat different gravitational quenching mechanism than Naab et al. I also discuss my work using halo finders to analyze simulated cosmological data, and my work improving the Enzo/AMR analysis tool "yt". This includes two parallelizations of the halo finder HOP (Eisenstein and Hut, 1998) which allows analysis of very large cosmological datasets on parallel machines. The first version is "yt-HOP," which works well for datasets between about 2563 and 5123 particles

Description of an α-cluster tail in 8Be and 20Ne: Delocalization of the α cluster by quantum penetration

Science.gov (United States)

Kanada-En'yo, Yoshiko

2014-10-01

We analyze the α-cluster wave functions in cluster states of ^8Be and ^{20}Ne by comparing the exact relative wave function obtained by the generator coordinate method (GCM) with various types of trial functions. For the trial functions, we adopt the fixed range shifted Gaussian of the Brink-Bloch (BB) wave function, the spherical Gaussian with the adjustable range parameter of the spherical Tohsaki-Horiuchi-Schuck-Röpke (sTHSR), the deformed Gaussian of the deformed THSR (dTHSR), and a function with the Yukawa tail (YT). The quality of the description of the exact wave function with a trial function is judged by the squared overlap between the trial function and the GCM wave function. A better result is obtained with the sTHSR wave function than the BB wave function, and further improvement can be made with the dTHSR wave function because these wave functions can describe the outer tail better. The YT wave function gives almost an equal quality to or even better quality than the dTHSR wave function, indicating that the outer tail of α-cluster states is characterized by the Yukawa-like tail rather than the Gaussian tail. In weakly bound α-cluster states with small α separation energy and the low centrifugal and Coulomb barriers, the outer tail part is the slowly damping function described well by the quantum penetration through the effective barrier. This outer tail characterizes the almost zero-energy free α gas behavior, i.e., the delocalization of the cluster.

Hoitohenkilökunta muistisairaan ikääntyneen suun hoitajana

OpenAIRE

Määttä, Johanna; Valtonen, Heidi

2014-01-01

Tulevaisuudessa ikääntyneiden sekä muistisairaiden määrä lisääntyy. Myös hampaallisten ikääntyneiden määrä tulee kasvamaan. Suun terveydestä huolehtiminen osana kokonaisterveyttä on tärkeää, koska huono suun terveys vaikuttaa yleisterveyteen haitallisesti. Muistisairauksiin liittyy muistin huononemisen lisäksi kognitiivisia häiriöitä, kuten käytöshäiriöitä ja motoristen toimintojen heikentymistä. Kaikki tämä aiheuttaa haasteita palvelukodissa työskentelevälle hoitohenkilökunnalle ja vastuu mu...

ARTJÄRVEN VANHAINKODIN HOITOHENKILÖKUNNAN ENSIAPUTAITOJEN KEHITTYMINEN

OpenAIRE

Nieminen, Marko

2011-01-01

Tämän kehittämistehtävän tarkoituksena oli tuottaa Artjärven vanhainkodin hoitohenkilökunnalle tietoa ensiavusta ja antaa käytännön harjoituksen avulla käden taitoja sekä laatia toimintaohjeet tukemaan ensiaputaitojen kehittymistä. Lisäksi tavoitteena oli kehittää omia ohjaustaitoja sekä vahvistaa omaa tietoutta opinnäytetyön kehittämismenetelmästä. Henkilökunta oli kokenut ensiaputaitojensa olevan riittämättömällä tasolla ja he tunsivat epävarmuutta sekä turvattomuutta kohdatessaan äkil...

Verkkokaupan arkkitehtuuri ja toteutus : Case: Mango Hotel

OpenAIRE

Ketolainen, Jari

2010-01-01

Opinnäytetyön toimeksiantajana toimi tamperelainen hotellialan yritys Mango Hotel. Yrityksellä oli ollut käytössä valmis verkkokaupparatkaisu vaatteiden, tavaroiden ja asusteiden myyntiin, mutta sovellus osoittautui vaikeakäyttöiseksi, huonosti Mango Hotellin tarpeisiin mukautuvaksi ja sitä oli ylläpitäjän hankala päivittää. Opinnäytetyön tarkoituksena oli suunnitella ja toteuttaa aivan uusi verkkokauppasovellus Mango Hotellin käyttöön käyttämättä tai muokkaamatta mitään valmista verkkoka...

