Wei, Le; Kan, Li-Yuan; Zeng, Hai-Ying; Tang, Yi-Yun; Huang, Hong-Lin; Xie, Ming; Zou, Wei; Wang, Chun-Yan; Zhang, Ping; Tang, Xiao-Qing
2018-06-01
Our previous works have shown that hydrogen sulfide (H 2 S) significantly attenuates chronic unpredictable mild stress (CUMS)-induced depressive-like behaviors and hippocampal endoplasmic reticulum (ER) stress. Brain-derived neurotrophic factor (BDNF) generates an antidepressant-like effect by its receptor tyrosine protein kinase B (TrkB). We have previously found that H 2 S upregulates the expressions of BDNF and p-TrkB in the hippocampus of CUMS-exposed rats. Therefore, the present work was to explore whether BDNF/TrkB pathway mediates the antidepressant-like role of H 2 S by blocking hippocampal ER stress. We found that treatment with K252a (an inhibitor of BDNF/TrkB pathway) significantly increased the immobility time in the forced swim test and tail suspension test and increased the latency to feed in the novelty-suppressed feeding test in the rats cotreated with sodium hydrosulfide (NaHS, a donor of H 2 S) and CUMS. Similarly, K252a reversed the protective effect of NaHS against CUMS-induced hippocampal ER stress, as evidenced by increases in the levels of ER stress-related proteins, glucose-regulated protein 78, CCAAT/enhancer binding protein homologous protein and cleaved caspase-12. Taken together, our results suggest that BDNF/TrkB pathway plays an important mediatory role in the antidepressant-like action of H 2 S in CUMS-exposed rats, which is by suppression of hippocampal ER stress. These data provide a novel mechanism underlying the protection of H 2 S against CUMS-induced depressive-like behaviors.
Fifty years of Jaynes-Cummings physics
Greentree, Andrew D.; Koch, Jens; Larson, Jonas
2013-11-01
subfields in physics. Jaynes-Cummings physics started with the diagonalization of a 2 × 2 matrix, as Frederick Cummings points out. There is no doubt that this elegance of simplicity will continue to guide exciting new research in the decades to come. References [1] Jaynes E T and Cummings F W 1963 Comparison of quantum and semiclassical radiation theories with application to the beam maser Proc. IEEE 51 89 [2] Shore B W and Knight P L 2004 Physics and Probability: Essays in Honor of Edwin T Jaynes (Cambridge: Cambridge University Press) [3] Tavis M and Cummings F W 1968 Exact solution for an N -molecule-radiation-field Hamiltonian Phys. Rev. 170 379-84 [4] Tavis M and Cummings F W 1969 Approximate solutions for an N -molecule-radiation-field Hamiltonian Phys. Rev. 188 692-5 [5] Hartmann M J, Brandão F G S L and Plenio M B 2006 Strongly interacting polaritons in coupled arrays of cavities Nature Phys. 2 849-55 [6] Greentree A D, Tahan C, Cole J H and Hollenberg L C L 2006 Quantum phase transitions of light Nature Phys. 2 856-61 [7] Angelakis D G, Santos M F and Bose S 2007 Photon-blockade-induced Mott transitions and XY spin models in coupled cavity arrays Phys. Rev. A 76 031805(R) [8] Schwab K C and Roukes M L 2005 Putting mechanics into quantum mechanics Phys. Today 58 36-42 [9] Blatt R, Milburn G J and Lvovksy A 2013 The 20th anniversary of quantum state engineering J. Phys. B: At. Mol. Opt. Phys. 46 100201 [10] Shore B and Knight P L 1993 The Jaynes-Cummings model J. Mod. Opt. 40 1195-238 [11] Cummings F W 2013 J. Phys. B: At. Mol. Opt. Phys. 46 220202 [12] Arenz C 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224001 [13] Quesada N 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224002 [14] Everitt M 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224003 [15] Kitajima S 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224004 [16] Groves E 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224005 [17] Bougouffa S 2013 J. Phys. B: At. Mol. Opt. Phys. 46 224006 [18] Braak D 2013 J. Phys. B: At. Mol. Opt. Phys
[Pediamécum: one year of experience].
Piñeiro Pérez, R; Martínez Fernández-Llamazares, C; Calvo Rey, C; Piñeiro Pérez, A P; Criado Vega, E A; Bravo Acuña, J; Cabrera García, L; Mellado Peña, M J
2014-10-01
In 2011, the Spanish Association of Pediatrics decided to support the most ambitious project of its newly created Committee for Medicinal Products: Pediamécum. This is the first free on-line database with information on medicinal products for pediatric use in Spain. The web page http://pediamecum.es/ started on December 17 December 2012. One year later, Pediamécum includes 580 registered drugs. The website achieved more than one million page views by the end of 2013. Because of the first anniversary of Pediamécum, a survey was performed to request the feeling of users. Four hundred eighty-three responses were obtained. Ninety-five percent believed that it is easy to navigate through the web, and 74% said that their doubts about the use of medicines in children were always resolved. The overall rating of Pediamécum is 7.5/10. The aims of Pediamécum are being accomplished; which is reflected essentially due to it becoming a useful tool for all professionals who care for children in their daily clinical practice. Copyright © 2014 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.
Bell-Nonlocality Dynamics of Three Remote Atoms in Tavis—Cummings and Jaynes—Cummings Models
International Nuclear Information System (INIS)
Zhen Xiu-Lan; Yang Qing; Yang Ming; Cao Zhuo-Liang
2014-01-01
We study the Bell-nonlocality dynamics of three remote atoms, two of which are trapped in one single-mode cavity and the third atom is trapped in another remote single-mode cavity. The interactions between the atoms and the cavity modes are studied via Tavis Cummings and Jaynes Cummings models. Here, the two single-mode cavities are introduced to simulate two different enviroments of the three atoms. The tripartite nonlocal correlations are studied in terms of the Svetlichny inequality and the WWZB inequality, respectively. The results show that the tripartite Bell-nonlocality sudden death will occur for the W state and GHZ state initial conditions. The detailed results demonstrate that the tripartite nonlocality of GHZ state is more robust than that of W state when suffering from the effect of environments. (general)
Balancing the dynamic Stark shift in a driven Jaynes-Cummings system
International Nuclear Information System (INIS)
Mogilevtsev, D; Kilin, S
2004-01-01
In this work we discuss the possibility of balancing a dynamic Shark shift in a Jaynes-Cummings system by simultaneously driving the cavity and the atom with classical fields, of the same frequency. For a lossless Jaynes-Cummings system this can lead to unusual atomic population dynamics. For a lossy Jaynes-Cummings system such balancing can lead to complete suppression of resonance fluorescence even for leaky cavities
Chronic antidepressant administration alleviates frontal and hippocampal BDNF deficits in CUMS rat.
Zhang, Yang; Gu, Fenghua; Chen, Jia; Dong, Wenxin
2010-12-17
Stress activates the hypothalamo-pituitary-adrenal (HPA) axis, regulates the expression of brain-derived neurotrophic factor (BDNF) in the brain, and mediates mood. Antidepressants alleviate stress and up-regulate BDNF gene expression. In this study, we investigated the effect of chronic unpredictable mild stress (CUMS) and the different kinds of antidepressant treatments on the HPA axis and the BDNF expression in the rat brain. Adult Wistar male rats were exposed to a six-week CUMS procedure and received different antidepressant treatments including venlafaxine, mirtazapine, and fluoxetine. Immunohistochemistry and real-time PCR were used to measure BDNF expression levels in the rat brain, and ELISAs were used to investigate the plasma corticosterone (CORT) and adrenocorticotropic hormone (ACTH) levels. CUMS significantly decreased the BDNF protein level in the DG, CA1, and CA3 of the hippocampus and increased plasma CORT level. Chronic antidepressant treatments all significantly increased BDNF protein levels in the hippocampus and the pre-frontal cortex. In addition, venlafaxine and mirtazapine inhibited the increase of plasma CORT level. These results suggested that an increase in the BDNF level in the brain could be a pivotal mechanism of various antidepressants to exert their therapeutic effects. Copyright © 2010 Elsevier B.V. All rights reserved.
Economic differential of integrated fish, rice cum piggery and fish ...
African Journals Online (AJOL)
Fish, rice cum piggery and fish, rice cum poultry production integration platforms were set up to perfect the ideas of integrated fish farming in Sierra Leone. Water quality parameters measured biweekly included: dissolved oxygen, water temperature, pH, water hardness, water alkalinity, ammonia, nitrate, BOD and nitrite.
Generalized Jaynes-Cummings model as a quantum search algorithm
International Nuclear Information System (INIS)
Romanelli, A.
2009-01-01
We propose a continuous time quantum search algorithm using a generalization of the Jaynes-Cummings model. In this model the states of the atom are the elements among which the algorithm realizes the search, exciting resonances between the initial and the searched states. This algorithm behaves like Grover's algorithm; the optimal search time is proportional to the square root of the size of the search set and the probability to find the searched state oscillates periodically in time. In this frame, it is possible to reinterpret the usual Jaynes-Cummings model as a trivial case of the quantum search algorithm.
Cummings/Ju - Harvard; Emory | Division of Cancer Prevention
Principal Investigator: Richard D Cummings, PhDInstitution: Beth Israel Deaconess Medical Center and Harvard Medical School, Boston, MA Principal Investigator: Tongzhong Ju, MD, PhDInstitution: Emory University, Atlanta, GA |
Generalized Jaynes-Cummings Hamiltonians by shape-invariant hierarchies and their SUSY partners
International Nuclear Information System (INIS)
Hussin, V; Kuru, S; Negro, J
2006-01-01
A generalization of the matrix Jaynes-Cummings model in the rotating wave approximation is proposed by means of the shape-invariant hierarchies of scalar factorized Hamiltonians. A class of Darboux transformations (sometimes called SUSY transformations in this context) suitable for these generalized Jaynes-Cummings models is constructed. Finally one example is worked out using the methods developed
Emergent randomness in the Jaynes-Cummings model
International Nuclear Information System (INIS)
Garraway, B M; Stenholm, S
2008-01-01
We consider the well-known Jaynes-Cummings model and ask if it can display randomness. As a solvable Hamiltonian system, it does not display chaotic behaviour in the ordinary sense. Here, however, we look at the distribution of values taken up during the total time evolution. This evolution is determined by the eigenvalues distributed as the square roots of integers and leads to a seemingly erratic behaviour. That this may display a random Gaussian value distribution is suggested by an exactly provable result by Kac. In order to reach our conclusion we use the Kac model to develop tests for the emergence of a Gaussian. Even if the consequent double limits are difficult to evaluate numerically, we find definite indications that the Jaynes-Cummings case also produces a randomness in its value distributions. Numerical methods do not establish such a result beyond doubt, but our conclusions are definite enough to suggest strongly an unexpected randomness emerging in a dynamic time evolution
Abd El Wahab, Manal Galal; Ali, Soad Shaker; Ayuob, Nasra Naeim
2018-06-01
This study aimed to evaluate the effect induced by musk on Alzheimer's disease-such as neurodegenerative changes in mice exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice were divided into 4 groups (n = 10); control, CUMS, CUMS + fluoxetine, CUMS + musk. At the end of the experiment, behavior of the mice was assessed. Serum corticosterone level, hippocampal protein level of the glucocorticoid receptors, and brain-derived neurotropic factor were also assessed. Hippocampus was histopathologically examined. Musk improved depressive status induced after exposure to CUMS as evidenced by the forced swimming and open field tests and improved the short-term memory as evidenced by the elevated plus maze test. Musk reduced both corticosterone levels and the hippocampal neurodegenerative changes observed after exposure to CUMS. These improvements were comparable to those induced by fluoxetine. Musk alleviated the memory impairment and neurodegenerative changes induced after exposure to the chronic stress.
Exact solution of the generalized time-dependent Jaynes-Cummings Hamiltonian
International Nuclear Information System (INIS)
Gruver, J.L.; Aliaga, J.; Cerdeira, H.A.; Proto, A.N.
1993-04-01
A time-dependent generalization of the Jaynes-Cummings Hamiltonian is studied using the maximum entropy formalism. The approach, related to a semi-Lie algebra, allows to find three different sets of physical relevant operators which describe the dynamics of the system for any temporal dependence. It is shown how the initial conditions of the operators are determined via the maximum entropy principle density operator, where the inclusion of the temperature turns the description of the problem into a thermodynamical one. The generalized time-independent Jaynes-Cummings Hamiltonian is exactly solved as a particular example. (author). 14 refs
Measurement Induced Enhancement of Squeezing in Nondegenerate Two-Photon Jaynes-Cummings Model
International Nuclear Information System (INIS)
Ye Saiyun
2006-01-01
Squeezing properties in the nondegenerate two-photon Jaynes-Cummings model are investigated. The effects of direct selective atomic measurement and the application of the classical field followed by atomic measurement are analyzed. Different values of the parameters of the classical field are taken into account. It is found that the field squeezing can be enhanced by measurement.
Transient theory of double slope floating cum tilted - wick type solar still
International Nuclear Information System (INIS)
Balan, R.; Chandrasekaran, J.; Janarthanan, B.; Kumar, S.
2011-01-01
A double slope floating cum tilted-wick solar still has been fabricated and transient theory of floating cum tilted-wick type solar still has been proposed. Analytical expressions have been derived for the different temperatures components of the proposed system. For elocution of the analytical results, numerical calculations have been carried out using the meteorological parameters for a typical summer day in Coimbatore. Analytical expression results are found to be in the close agreement with the experimental results. (authors)
Advanced adsorption cooling cum desalination cycle: A thermodynamic framework
Chakraborty, Anutosh; Thu, Kyaw; Ng, K. C.
2011-01-01
We have developed a thermodynamic framework to calculate adsorption cooling cum desalination cycle performances as a function of pore widths and pore volumes of highly porous adsorbents, which are formulated from the rigor of thermodynamic property
Dispersive regime of the Jaynes–Cummings and Rabi lattice
International Nuclear Information System (INIS)
Zhu, Guanyu; Koch, Jens; Schmidt, Sebastian
2013-01-01
Photon-based strongly correlated lattice models like the Jaynes–Cummings and Rabi lattices differ from their more conventional relatives like the Bose–Hubbard model by the presence of an additional tunable parameter: the frequency detuning between the pseudo-spin degree of freedom and the harmonic mode frequency on each site. Whenever this detuning is large compared to relevant coupling strengths, the system is said to be in the dispersive regime. The physics of this regime is well-understood at the level of a single Jaynes–Cummings or Rabi site. Here, we extend the theoretical description of the dispersive regime to lattices with many sites, for both strong and ultra-strong coupling. We discuss the nature and spatial range of the resulting qubit–qubit and photon–photon coupling, demonstrate the emergence of photon-pairing and squeezing and illustrate our results by exact diagonalization of the Rabi dimer. (paper)
Proceedings of twelfth ISMAS symposium cum workshop on mass spectrometry
International Nuclear Information System (INIS)
Alamelu, D.; Jaison, P.G.; Aggarwal, S.K.
2007-03-01
Mass Spectrometry is an important analytical tool and has encompassed almost all branches of science and technology including Agricultural, biology, Chemistry, Earth sciences, environment, Forensic Science, Medical Sciences, Hydrology, Nuclear Technology, Oceanography, Physics etc. Recent advancements in the instrumentation of Mass Spectrometry have further strengthened its role for various applications. It is indeed a matter of great pleasure to present this special Issue of ISMAS Bulletin which is brought out on the occasion of the 12th ISMAS Symposium cum Workshop on Mass spectrometry (12th ISMAS-WS 2007) being held at Cidade-de-Goa, Dona Paula, Goa from March 25 to 30, 2007 in association with National Institute of Oceanography, Goa. This Symposium cum Workshop is co-sponsored by Scientific Departments of Government of India. Papers relevant to INIS are indexed separately
Gravitational Jaynes–Cummings model beyond the rotating wave
Indian Academy of Sciences (India)
In this paper, the quantum properties of a two-level atom and the cavity-field in the Jaynes–Cummings model with the gravity beyond the rotating wave approximation are investigated. For this purpose, by solving the Schrödinger equation in the interaction picture, the evolving state of the system is found by which the ...
Advanced adsorption cooling cum desalination cycle: A thermodynamic framework
Chakraborty, Anutosh
2011-01-01
We have developed a thermodynamic framework to calculate adsorption cooling cum desalination cycle performances as a function of pore widths and pore volumes of highly porous adsorbents, which are formulated from the rigor of thermodynamic property surfaces of adsorbent-adsorbate system and the adsorption interaction potential between them. Employing the proposed formulations, the coefficient of performance (COP) and overall performance ratio (OPR) of adsorption cycle are computed for various pore widths of solid adsorbents. These results are compared with experimental data for verifying the proposed thermodynamic formulations. It is found from the present analysis that the COP and OPR of adsorption cooling cum desalination cycle is influenced by (i) the physical characteristics of adsorbents, (ii) characteristics energy and (iii) the surface-structural heterogeneity factor of adsorbent-water system. The present study confirms that there exists a special type of adsorbents having optimal physical characteristics that allows us to obtain the best performance.
Concurrence of three Jaynes-Cummings systems
Qiang, Wen-Chao; Sun, Guo-Hua; Dong, Qian; Camacho-Nieto, Oscar; Dong, Shi-Hai
2018-04-01
We apply genuine multipartite concurrence to investigate entanglement properties of three Jaynes-Cummings systems. Three atoms are initially put in GHZ-like state and locally interact with three independent cavities, respectively. We present analytical concurrence expressions for various subsystems including three-atom, three-cavity and some atom-cavity mixed systems. We also examine the global system and illustrate the evolution of its concurrence. Except for the sudden death of entanglement, we find for some initial entanglement parameter θ , the concurrence of the global system may maintain unchanged in some time intervals.