Bly og andre tungmetaller i salat dyrket i torv tørket med spillolje

OpenAIRE

Selmer-Olsen, A. R.; Gislerød, H. R.

1986-01-01

En rekke veksttorvprodukter er analysert på tungmetaller. Til sammenligning er også naturtorv både i rå og i tørket tilstand, når tørkingen har foregått ved direkte innblåsing av forbrenningsgasser fra spillolje, også analysert ( tabell 1). Det viser seg å være et forholdsvis høyt innhold av enkelte elementer i tørket naturtorv og dette skyldes i første rekke kvaliteten av spilloljen. Det viser seg imidlertid også å være innhold som skyldes forurensninger i tilsetningsstoffer som Fullgjødsel...

Työelämäkokemuksen hyödyntäminen koulutuksessa : Ammatillisen opettajankoulutuksen, palveluliiketoiminnan ja terveyden edistämisen koulutusohjelmien ristiinarviointiraportit

OpenAIRE

2010-01-01

Jyväskylän ammattikorkeakoulun (JAMK) laadunvarmistusjärjestelmään kuuluu yhtenä tärkeänä osana koulutusohjelmien ristiinarviointi, jossa hyödynnetään eri alojen asiantuntemusta koulutuksen kehitystyössä. Jokaista arviointia varten kootaan monialainen arviointiryhmä, joka laatii myös julkaistavan raportin tekemästään arvioinnista. Näin ristiinarviointi on myös sisäinen yhteisöllinen oppimismenetelmä, jossa hyviä käytäntöjä ja kehittämisvirikkeitä siirtyy yhteiseen käyttöön. ...

Tributyylitina (TBT) maaympäristössä: esiintyminen, vaikutukset ja riskit

OpenAIRE

Lukkari, Tuomas; Koponen, Kari; Tuomi, Pirjo; Dahlbo, Kim; Rossi, Esko; Järvinen, Kimmo

2006-01-01

Organometalleihin kuuluvan tributyylitinan (TBT) esiintymisestä, vaikutuksista ja mahdollisista riskeistä maaympäristössä on vain vähän tutkimustietoa. Tiedot perustuvat pääasiassa vesiympäristöissä tehtyihin tutkimuksiin. TBT:a ei esiinny ympäristössä luonnostaan, vaan se on peräisin ihmisen toiminnasta. TBT:n päästöt maaperään ovat peräisin mm. TBT:a sisältävien valmisteiden käytöstä, lähinnä laivojen pohjamaaleista sekä mahdollisesti pilaantuneiden sedimenttien loppusijoituksesta. TBT:n...

Matkailuyhteistyö Siikaisten kunnassa

OpenAIRE

Jaakkola, Sanna

2010-01-01

Tämän opinnäytetyön aiheena oli tutkia Siikaisten kunnan alueen matkailuyhteistyötä. Tutkimuksen päätehtävänä oli löytää vastaus kysymykseen: Miten Siikaisten matkailualan toimijat suhtautuvat yhteistyöhön? Tutkimuksen alatehtävinä pyrittiin selvittämään onko matkailualan yrittäjillä halua ja tarvetta yhteistyöhön, millaisessa roolissa he haluaisivat kunnan toimivan, millaisia esteitä he kokevat matkailuyhteistyölle olevan ja miten he ovat kokeneet kehityshankkeet. Lisäksi selvitettiin matkai...

WLAN-antenni ajoneuvokäyttöön

OpenAIRE

Mustonen, Sami

2006-01-01

Insinöörityössä tutkittiin, mikä WLAN-antenni soveltuisi parhaiten käytettäväksi Sunit Oy:n valmistamissa ajoneuvotietokoneissa. WLAN-antennin täytyy olla tehokas ja helposti asennettava ajoneuvokäyttöön. Työssä tutkittiin myös, kuinka merkittävässä asemassa ovat suurtaajuuskäytössä käytettävät RF-liittimet ja kaapelit. Insinöörityön tutkimus perustuu suurimmalta osaltaanantenniteoriaan, sähkömagnetismiin ja mikroaaltomittaustekniikkaan. WLAN-antennimittaukset on tehty Kajaanin ammattikork...

Sähköalan oppimateriaalin verkkodokumentointi

OpenAIRE

Riikonen, Timitri

2015-01-01

Tämän työn tavoitteena oli kehittää Savonia-ammattikorkeakoulun sähköalan opetuksen verkkodokumentointia. Työssä luodaan alusta, jota käytetään kurssin ohella. Alustaan tulisi sisällyttää sekä kurssimateriaali, että kurssin aikana käsiteltyjen asioiden havainnollistava materiaali. Sen tulisi olla helppo sekä käyttää että muokata. Alustaa varten testattiin useita eri sovelluksia. Työssä käytettiin Savonia-ammattikorkeakoululla käytössä olevaa DMS600NE-verkkotietojärjestelmää. Ohjelmaan luo...

FC Kliini RY:n Kesäpäivien suunnittelu ja järjestäminen

OpenAIRE

Narmala, Kalle

2012-01-01

Opinnäytetyön aiheena oli suunnitella ja järjestää FC Kliini ry:n Kesäpäivät. Tapahtuma suunniteltiin yhdistyksen puheenjohtaja Antti Niemisen toimeksiannon mukaan. Kesäpäivien suunnittelu alkoi maaliskuussa 2012, jolloin sen ajankohdaksi päätettiin 17.-19.8.2012. Tapahtuma järjestettiin loppukesästä, jotta kaikki yhdistyksen jäsenet voisivat ottaa osaa tapahtumaan. Opinnäytetyö suoritettiin toiminnallisena, jossa yhdistyy käytäntö sekä teoria. FC Kliini ry on jo kauan suunnitellut virkist...

Sisäänostajan eettiset kysymykset

OpenAIRE

Malinen, Mirka

2010-01-01

Tämä opinnäytetyö käsittelee vastuullista hankintaa suomalaisissa yrityksissä. Tutkimuskysymys on, millä tavalla yrityksen eettiset arvot vaikuttavat sisäänostajan tai maahantuojan työhön, kun he tekevät hankintoja maista, joissa lainsäädäntö ei täytä kansainvälisiä eettisyyden vähimmäisvaatimuksia. Aihe on siis rajattu riskimaista tehtävään ostotoimintaan. Hankintojen eettisyyteen liittyy sosiaalisen ja ekologisen vastuun näkökulma. Sosiaalinen vastuu käsittää tuotantolaitoksen työntekijöide...

”En tykkää junnata paikallaan" : Palveluneuvojat laadun kehittäjinä Kelassa

OpenAIRE

Kyllönen, Anne

2016-01-01

Opinnäytetyöni tavoitteena oli selvittää millaiset asiat tukevat palveluneuvojan työn laadun kehittämistä Kansaneläkelaitoksessa (Kela). Kelassa toimistojen asiakaspalvelussa työskentelevät palveluneuvojat ovat erikoistuneet asiakaspalvelutyöhön ja heillä on käytössä palvelumalli. Tutkimuksessa selvitetään palveluneuvojien näkemyksiä palvelumallista, millaisia vaikutusmahdollisuuksia heillä on työnsä kehittämiseen sekä mitkä seikat tukevat ja innostavat heidän kehittymistään. Opinnäytetyön te...

Ruoanvalmistuspaperi Cook and chill prosessissa

OpenAIRE

Sarjohalme, Sirkka; Helin, Inga

2012-01-01

Opinnäytetyö lähti liikkeelle opinnäytetyön tilaajan, Metsä Tissuen, toiveesta tutkia Cook and chill -ruoanvalmistuspaperin soveltuvuutta Cook and chill -tuotantotapaan ammattikeittiöissä. Uudet toimintamenetelmät eroavat perinteisistä menetelmistä käytännössä näkyvimmin siinä, että ruoanvalmistus ei ole sidottu tarjoilupaikkaan ja ruoan tarjoilun ei tarvitse välttämättä tapahtua valmistuspäivänä. Tähän perustuu myös Cook and chill -tuotantotapa. Tutkimusyhteistyötä tehtiin Pirkkalan tuotanto...