Ocimum basilicum improve chronic stress-induced neurodegenerative changes in mice hippocampus.
Ayuob, Nasra Naeim; El Wahab, Manal Galal Abd; Ali, Soad Shaker; Abdel-Tawab, Hanem Saad
2018-01-22
Alzheimer's disease (AD), one of the progressive neurodegenerative diseases might be associated with exposure to stress and altered living conditions. This study aimed to evaluate the effectiveness of Ocimum basilicum (OB) essential oils in improving the neurodegenerative-like changes induced in mice after exposed to chronic unpredictable mild stress (CUMS). Forty male Swiss albino mice divided into four groups (n = 10); the control, CUMS, CUMS + Fluoxetine, CUMS + OB were used. Behavioral tests, serum corticosterone level, hippocampus protein level of the glucocorticoid receptors (GRs) and brain-dreived neurotropic factor (BDNF) were determined after exposure to CUMS. Hippocampus was histopathologically examined. Data were analyzed using statistical package for the social sciences (SPSS) and P value of less than 0.05 was considered significant. OB diminished the depression manifestation as well as impaired short term memory observed in the mice after exposure to the CUMS as evidenced by the forced swimming and elevated plus maze test. OB also up-regulated the serum corticosterone level, hippocampal protein level of the glucocorticoid receptor and the brain-derived neurotropic factor and reduced the neurodegenerative and atrophic changes induced in the hippocampus after exposure to CUMS. Essential oils of OB alleviated the memory impairment and hippocampal neurodegenerative changes induced by exposure to the chronic unpredictable stress indicating that it is the time to test its effectiveness on patients suffering from Alzheimer disease.
Collision dynamics of the coherent Jaynes-Cummings model
International Nuclear Information System (INIS)
Rabello, M.L.C.; Toledo Piza, A.F.R. de.
1985-01-01
The anatomy of the dynamics of quantum correlations of two interacting subsystems described by the Jaynes-Cummings Model is studied, making use of a natural states decomposition, following an old suggestion by Schroedinger. The amplitude modulation of the fast Rabi oscillations which occur for a strong, coherent initial field is obtained from the spin intrinsic depolarization resulting from corrections to the mean field approximation. (Author) [pt
Plea bargaining and the religious cum socio-cultural concept of ...
African Journals Online (AJOL)
Plea bargaining and the religious cum socio-cultural concept of Yoruba ọmọlúàbí in the Nigerian political landscape. ... Ilorin Journal of Religious Studies ... It therefore, attempts to define what is meant by plea bargaining, introduction as to its ...
Generalized Tavis-Cummings models and quantum networks
Gorokhov, A. V.
2018-04-01
The properties of quantum networks based on generalized Tavis-Cummings models are theoretically investigated. We have calculated the information transfer success rate from one node to another in a simple model of a quantum network realized with two-level atoms placed in the cavities and interacting with an external laser field and cavity photons. The method of dynamical group of the Hamiltonian and technique of corresponding coherent states were used for investigation of the temporal dynamics of the two nodes model.
Cum se traduce ‘rușinea’. Abordare traductologică (I
Directory of Open Access Journals (Sweden)
Magda Jeanrenaud
2017-03-01
Full Text Available Pornind de la sfera semantică și lexicală a conceptelor honte (limba franceză și, respectiv, rușine (limba română, îmi propun să examinez modul cum se traduce acesta în limba română pornind de la un studiu de caz. În acest scop, voi încerca să elaborez un studiu traductologic comparativ al lucrării lui Boris Cyrulnik, intitulată Mourir de dire. La honte (Éditions Odile Jacob, Paris, 2010 și a traducerii sale în limba română, intitulată Mai bine mor decît să spun. Rușinea (traducere din limba franceză de Valentin Protopopescu, Editura Trei, col. „Psihologia pentru toți”, București, 2012. Textul lui Cyrulnik are o particularitate: oscilează între factura literară și cea a unui text specializat. Din acest punct de vedere, transpunerea lui pune la încercare teoriile funcționaliste ale traducerii și, mai ales, teoria skopos-ului elaborată de Katharina Reiss și Hans Vermeer: este interesant de analizat cum „decodează” traducătorul „intenționalitatea” acestui tip de text, totuși specializat, cum decide el să transpună sfera sa semantică și lexicală în limba română.
Berry phase in a two-atom Jaynes-Cummings model with Kerr medium
International Nuclear Information System (INIS)
Bu Shenping; Zhang Guofeng; Liu Jia; Chen Ziyu
2008-01-01
The Jaynes-Cummings model (JCM) is an very important model for describing interaction between quantized electromagnetic fields and atoms in cavity quantum electrodynamics (QED). This model is generalized in many different directions since it predicts many novel quantum effects that can be verified by modern physics experimental technologies. In this paper, the Berry phase and entropy of the ground state for arbitrary photon number n of a two-atom Jaynes-Cummings model with Kerr-like medium are investigated. It is found that there is some correspondence between their images, especially the existence of a curve in the Δ-ε plane along which the energy, Berry phase and entropy all reach their special values. So it is available for detecting entanglement by applying Berry phase.
Berry phase in a two-atom Jaynes-Cummings model with Kerr medium
Energy Technology Data Exchange (ETDEWEB)
Bu Shenping; Zhang Guofeng; Liu Jia; Chen Ziyu [Department of Physics, School of Science, BeiHang University, Xueyuan Road, Beijing 100083 (China)], E-mail: chenzy@buaa.edu.cn
2008-12-15
The Jaynes-Cummings model (JCM) is an very important model for describing interaction between quantized electromagnetic fields and atoms in cavity quantum electrodynamics (QED). This model is generalized in many different directions since it predicts many novel quantum effects that can be verified by modern physics experimental technologies. In this paper, the Berry phase and entropy of the ground state for arbitrary photon number n of a two-atom Jaynes-Cummings model with Kerr-like medium are investigated. It is found that there is some correspondence between their images, especially the existence of a curve in the {delta}-{epsilon} plane along which the energy, Berry phase and entropy all reach their special values. So it is available for detecting entanglement by applying Berry phase.
The squeezing properties in the Jaynes-Cummings model with arbitrary intensity-dependent coupling
International Nuclear Information System (INIS)
Rhui-Hua, X.; Dun-Huan, L.; Gong-Ou, X.
1996-01-01
It is studied the squeezing properties of the atom and the radiation field in arbitrary intensity-dependent-coupling Jaynes-Cummings model when it is restricted to the following initial condition: the atom in its coherent state and the field in the vacuum state. The influence of virtual-photon processes on the atomic squeezing predicted by the Jaynes-Cummings model (JCM) has been examined. The relationship between the field and atomic squeezing in the resonant multi-photon JCM has been discussed. The symmetry between the field and atomic squeezing (SFAS) has been exposed in the resonant vacuum one-photon JCM, and the influence of non-resonant interaction and virtual-photon processes on the SFAS has also been discussed
Advertisement for the position of “Copy Editor cum Proof Reader ...
Indian Academy of Sciences (India)
user
Advertisement for the position of “Copy Editor cum. Proof Reader”. Indian Academy of Sciences (IASc), an institution under the. Department of Science & Technology, Government of India publishes scholarly journals, thematic books and other publications. The. Academy currently publishes 10 journals in various disciplines ...
General sets of coherent states and the Jaynes-Cummings model
International Nuclear Information System (INIS)
Daoud, M.; Hussin, V.
2002-01-01
General sets of coherent states are constructed for quantum systems admitting a nondegenerate infinite discrete energy spectrum. They are eigenstates of an annihilation operator and satisfy the usual properties of standard coherent states. The application of such a construction to the quantum optics Jaynes-Cummings model leads to a new understanding of the properties of this model. (author)
Zhai, Xue-jia; Chen, Fen; Zhu, Chao-ran; Lu, Yong-ning
2015-11-01
Many amino acid neurotransmitters in urine are associated with chronic stress as well as major depressive disorders. To better understand depression, an analytical LC-MS/MS method for the simultaneous determination of 11 underivatized neurotransmitters (4-aminohippurate, 5-HIAA, glutamate, glutamine, hippurate, pimelate, proline, tryptophan, tyramine, tyrosine and valine) in a single analytical run was developed. The advantage of this method is the simple preparation in that there is no need to deconjugate the urine samples. The quantification range was 25-12,800 ng mL(-1) with >85.8% recovery for all analytes. The nocturnal urine concentrations of the 11 neurotransmitters in chronic unpredictable mild stress (CUMS) model rats and control group (n = 12) were analyzed. A series of significant changes in urinary excretion of neurotransmitters could be detected: the urinary glutamate, glutamine, hippurate and tyramine concentrations were significantly lower in the CUMS group. In addition, the urinary concentrations of tryptophan as well as tyrosine were significantly higher in chronically stressed rats. This method allows the assessment of the neurotransmitters associated with CUMS in rat urine in a single analytical run, making it suitable for implementation as a routine technique in depression research. Copyright © 2015 John Wiley & Sons, Ltd.