Comparison of active SIFT-based 3D object recognition algorithms

CSIR Research Space (South Africa)

Keaikitse, M

2013-09-01

Full Text Available by the author of [8]. The following is the procedure used for obtaining that dataset. The training and testing datasets were captured using a Prosilica GE1900C camera. Everyday objects such as cereal and spice boxes were used. In compiling the training dataset....88 1 Yes Spice Bottle - - No Spray Can - - No Spray Can2 1.39 1 Yes images satisfies the condition: (|xi − xj | ≤ xT = 12) ∧ (|yi − yj | ≤ yT = 4), In our case, however, the camera is fixed and the object is placed on a rotating turntable. As a result...

Yrityksen internetsivuston palvelun laadun kehittäminen

OpenAIRE

Kova, Johanna

2012-01-01

Tänä päivänä internetin merkitys yrityksille on kasvanut valtavasti. Nykyään yhä useampi kuluttaja saa ensivaikutelman yrityksestä sen internetisivujen kautta. Näin ollen yritysten onkin tärkeää panostaa siihen, että kuluttaja löytää kaiken mahdollisen tarvittavan tiedon helposti yrityksen kotisivujen kautta. Opinnäytetyön tavoitteena oli selvittää kiinteistönvälitysalalla toimivan yrityksen internetsivuston palvelun laatua asunnon ostaja-asiakkaiden näkökulmasta ja saada tätä kautta kehittäm...

Valmistalokauppa : Toimintatapa ja omavalvonnan kehitystarpeet Muurametalot Oy:ssä

OpenAIRE

Kantola, Jussi

2012-01-01

Valmistalokauppa on kehittynyt paljon viimeisten vuosien aikana. Taloja valmistavia yrityksiä on perustettu runsaasti ja valmistalojen kysyntä on kasvanut. Työn tarkoituksena oli päivittää Muurametalot Oy:n omavalvontajärjestelmä vastaamaan paremmin tämän päivän tarpeita. Tavoitteena oli muokata omavalvonnassa käytettävät tarkastuspöytäkirjat nykypäivän asetusten tasolle. Ideaalitilanne olisi, että jokainen työntekijä osallistuu omavalvonnan käyttöön. Järjestelmän periaatteena on tarjota ...

Tanssijan roolityö : Minä toisena

OpenAIRE

Penttilä, Elena

2012-01-01

Tanssi ja teatteri, sekä näyttämöllisyyden mahdollisuudet ja haasteet, kiehtovat minua. Taiteellisen opinnäytetyöni innoittajana on toiminut tahtoni löytää työskentelymuoto, jossa tanssija kykenisi hyödyntämään näyttelijäntyön perusteita tuodakseen keholliseen ilmaisuunsa moniulotteisuutta ja syvyyttä. Opinnäytetyöni produktiotyöskentelyssä roolityön lähtökohtana toimivat eri aistikanavia pitkin tarjotut impulssit, näyttämötilan käsittäminen paikkana sekä teokselle luotu tarinamuotoinen t...

GLOBAALI PALKKAHALLINTO : CASE: Yritys Oy

OpenAIRE

Salo, Paula

2017-01-01

Kehittämistyössä tutkittiin globaalia palkkahallintoa, sen käsitettä, vaatimuksia ja globaalin palkkahallinnon käyttöönottoa kansainvälisesti toimivassa yrityksessä. Tavoitteena oli löytää keinoja, joilla kohdeyritys pääsee tavoitteisiinsa palkkahallinnon toteuttamisessa. Kehittämistyö tehtiin kevään 2016 ja kevään 2017 välisenä aikana haastatellen ja havainnoiden käynnissä olevaa palkkahallinnon projektia. Kehittämistyön teoreettisessa osuudessa käydään läpi ulkoistamisen syyt lyhyesti ...