Qudit quantum computation in the Jaynes-Cummings model
DEFF Research Database (Denmark)
Mischuck, Brian; Mølmer, Klaus
2013-01-01
We have developed methods for performing qudit quantum computation in the Jaynes-Cummings model with the qudits residing in a finite subspace of individual harmonic oscillator modes, resonantly coupled to a spin-1/2 system. The first method determines analytical control sequences for the one......- and two-qudit gates necessary for universal quantum computation by breaking down the desired unitary transformations into a series of state preparations implemented with the Law-Eberly scheme [ Law and Eberly Phys. Rev. Lett. 76 1055 (1996)]. The second method replaces some of the analytical pulse...
Sun, Xiaoyan; Song, Zhenhua; Si, Yawei; Wang, Jin-Hui
2018-06-01
Chronic stress with lack of reward presumably may impair brain reward circuit, leading to major depressive disorder (MDD). Most individuals experiencing chronic stress do not suffer from MDD, i.e., resilience, implying the presence of endogenous anti-depression in the brain. Molecular mechanisms underlying stress-induced depression versus resilience were investigated. Mice were treated by chronic unpredictable mild stress (CUMS) for four weeks. Their mood state was assessed by behavioral tasks, such as sucrose preference, Y-maze and forced swimming testes. To reveal comprehensive molecular profiles of major depression versus resilience, mRNA and microRNA profiles were analyzed by high-throughput sequencing in the ventral tegmental area (VTA) harvested from control, CUMS-susceptible and CUMS-resilience mice. In data analyses of control versus CUMS-susceptible mice as well as control versus CUMS-resilience mice, 1.5 fold ratio in reads per kilo-base per million reads was set as the threshold to judge the involvement of mRNAs and microRNAs in the CUMS, depression or resilience. The downregulation of synaptic vesicle cycle, neurotrophin, GABAergic synapse and morphine addiction as well as the upregulation of transmitter release, calcium signal and cAMP-dependent response element binding are associated to CUMS-susceptibility. The downregulation of tyrosine metabolism and protein process in endoplasmic reticulum as well as the upregulation of amino acid biosynthesis, neuroactive ligand-receptor interaction and dopaminergic synapse are associated to CUMS-resilience. Therefore, the impairment of neurons and GABA/dopaminergic synapses in the VTA is associated with major depression. The upregulation of these entities is associated with resilience. Consistent results obtained from analyzing mRNAs and microRNAs as well as using different approaches strengthen our finding and conclusion. Copyright © 2018. Published by Elsevier Inc.
Dynamics of pairwise entanglement between two Tavis-Cummings atoms
International Nuclear Information System (INIS)
Guo Jinliang; Song Heshan
2008-01-01
We investigate the time evolution of pairwise entanglement between two Tavis-Cummings atoms for various entangled initial states, including pure and mixed states. We find that the phenomenon of entanglement sudden death behaviors is distinct in the evolution of entanglement for different initial states. What deserves mentioning here is that the initial portion of the excited state in the initial state is responsible for the sudden death of entanglement, and the degree of this effect also depends on the initial states
Directory of Open Access Journals (Sweden)
Carlos A. Hernández M.
2012-06-01
Full Text Available Se conceptualiza en el aporte de la Educación Superior al Desarrollo Local en los municipios, cómo se inserta en el proceso, las amenazas a su participación y las oportunidades generadas por su inclusión. Se analiza la situación actual y perspectiva y las Estrategias a seguir por la Educación Superior en los municipios. Se define como se trabaja la seguridad alimentaria en función del Desarrollo Local, la superación de Postgrado en el CUM, la formación y superación de los cuadros, la participación en proyectos pertinentes en energía, medio ambiente, servicios a la población, industrias locales y problemas socio - comunitarios y la formación vocacional y articulación pertinente con la Enseñanza Técnico Profesional. Por último se hace una propuesta de Indicadores y herramientas para medir el impacto de la Gestión del Conocimiento y la Innovación dentro del Programa de Desarrollo Local dividida en 2 grupos: Indicadores de funcionamiento interno del CUM e Indicadores de funcionamiento del CUM hacia el Desarrollo Local del Municipio.
Directory of Open Access Journals (Sweden)
Se Chul Chun
2018-02-01
Full Text Available Graviola is one of the most accomplished natural anticancer therapists gaining popularity in recent times. Harnessing the full benefit from tapping all of its rich bioactive reservoirs is absolutely worthy and mandatory. It is in this regard that a well optimized extraction methodology gains paramount importance. In case of Graviola, no sophistication in terms of extraction methods is reported. A neoteric sonication cum microwave combined extraction technology was introduced that maximized the extraction process and minimized (7 min the extraction time. The extraction efficiency was validated based on the significant enrichment of bioactive ingredients in Graviola extracts following the sonication cum microwave combined protocol.
Dynamics of atom-field entanglement for Tavis-Cummings models
Bashkirov, Eugene K.
2018-04-01
An exact solution of the problem of two-atom one- and two-mode Jaynes-Cummings model with intensity- dependent coupling is presented. Asymptotic solutions for system state vectors are obtained in the approximation of large initial coherent fields. The atom-field entanglement is investigated on the basis of the reduced atomic entropy dynamics. The possibility of the system being initially in a pure disentangled state to revive into this state during the evolution process for both models is shown. Conditions and times of disentanglement are derived.
X-linked ocular albinism in Blacks. Ocular albinism cum pigmento.
O'Donnell, F E; Green, W R; Fleischman, J A; Hambrick, G W
1978-07-01
X-linked ocular albinism can be an unsuspected cause of congenital nystagmus in blacks. In this study, eight of ten black ocular albinos from two kindreds had nonalbinotic, moderately pigmented fundi and no transillumination of the iris. We refer to this paradoxical condition as "ocular albinism cum pigmento." The only constant ophthalmoscopic feature was a foveal hypoplasia. Biopsy of clinically normal skin to demonstrate giant pigment granules is the most accurate means of diagnosis.
A noble additive cum compatibilizer for dispersion of nanoclay into ethylene octene elastomer
CSIR Research Space (South Africa)
Mondal, S
2016-06-01
Full Text Available This paper introduces a poly(ethylene-co-octene)-poly(ethylene-co-vinyl acetate) double network hybrid as a noble additive cum compatibilizer for poly(ethylene-co-octene) (POE). The addition of only 0.5 mass% of the hybrid into POE has raised...
Dynamics of Entanglement in Jaynes–Cummings Nodes with Nonidentical Qubit-Field Coupling Strengths
Directory of Open Access Journals (Sweden)
Li-Tuo Shen
2017-07-01
Full Text Available How to analytically deal with the general entanglement dynamics of separate Jaynes–Cummings nodes with continuous-variable fields is still an open question, and few analytical approaches can be used to solve their general entanglement dynamics. Entanglement dynamics between two separate Jaynes–Cummings nodes are examined in this article. Both vacuum state and coherent state in the initial fields are considered through the numerical and analytical methods. The gap between two nonidentical qubit-field coupling strengths shifts the revival period and changes the revival amplitude of two-qubit entanglement. For vacuum-state fields, the maximal entanglement is fully revived after a gap-dependence period, within which the entanglement nonsmoothly decreases to zero and partly recovers without exhibiting sudden death phenomenon. For strong coherent-state fields, the two-qubit entanglement decays exponentially as the evolution time increases, exhibiting sudden death phenomenon, and the increasing gap accelerates the revival period and amplitude decay of the entanglement, where the numerical and analytical results have an excellent coincidence.
Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice?
Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad
2017-10-01
Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.
Application of Singh et al., unbiased estimator in a dual to ratio-cum ...
African Journals Online (AJOL)
This paper applied an unbiased estimator in a dual to ratio–cum-product estimator in sample surveys to double sampling design. Its efficiency over the conventional biased double sampling design estimator was determined based on the conditions attached to its supremacy. Three different data sets were used to testify to ...
Directory of Open Access Journals (Sweden)
Hong-ping Huang
2017-05-01
Full Text Available Chronic stressors can often lead to the development of psychological disorders, such as depression and anxiety. The locus coeruleus (LC is a stress sensitive brain region located in the pons, with noradrenergic neurons that project to the hypothalamus, especially the paraventricular nucleus (PVN of the hypothalamus. The purpose of this paper is to better understand how alpha 2A-adrenoceptors (α2A-ARs and LC-hypothalamus noradrenergic system participate in the pathophysiological mechanism of depression. In vivo norepinephrine (NE release in the PVN triggered by electrical stimulation in the LC was detected with carbon fiber electrodes in depression model of rats induced by chronic unpredictable mild stress (CUMS. Also, the extracellular level of NE in the PVN was measured by microdialysis in vivo without any stimulation in the LC. The alpha 2-adrenoceptor (α2-AR antagonist yohimbine and α2A-ARs antagonist BRL-44408 maleate were systemically administered to rats to determine the effects of α2A-ARs on NE release in the PVN. The peak value of elicited NE release signals in the PVN induced by electrical stimulation in the LC in the CUMS rats were lower than that in the control rats. The extracellular levels of NE in the PVN of the CUMS rats were significantly less than that of the control rats. Intraperitoneal injection of yohimbine or BRL-44408 maleate significantly potentiated NE release in the PVN of the CUMS rats. The CUMS significantly increased protein expression levels of α2A-AR in the hypothalamus, and BRL-44408 maleate significantly reversed the increase of α2A-AR protein expression levels in the CUMS rats. Our results suggest that the CUMS could significantly facilitate the effect of α2-adrenoceptor-mediated presynaptic inhibition and decrease the release of NE in the PVN from LC. Blockade of the inhibitory action of excessive α2A-adrenergic receptors in the CUMS rats could increase the level of NE in the PVN, which is effective in
Li, Meng; Fu, Qiang; Li, Ying; Li, Shanshan; Xue, Jinsong; Ma, Shiping
2014-10-01
Emodin, the major active component of Rhubarb, has shown neuroprotective activity. This study is attempted to investigate whether emodin possesses beneficial effects on chronic unpredictable mild stress (CUMS)-induced behavioral deficits (depression-like behaviors) and explore the possible mechanisms. ICR mice were subjected to chronic unpredictable mild stress for 42 consecutive days. Then, emodin and fluoxetine (positive control drug) were administered for 21 consecutive days at the last three weeks of CUMS procedure. The classical behavioral tests: open field test (OFT), sucrose preference test (SPT), tail suspension test (TST) and forced swimming test (FST) were applied to evaluate the antidepressant effects of emodin. Then plasma corticosterone concentration, hippocampal glucocorticoid receptor (GR) and brain-derived neurotrophic factor (BDNF) levels were tested to probe the mechanisms. Our results indicated that 6 weeks of CUMS exposure induced significant depression-like behavior, with high, plasma corticosterone concentration and low hippocampal GR and BDNF expression levels. Whereas, chronic emodin (20, 40 and 80 mg/kg) treatments reversed the behavioral deficiency induced by CUMS exposure. Treatment with emodin normalized the change of plasma corticosterone level, which demonstrated that emodin could partially restore CUMS-induced HPA axis impairments. Besides, hippocampal GR (mRNA and protein) and BDNF (mRNA) expressions were also up-regulated after emodin treatments. In conclusion, emodin remarkably improved depression-like behavior in CUMS mice and its antidepressant activity is mediated, at least in part, by the up-regulating GR and BDNF levels in hippocampus. Copyright © 2014 Elsevier B.V. All rights reserved.
Agmatine attenuates chronic unpredictable mild stress induced behavioral alteration in mice.
Taksande, Brijesh G; Faldu, Dharmesh S; Dixit, Madhura P; Sakaria, Jay N; Aglawe, Manish M; Umekar, Milind J; Kotagale, Nandkishor R
2013-11-15
Chronic stress exposure and resulting dysregulation of the hypothalamic pituitary adrenal axis develops susceptibility to variety of neurological and psychiatric disorders. Agmatine, a putative neurotransmitter has been reported to be released in response to various stressful stimuli to maintain the homeostasis. Present study investigated the role of agmatine on chronic unpredictable mild stress (CUMS) induced behavioral and biochemical alteration in mice. Exposure of mice to CUMS protocol for 28 days resulted in diminished performance in sucrose preference test, splash test, forced swim test and marked elevation in plasma corticosterone levels. Chronic agmatine (5 and 10 mg/kg, ip, once daily) treatment started on day-15 and continued till the end of the CUMS protocol significantly increased sucrose preference, improved self-care and motivational behavior in the splash test and decreased duration of immobility in the forced swim test. Agmatine treatment also normalized the elevated corticosterone levels and prevented the body weight changes in chronically stressed animals. The pharmacological effect of agmatine was comparable to selective serotonin reuptake inhibitor, fluoxetine (10mg/kg, ip). Results of present study clearly demonstrated the anti-depressant like effect of agmatine in chronic unpredictable mild stress induced depression in mice. Thus the development of drugs based on brain agmatinergic modulation may represent a new potential approach for the treatment of stress related mood disorders like depression. © 2013 Published by Elsevier B.V.
An algebraic method to solve the Tavis-Cummings problem
International Nuclear Information System (INIS)
Vadejko, I.P.; Miroshnichenko, G.P.; Rybin, A.V.; Timonen, J.
2003-01-01
We study cooperative behaviour of the system of two-level atoms coupled to a single mode of the electromagnetic field in the resonator. We have developed a general procedure allowing one to rewrite a polynomial deformed SU(2) algebra in terms of another polynomial deformation. Using these methods, we have constructed a perturbation series for the Tavis-Cummings Hamiltonian and diagonalized it in the third order. Based on the zero-order Hamiltonian we calculate the intensity of spontaneous emission of N two-level atoms inside a cavity, which are in thermal equilibrium with the reservoir. The atom-atom correlation determining superradiance in the system is analyzed
Jaynes-Cummings model and the deformed-oscillator algebra
International Nuclear Information System (INIS)
Crnugelj, J.; Martinis, M.; Mikuta-Martinis, V.
1994-01-01
We study the time evolution of the deformed Jaynes-Cummings model (DJCM). It is shown that the standard JCM and its recent non-linear generalizations involving the intensity-dependent coupling and/or the multiphoton coupling are only particular cases of the DJCM. The time evolution of the mean phonon number and the population inversion are evaluated. A special case of the q-deformed JCM is analyzed explicitly. The long time quasi-periodic revival effects of the q-deformed JCM are observed for q∼1 and an initially large mean photon number. For other values of the deformation parameter q we observe chaotic-like behaviour of the population inversion. Photons are assumed to be initially in the deformed coherent state. ((orig.))
Wang, Yuwen
2016-09-22
We study the dynamics of an ultrafast single photon pulse in a one-dimensional waveguide two-point coupled with a Jaynes-Cummings system. We find that for any single photon input the transmissivity depends periodically on the separation between the two coupling points. For a pulse containing many plane wave components it is almost impossible to suppress transmission, especially when the width of the pulse is less than 20 times the period. In contrast to plane wave input, the waveform of the pulse can be modified by controlling the coupling between the waveguide and Jaynes-Cummings system. Tailoring of the waveform is important for single photon manipulation in quantum informatics. © The Author(s) 2016.
Grassmann phase space theory and the Jaynes–Cummings model
International Nuclear Information System (INIS)
Dalton, B.J.; Garraway, B.M.; Jeffers, J.; Barnett, S.M.
2013-01-01
The Jaynes–Cummings model of a two-level atom in a single mode cavity is of fundamental importance both in quantum optics and in quantum physics generally, involving the interaction of two simple quantum systems—one fermionic system (the TLA), the other bosonic (the cavity mode). Depending on the initial conditions a variety of interesting effects occur, ranging from ongoing oscillations of the atomic population difference at the Rabi frequency when the atom is excited and the cavity is in an n-photon Fock state, to collapses and revivals of these oscillations starting with the atom unexcited and the cavity mode in a coherent state. The observation of revivals for Rydberg atoms in a high-Q microwave cavity is key experimental evidence for quantisation of the EM field. Theoretical treatments of the Jaynes–Cummings model based on expanding the state vector in terms of products of atomic and n-photon states and deriving coupled equations for the amplitudes are a well-known and simple method for determining the effects. In quantum optics however, the behaviour of the bosonic quantum EM field is often treated using phase space methods, where the bosonic mode annihilation and creation operators are represented by c-number phase space variables, with the density operator represented by a distribution function of these variables. Fokker–Planck equations for the distribution function are obtained, and either used directly to determine quantities of experimental interest or used to develop c-number Langevin equations for stochastic versions of the phase space variables from which experimental quantities are obtained as stochastic averages. Phase space methods have also been developed to include atomic systems, with the atomic spin operators being represented by c-number phase space variables, and distribution functions involving these variables and those for any bosonic modes being shown to satisfy Fokker–Planck equations from which c-number Langevin equations are
Directory of Open Access Journals (Sweden)
T Ashino
2008-11-01
Full Text Available On March 4-5, 2008, the CODATA Task Group for Exchangeable Material Data Representation to Support Research and Education held a two day seminar cum meeting at the National Physical Laboratory (NPL, New Delhi, India, with NPL materials researchers and task group members representing material activities and databases from seven countries: European Union (The Czech Republic, France, and the Netherlands, India, Korea, Japan, and the United States. The NPL seminar included presentations about the researchers' work. The Task Group meeting included presentations about current data related activities of the members. Joint discussions between NPL researchers and CODATA task group members began an exchange of viewpoints among materials data producers, users, and databases developers. The seminar cum meeting included plans to continue and expand Task Group activities at the 2008 CODATA 21st Meeting in Kyiv, Ukraine.