Hengitän ja tunnen kehoni : Luova liike psykofyysisessä fysioterapiassa

OpenAIRE

Mäntynen, Mari

2015-01-01

Tämän kehittämistehtävän tarkoituksena oli tarkastella luovaa liikettä osana psykofyysistä fysioterapiaprosessia. Luovaa liikettä käsiteltiin tanssi- ja liiketerapian näkökulmasta sekä havainnointi- että terapiamenetelmänä. Psykofyysisen fysioterapian näkemystä kuvattiin ruumiinkuvakäsitteen avulla. Käytännön kokemuksia tuotiin esille sekä yksilöterapiassa että kehotietoisuusryhmässä. Tässä työssä asiakkaiden kokemukset nousivat esille terapeutin arvioimana. Kehittämistehtävä toteutettiin aik...

Avoimen lähdekoodin HA-tietokannat

OpenAIRE

Vartio, Sami

2014-01-01

Insinöörityössä perehdyttiin avoimen lähdekoodin periaatteisiin ja lisenssimalleihin sekä huomioitiin liiketaloudelliset lähtökohdat. Tavoitteena oli tutustua järjestelmän saatavuuteen sekä klusteroinnin periaatteisiin. Järjestelmän saatavuus (HA) on tietojärjestelmien suunnittelussa käytettävä käytäntö, joka pyrkii siihen että järjestelmä on aina käyttäjän käytettävissä. Aluksi käsiteltiin perustietoja sekä teoriaa. Tutkimuksen edetessä paneuduttiin laajemmin yleisimpiin avoimen lähdeko...

Siirtyminen IPv6-protokollaan yrityksen verkkolaitteistossa

OpenAIRE

Lindén, Kalle

2012-01-01

Tämän opinnäytetyön tarkoituksena on selvittää, mitä muutoksia Päijät-Hämeen koulutuskonsernin (PHKK) tietoverkon runkolaitteissa tarvitsee tehdä, jotta voidaan ottaa IPv6-protokolla käyttöön. Siirtyminen IPv6-protokollaan tulee olemaan välttämätön toimenpide, koska IPv4-protokollasta loppuvat uudet yksilölliset osoitteet. IPv4- ja IPv6-protokollien suurimmat erot ovat osoitekentän koon kasvaminen 32 bitistä 128 bittiin. Aluksi IPv4-osoitteistuksessa oli käytössä luokallinen osoitejärjest...

Mansikkaviljelmän perustaminen Lapväärttiin

OpenAIRE

Klåvus, Hanna

2013-01-01

Tavoitteena on ollut suunnitella ja perustaa mansikkaviljelmä Lapväärttiin ja työllistyä samalla. Tämä opinnäytetyö on tehty toiminnallisena opinnäytetyönä ja se sisältää teoreettista taustaa työlle ja toteutuksen, sekä pohdinnan työn onnistumisesta, mikä on apuna mansikan viljelyä suunnittelevalle. Kahden hehtaarin mansikkaviljelmälle löytyi hyvä paikka talouskeskuksen vierestä. Sijainti on hyvä niin käytännön töiden kuin asiakkaidenkin kannalta. Talouskeskus sijaitsee Lapväärtissä hyvie...

Organisaation ostotoiminta : liikelahjatoimittajan valinta

OpenAIRE

Hakala, Marita

2010-01-01

Tässä opinnäytetyössä tarkastellaan liikelahjatoimittajan valintaan, sekä mainos- ja liikelahjojen ostoon vaikuttavia tekijöitä. Tärkeimpänä tavoitteena oli löytää ne pääsyyt, jotka vaikuttavat toimittajan valintaan. Edellisten lisäksi kartoitettiin myös asenteita internetin (tarkemmin extranet–palvelut) käyttöä kohtaan liikelahjahankinnoissa. Opinnäytetyö tehtiin yhteistyössä Liikelahjatalon (nimi muutettu) kanssa. Lähteinä tässä työssä käytettiin kirjallisia lähteitä, Internet–tietokant...