Yazir, Yusufhan; Utkan, Tijen; Gacar, Nejat; Aricioglu, Feyza
2015-01-01
A number of studies have recently focused on the neuroprotective and anti-inflammatory effects of resveratrol. In prior studies, we described its beneficial effects on scopolamine-induced learning deficits in rats. The aim of this study was to investigate the effects of resveratrol on emotional and spatial cognitive functions, neurotropic factor expression, and plasma levels of proinflammatory cytokines in rats exposed to chronic unpredictable mild stress (CUMS), which is known to induce cognitive deficits. Resveratrol (5 or 20mg/kg) was administered intraperitoneally for 35 days. Rats in the CUMS group and in the 5mg/kg resveratrol+CUMS group performed poorly in tasks designed to assess emotional and spatial learning and memory. The 20mg/kg resveratrol+CUMS group showed improved performance compared to the CUMS group. In addition, the CUMS procedure induced lower expression of brain-derived neurotrophic factor and c-Fos in hippocampal CA1 and CA3 and in the amygdala of stressed rats. These effects were reversed by chronic administration of resveratrol (20mg/kg). In addition, plasma levels of tumor necrosis factor-alpha and interleukin-1 beta were increased by CUMS, but were restored to normal by resveratrol. These results indicate that resveratrol significantly attenuates the deficits in emotional learning and spatial memory seen in chronically stressed rats. These effects may be related to resveratrol-mediated changes in neurotrophin factor expression in hippocampus and in levels of proinflammatory cytokines in circulation. Copyright © 2014 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Wang, Yimin; Haw, Jing Yan
2015-01-01
Highlights: • The intermediate rotating wave approximation (IRWA) is introduced. • The co-rotating and counter-rotating terms in Rabi model are expressed separately. • IRWA is applied to the near resonance case and the large detuning case. • The continuity between the Jaynes–Cummings model and the Rabi model is established. - Abstract: We present a novel approach called the intermediate rotating wave approximation (IRWA), which employs a time-averaging method to encapsulate the dynamics of light-matter interaction from strong to ultrastrong coupling regime. In contrast to the ordinary rotating wave approximation, this method addresses the co-rotating and counter-rotating terms separately to trace their physical consequences individually, and thus establishes the continuity between the Jaynes–Cummings model and the quantum Rabi model. We investigate IRWA in near resonance and large detuning cases. Our IRWA not only agrees well with both models in their respective coupling strengths, but also offers a good explanation of their differences
Huang, Hui-Jie; Zhu, Xiao-Cang; Han, Qiu-Qin; Wang, Ya-Lin; Yue, Na; Wang, Jing; Yu, Rui; Li, Bing; Wu, Gen-Cheng; Liu, Qiong; Yu, Jin
2017-05-30
As a regulator of food intake, ghrelin also plays a key role in mood disorders. Previous studies reported that acute ghrelin administration defends against depressive symptoms of chronic stress. However, the effects of long-term ghrelin on rodents under chronic stress hasn't been revealed. In this study, we found chronic peripheral administration of ghrelin (5nmol/kg/day for 2 weeks, i.p.) could alleviate anxiety- and depression-like behaviors induced by chronic unpredictable mild stress (CUMS). The depression-like behaviors were assessed by the forced swimming test (FST), and anxiety-like behaviors were assessed by the open field test (OFT) and the elevated plus maze test (EPM). Meanwhile, we observed that peripheral acylated ghrelin, together with gastral and hippocampal ghrelin prepropeptide mRNA level, were significantly up-regulated in CUMS mice. Besides, the increased protein level of growth hormone secretagogue receptor (GHSR) in hippocampus were also detected. These results suggested that the endogenous ghrelin/GHSR pathway activated by CUMS plays a role in homeostasis. Further results showed that central treatment of ghrelin (10μg/rat/day for 2 weeks, i.c.v.) or GHRP-6 (the agonist of GHSR, 10μg/rat/day for 2 weeks, i.c.v.) significantly alleviated the depression-like behaviors induced by CUMS in FST and sucrose preference test (SPT). Based on these results, we concluded that central GHSR is involved in the antidepressant-like effect of exogenous ghrelin treatment, and ghrelin/GHSR may have the inherent neuromodulatory properties against depressive symptoms. Copyright © 2017 Elsevier B.V. All rights reserved.
A CATASTROPHIC-CUM-RESTORATIVE QUEUING SYSTEM WITH CORRELATED BATCH ARRIVALS AND VARIABLE CAPACITY
Directory of Open Access Journals (Sweden)
Rakesh Kumar
2008-07-01
Full Text Available In this paper, we study a catastrophic-cum-restorative queuing system with correlated batch arrivals and service in batches of variable sizes. We perform the transient analysis of the queuing model. We obtain the Laplace Transform of the probability generating function of system size. Finally, some particular cases of the model have been derived and discussed. Keywords: Queue length, Catastrophes, Correlated batch arrivals, Broadband services, Variable service capacity, and Restoration.
Changes in tau phosphorylation levels in the hippocampus and frontal cortex following chronic stress
Energy Technology Data Exchange (ETDEWEB)
Yang, C.; Guo, X. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wang, G.H. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China); Wuhan University, Institute of Neuropsychiatry, Wuhan, China, Institute of Neuropsychiatry, Wuhan University, Wuhan (China); Wang, H.L.; Liu, Z.C.; Liu, H.; Zhu, Z.X.; Li, Y. [Wuhan University, Renmin Hospital, Department of Psychiatry, Wuhan, China, Department of Psychiatry, Renmin Hospital, Wuhan University, Wuhan (China)
2014-03-03
Studies have indicated that early-life or early-onset depression is associated with a 2- to 4-fold increased risk of developing Alzheimers disease (AD). In AD, aggregation of an abnormally phosphorylated form of the tau protein may be a key pathological event. Tau is known to play a major role in promoting microtubule assembly and stabilization, and in maintaining the normal morphology of neurons. Several studies have reported that stress may induce tau phosphorylation. The main aim of the present study was to investigate possible alterations in the tau protein in the hippocampus and frontal cortex of 32 male Sprague-Dawley rats exposed to chronic unpredictable mild stress (CUMS) and then re-exposed to CUMS to mimic depression and the recurrence of depression, respectively, in humans. We evaluated the effects of CUMS, fluoxetine, and CUMS re-exposure on tau and phospho-tau. Our results showed that a single exposure to CUMS caused a significant reduction in sucrose preference, indicating a state of anhedonia. The change in behavior was accompanied by specific alterations in phospho-tau protein levels, but fluoxetine treatment reversed the CUMS-induced impairments. Moreover, changes in sucrose preference and phospho-tau were more pronounced in rats re-exposed to CUMS than in those subjected to a single exposure. Our results suggest that changes in tau phosphorylation may contribute to the link between depression and AD.
Changes in tau phosphorylation levels in the hippocampus and frontal cortex following chronic stress
International Nuclear Information System (INIS)
Yang, C.; Guo, X.; Wang, G.H.; Wang, H.L.; Liu, Z.C.; Liu, H.; Zhu, Z.X.; Li, Y.
2014-01-01
Studies have indicated that early-life or early-onset depression is associated with a 2- to 4-fold increased risk of developing Alzheimers disease (AD). In AD, aggregation of an abnormally phosphorylated form of the tau protein may be a key pathological event. Tau is known to play a major role in promoting microtubule assembly and stabilization, and in maintaining the normal morphology of neurons. Several studies have reported that stress may induce tau phosphorylation. The main aim of the present study was to investigate possible alterations in the tau protein in the hippocampus and frontal cortex of 32 male Sprague-Dawley rats exposed to chronic unpredictable mild stress (CUMS) and then re-exposed to CUMS to mimic depression and the recurrence of depression, respectively, in humans. We evaluated the effects of CUMS, fluoxetine, and CUMS re-exposure on tau and phospho-tau. Our results showed that a single exposure to CUMS caused a significant reduction in sucrose preference, indicating a state of anhedonia. The change in behavior was accompanied by specific alterations in phospho-tau protein levels, but fluoxetine treatment reversed the CUMS-induced impairments. Moreover, changes in sucrose preference and phospho-tau were more pronounced in rats re-exposed to CUMS than in those subjected to a single exposure. Our results suggest that changes in tau phosphorylation may contribute to the link between depression and AD
Entre Lilith y Eva: Björk canta E. E. Cummings
Directory of Open Access Journals (Sweden)
Jordi Mas López
2016-05-01
del poeta norteamericano en Sun In My Mouth y el resto de composiciones de Vespertine. Frente a la inequívoca exaltación del héroe solar de Cummings, Björk utiliza una mirada femenina que duda entre los referentes de Lilith, la mujer que encuentra su libertad fuera de la sociedad, y Eva, aquella cuya sumisión es socialmente productiva. El resultado es un discurso de gran valor artístico, pero sujeto, en lo ideológico, a las limitaciones que imponen los motivos de partida
Stefanovic, Bojana; Spasojevic, Natasa; Jovanovic, Predrag; Jasnic, Nebojsa; Djordjevic, Jelena; Dronjak, Sladjana
2016-10-01
The hippocampus is sensitive to stress which activates norepinephrine terminals deriving from the locus coeruleus. Melatonin exerts positive effects on the hippocampal neurogenic process and on depressive-like behaviour. Thus, in the present study, an examination was made of the effect of chronic melatonin treatment on norepinephrine content, synthesis, uptake, vesicular transport and degradation in the hippocampus of rats exposed to CUMS. This entailed quantifying the norephinephrine, mRNA and protein levels of DBH, NET, VMAT 2, MAO-A and COMT. The results show that CUMS evoked prolonged immobility. Melatonin treatment decreased immobility in comparison with the placebo group, reflecting an antidepressant-like effect. Compared with the placebo group, a dramatic decrease in norepinephrine content, decreased VMAT2 mRNA and protein and increased MAO-A protein levels in the hippocampus of the CUMS rats were observed. However, no significant differences in the levels of DBH, NET, COMT mRNA and protein and MAO-A mRNA levels between the placebo and the stressed groups were found. The results showed the restorative effects of melatonin on the stress-induced decline in the norepinephrine content of the hippocampus. It was observed that melatonin treatment in the CUMS rats prevented the stress-induced decrease in VMAT2 mRNA and protein levels, whereas it reduced the increase of the mRNA of COMT and protein levels of MAO-A. Chronic treatment with melatonin failed to alter the gene expression of DBH or NET in the hippocampus of the CUMS rats. Additionally, the results show that melatonin enhances VMAT2 expression and norepinephrine storage, whilst it reduces norepinephrine degrading enzymes. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.
A generalized Jaynes-Cummings model: The relativistic parametric amplifier and a single trapped ion
Energy Technology Data Exchange (ETDEWEB)
Ojeda-Guillén, D., E-mail: dojedag@ipn.mx [Escuela Superior de Cómputo, Instituto Politécnico Nacional, Av. Juan de Dios Bátiz esq. Av. Miguel Othón de Mendizábal, Col. Lindavista, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico); Mota, R. D. [Escuela Superior de Ingeniería Mecánica y Eléctrica, Unidad Culhuacán, Instituto Politécnico Nacional, Av. Santa Ana No. 1000, Col. San Francisco Culhuacán, Delegación Coyoacán, C.P. 04430 Ciudad de México (Mexico); Granados, V. D. [Escuela Superior de Física y Matemáticas, Instituto Politécnico Nacional, Ed. 9, Unidad Profesional Adolfo López Mateos, Delegación Gustavo A. Madero, C.P. 07738 Ciudad de México (Mexico)
2016-06-15
We introduce a generalization of the Jaynes-Cummings model and study some of its properties. We obtain the energy spectrum and eigenfunctions of this model by using the tilting transformation and the squeezed number states of the one-dimensional harmonic oscillator. As physical applications, we connect this new model to two important and novelty problems: the relativistic parametric amplifier and the quantum simulation of a single trapped ion.
Mao, Qing-Qiu; Xian, Yan-Fang; Ip, Siu-Po; Tsai, Sam-Hip; Che, Chun-Tao
2010-07-11
The root part of Paeonia lactiflora Pall., commonly known as peony, is a commonly used Chinese herb for the treatment of depression-like disorders. Previous studies in our laboratory have showed that total glycosides of peony (TGP) produced antidepressant-like action in various mouse models of behavioral despair. The present study aimed to investigate the mechanism(s) underlying the antidepressant-like action of TGP by measuring neurotrophins including brain-derived neurotrophic factor (BDNF) and nerve growth factor (NGF) in non-stressed and chronic unpredictable mild stress (CUMS)-treated rats. TGP (80 or 160 mg/kg/day) was administered by oral gavage to the animals for 5 weeks. The results showed that CUMS caused depression-like behavior in rats, as indicated by the significant decreases in sucrose consumption and locomotor activity (assessed by open-field test). In addition, it was found that BDNF contents in the hippocampus and frontal cortex were significantly decreased in CUMS-treated rats. CUMS treatment also significantly decreased the level of NGF in the frontal cortex of the animals. Daily intragastric administration of TGP (80 or 160 mg/kg/day) during the five weeks of CUMS significantly suppressed behavioral and biochemical changes induced by CUMS. Treating non-stressed animals with TGP (160 mg/kg) for 5 weeks also significantly increased BDNF contents in the hippocampus and frontal cortex, and NGF contents in the frontal cortex. The results suggest that the antidepressant-like action of TGP is mediated, at least in part, by increasing the expression of BDNF and NGF in selective brain tissues. Copyright 2010 Elsevier B.V. All rights reserved.
Cavity losses for the dissipative Jaynes-Cummings Hamiltonian beyond rotating wave approximation
International Nuclear Information System (INIS)
Scala, M; Militello, B; Messina, A; Maniscalco, S; Piilo, J; Suominen, K-A
2007-01-01
A microscopic derivation of the master equation for the Jaynes-Cummings model with cavity losses is given, taking into account the terms in the dissipator which vary with frequencies of the order of the vacuum Rabi frequency. Our approach allows us to single out physical contexts wherein the usual phenomenological dissipator turns out to be fully justified and constitutes an extension of our previous analysis (Scala et al 2007 Phys. Rev. A 75 013811), where a microscopic derivation was given in the framework of the rotating wave approximation
Design, construction and experimental study of Electric Cum Solar Oven-II
International Nuclear Information System (INIS)
Nandwani, S.S.
1987-11-01
As in many developing countries, 35-40% of the population of Costa Rica still use firewood for domestic cooking. Considering the fact that Costa Rica is blessed with good sunshine, good hydroelectric potential, and a good electric network, a hybrid solar oven was thought to be useful. In the present paper the construction and working of a new type of Electric Cum Solar Oven (ECSO) has been described. This oven can be used for cooking and baking any type of meal at any time during the year employing solar and/or electric energy but consuming the minimum quantity of electric energy in case it is required. (author). 9 refs, 6 figs, 1 tab
Nonlinear Jaynes–Cummings model for two interacting two-level atoms
International Nuclear Information System (INIS)
Santos-Sánchez, O de los; González-Gutiérrez, C; Récamier, J
2016-01-01
In this work we examine a nonlinear version of the Jaynes–Cummings model for two identical two-level atoms allowing for Ising-like and dipole–dipole interplays between them. The model is said to be nonlinear in the sense that it can incorporate both a general intensity-dependent interaction between the atomic system and the cavity field and/or the presence of a nonlinear medium inside the cavity. As an example, we consider a particular type of atom-field coupling based upon the so-called Buck–Sukumar model and a lossless Kerr-like cavity. We describe the possible effects of such features on the evolution of some quantities of current interest, such as atomic excitation, purity, concurrence, the entropy of the field and the evolution of the latter in phase space. (paper)
E. E. Cummings: From Parenthesis to Personality (Part II
Directory of Open Access Journals (Sweden)
Uroš Mozetič
2007-06-01
Full Text Available The paper presents the unique oeuvre of E.E. Cummings; who claims an outstanding position in the heritage of American poetry; as a case of Bildungsdichtung. This status is largely due to his highly innovative and iconoclastic approach to poetic composition; starting from his early rebellious endeavours drawing on an astounding variety of non-standard and downright shocking potentialities of the English language (including such peculiar linguistic and stylistic idiosyncracies as drastic changes of the syntactic English word order; shifts at the morphology and word-formation level; unorthodox use of punctuation; extravagant typography and spacing or arrangement of space between the lines; a diversity of meters and rhymes; as well as seemingly eccentric imagery; to his later and invariably maturer poetic diction – the diction of one who has apparently come to terms with the world and his fellow-beings; realising that genuine wisdom resides in the understanding and forgiveness of the inherently fallible human nature rather than in its continuous sardonic scrutiny.