Omaa ääntä etsimässä : syntetisaattorin käyttö Orbit-yhtyeessä

OpenAIRE

Myrskog, Mikael

2014-01-01

Musiikkikappaleessa on mielestäni oleellisinta sen sisäinen, esteettinen maailma ja se tunne, joka tästä välittyy. Tässä kokonaisuudessa yksi tärkeimmistä tekijöistä on mielestäni kappaleen eri instrumenttien luoma yhteinen saundimaailma. Opinnäytetyössäni tutkin ja kuvailen, miten käytän syntetisaattoreita saundien luomiseen fuusiojazzyhtyeessä Orbit. Mielestäni on tärkeää olla tietoinen siitä musiikin perinteestä, minkä jatkumon osana itse on. Näin esittelen ja analysoin kappaleita,...

Käyttäjänäkökulman välttämättömyys tila-suunnittelussa - esimerkkinä tietohallintoalan yritys

OpenAIRE

Kunnas, Heli

2012-01-01

Hyvä toimistoympäristö luo edellytykset kohtaamiselle työpaikalla. Yhä useampi yritys on pa-nostanut toimistoympäristöjen kehittämiseen luomalla niistä mukavia ja edustavia kohtaamis-paikkoja, joissa tilojen käyttäjät voivat valita erilaisia tiloja, jotka tukevat heidän työtehtäviään. Toimistoympäristöillä luodaan yritysmielikuvaa ja kilpaillaan parhaista työntekijöistä. Hyvien ja parhaiden työpaikkojen välisissä eroissa korostuu toimistotilojen viihtyisyyden ja käytännöllisyyden huomioiminen...

Characterization of Non-Linearized Spacecraft Relative Motion using Nonlinear Normal Modes

Science.gov (United States)

2016-04-20

the HCW equation (Eq. (2) expressed in terms of relative orbit elements (ROEs) [17], x(t) = −ae 2 cos(β) + xd y(t) = ae sin(β) + yd z(t) = zm cos(ψ...30) where ae, xd , zm are constant and yd(t) = yd0− 32nxdt, β(t) = β0 +nt and ψ(t) = ψ0 +nt are time dependent. It is clear that (ae, zm, xd , yd0, β0...quantities correspond to the ambiguous orbit. It is noted that if the non- drifting condition xd = 0 is satisfied, Eqs. (37-40) will vanish. In the

VPN ja OpenVPN

OpenAIRE

Talja, Timo

2015-01-01

Tämän opinnäytetyön tarkoituksena on tutustua VPN-teknologiaan sekä eri salausprotokolliin. Teoriaosuudessa käydään läpi erilaisia salausprotokollia. Käytännön osuuden aikana luodaan toimiva OpenVPN-palvelinympäristö Virtualbox-virtuaalikoneohjelmiston avulla. Kaikki opinnäytetyössä käytetyt sovellukset perustuvat avoimeen lähdekoodiin. Työssä käydään läpi tarvittavat asennusvaiheet sertifikaattien sekä avaimien luontiin palvelimelle. Työssä luodaan myös esimerkiksi älypuhelimelle OpenVPN...

Ajattelun taito ja lupa ilmaista: teoreettis-käsitteellinen tutkimus hoitotyön edellyttämästä kriittisen ajattelun taidosta ja sen edellytyksistä

OpenAIRE

Nurmela, Tiina

2002-01-01

Hoitotyö on käytännön toimintaa, jonka päämääränä on vastata potilaan terveystarpeisiin, jotka liittyvät ihmisten inhimilliseen olemassaoloon ja hyvinvointiin. Tässä toiminnassa ei riitä, että pelkästään tehdään, vaan tekeminen edellyttää monenlaisia ajattelun taitoja. Tutkimuksen lähtökohtana oli tutkimusten osoittama hoitajien ja hoitotyön opiskelijoiden heikko kriittisen ajattelun taso sekä epäselvä ajattelua kuvaava käsitteistö hoitamisen yhteydessä. Tutkimus oli teoreettis-käsitteell...