A quantum heat engine based on Tavis-Cummings model
Sun, Kai-Wei; Li, Ran; Zhang, Guo-Feng
2017-09-01
This paper will investigate a four-stroke quantum heat engine based on the Tavis-Cummings model. The cycle of the heat engine is similar to the Otto cycle in classical thermodynamics. The relationship between output power as well as cycle efficiency and external physical system parameters are given. Under this condition, the entanglement behavior of the system will be studied. The system can show considerable entanglement by strictly controlling relevant parameters. Unlike common two-level quantum heat engines, efficiency is a function of temperature, showing interesting and unexpected phenomena. Several ways to adjust engine properties by external parameters are proposed, with which the output power and efficiency can be optimized. The heat engine model exhibits high efficiency and output power with the participation of a small number of photons, and decay rapidly as the number of photons increases in entangled area but shows interesting behaviors in non-entangled area of photon numbers.
Entropy exchange and entanglement in the Jaynes-Cummings model
International Nuclear Information System (INIS)
Boukobza, E.; Tannor, D.J.
2005-01-01
The Jaynes-Cummings model (JCM) is the simplest fully quantum model that describes the interaction between light and matter. We extend a previous analysis by Phoenix and Knight [Ann. Phys. 186, 381 (1988)] of the JCM by considering mixed states of both the light and matter. We present examples of qualitatively different entropic correlations. In particular, we explore the regime of entropy exchange between light and matter, i.e., where the rate of change of the two are anticorrelated. This behavior contrasts with the case of pure light-matter states in which the rate of change of the two entropies are positively correlated and in fact identical. We give an analytical derivation of the anticorrelation phenomenon and discuss the regime of its validity. Finally, we show a strong correlation between the region of the Bloch sphere characterized by entropy exchange and that characterized by minimal entanglement as measured by the negative eigenvalues of the partially transposed density matrix
Pandit, Mahasweta; Das, Sreetama; Singha Roy, Sudipto; Shekhar Dhar, Himadri; Sen, Ujjwal
2018-02-01
We consider a generalized double Jaynes-Cummings model consisting of two isolated two-level atoms, each contained in a lossless cavity that interact with each other through a controlled photon-hopping mechanism. We analytically show that at low values of such a mediated cavity-cavity interaction, the temporal evolution of entanglement between the atoms, under the effects of cavity perturbation, exhibits the well-known phenomenon of entanglement sudden death (ESD). Interestingly, for moderately large interaction values, a complete preclusion of ESD is achieved, irrespective of its value in the initial atomic state. Our results provide a model to sustain entanglement between two atomic qubits, under the adverse effect of cavity induced perturbation, by introducing a non-intrusive inter-cavity photon exchange that can be physically realized through cavity-QED setups in contemporary experiments.
Entanglement dynamics of a double two-photon Jaynes–Cummings model with Kerr-like medium
International Nuclear Information System (INIS)
Xi-Cheng, Ouyang; Mao-Fa, Fang; Guo-Dong, Kang; Xiao-Juan, Deng; Li-Yuan, Huang
2010-01-01
In this paper, the entanglement dynamics of a double two-photon Jaynes–Cummings model with Kerr-like medium is investigated. It is shown that initial entanglement has an interesting subsequent time evolution, including the so-called entanglement sudden death effect. It is also shown analytically that the Kerr-like medium can repress entanglement sudden death and enhance the degree of atom-atom entanglement. A more interesting fact is that the Kerr effect is more obvious when each of the two cavities with have the Kerr-like medium than only one of them with the Kerr-like medium
Directory of Open Access Journals (Sweden)
Pei Jiang
2014-01-01
Full Text Available Depression is associated with stress-induced neural atrophy in limbic brain regions, whereas exercise has antidepressant effects as well as increasing hippocampal synaptic plasticity by strengthening neurogenesis, metabolism, and vascular function. A key mechanism mediating these broad benefits of exercise on the brain is induction of neurotrophic factors, which instruct downstream structural and functional changes. To systematically evaluate the potential neurotrophic factors that were involved in the antidepressive effects of exercise, in this study, we assessed the effects of swimming exercise on hippocampal mRNA expression of several classes of the growth factors (BDNF, GDNF, NGF, NT-3, FGF2, VEGF, and IGF-1 and peptides (VGF and NPY in rats exposed to chronic unpredictable mild stress (CUMS. Our study demonstrated that the swimming training paradigm significantly induced the expression of BDNF and BDNF-regulated peptides (VGF and NPY and restored their stress-induced downregulation. Additionally, the exercise protocol also increased the antiapoptotic Bcl-xl expression and normalized the CUMS mediated induction of proapoptotic Bax mRNA level. Overall, our data suggest that swimming exercise has antidepressant effects, increasing the resistance to the neural damage caused by CUMS, and both BDNF and its downstream neurotrophic peptides may exert a major function in the exercise related adaptive processes to CUMS.
Chilur, Rudragouda; Kumar, Sushilendra
2018-06-01
The Maize ( Zea mays L.) crop is one of the most important cereal in agricultural production systems of Northern Transition Zone (Hyderabad-Karnataka region) in India. These Hyderabad Karnataka farmers (small-medium) are lack of economic technologies with maize dehusking and shelling, which fulfils the two major needs as crops and as livestock in farming. The portable medium size (600 kg/h capacity) electric motor (2.23 kW) operated Maize Dehusker cum Sheller (MDS) was designed to resolve the issue by considering engineering properties of maize. The developed trapezium shaped MDS machine having overall dimensions (length × (top and bottom) × height) of 1200 × (500 and 610) × 810 mm. The selected operational parameters viz, cylinder peripheral speed (7.1 m/s), concave clearance (25 mm) and feed rate (600 kg/h) were studied for machine-performance and seed-quality parameters. The performance of machine under these parameters showed the dehusking efficiency of 99.56%, shelling efficiency of 98.01%, cleaning efficiency of 99.11%, total loss of 3.63% machine capacity of 527.11 kg/kW-h and germination percentage of 98.93%. Overall machine performance was found satisfactory for maize dehusking cum shelling operation as well as to produce the maize grains for seeding purpose.
Chilur, Rudragouda; Kumar, Sushilendra
2018-02-01
The Maize (Zea mays L.) crop is one of the most important cereal in agricultural production systems of Northern Transition Zone (Hyderabad-Karnataka region) in India. These Hyderabad Karnataka farmers (small-medium) are lack of economic technologies with maize dehusking and shelling, which fulfils the two major needs as crops and as livestock in farming. The portable medium size (600 kg/h capacity) electric motor (2.23 kW) operated Maize Dehusker cum Sheller (MDS) was designed to resolve the issue by considering engineering properties of maize. The developed trapezium shaped MDS machine having overall dimensions (length × (top and bottom) × height) of 1200 × (500 and 610) × 810 mm. The selected operational parameters viz, cylinder peripheral speed (7.1 m/s), concave clearance (25 mm) and feed rate (600 kg/h) were studied for machine-performance and seed-quality parameters. The performance of machine under these parameters showed the dehusking efficiency of 99.56%, shelling efficiency of 98.01%, cleaning efficiency of 99.11%, total loss of 3.63% machine capacity of 527.11 kg/kW-h and germination percentage of 98.93%. Overall machine performance was found satisfactory for maize dehusking cum shelling operation as well as to produce the maize grains for seeding purpose.
Sex differences in the stress response in SD rats.
Lu, Jing; Wu, Xue-Yan; Zhu, Qiong-Bin; Li, Jia; Shi, Li-Gen; Wu, Juan-Li; Zhang, Qi-Jun; Huang, Man-Li; Bao, Ai-Min
2015-05-01
Sex differences play an important role in depression, the basis of which is an excessive stress response. We aimed at revealing the neurobiological sex differences in the same study in acute- and chronically-stressed rats. Female Sprague-Dawley (SD) rats were randomly divided into 6 groups: chronic unpredictable mild stress (CUMS), acute foot shock (FS) and controls, animals in all 3 groups were sacrificed in proestrus or diestrus. Male SD rats were randomly divided into 3 groups: CUMS, FS and controls. Comparisons were made of behavioral changes in CUMS and control rats, plasma levels of corticosterone (CORT), testosterone (T) and estradiol (E2), and of the hypothalamic mRNA-expression of stress-related molecules, i.e. estrogen receptor α and β, androgen receptor, aromatase, mineralocorticoid receptor, glucocorticoid receptor, corticotropin-releasing hormone, arginine vasopressin and oxytocin. CUMS resulted in disordered estrus cycles, more behavioral and hypothalamic stress-related molecules changes and a stronger CORT response in female rats compared with male rats. Female rats also showed decreased E2 and T levels after FS and CUMS, while male FS rats showed increased E2 and male CUMS rats showed decreased T levels. Stress affects the behavioral, endocrine and the molecular response of the stress systems in the hypothalamus of SD rats in a clear sexual dimorphic way, which has parallels in human data on stress and depression. Copyright © 2015 Elsevier B.V. All rights reserved.
Design and fabrication of a Czerny-Turner monochromator-cum-spectrograph
International Nuclear Information System (INIS)
Murty, M.V.R.K.; Shukla, R.P.; Bhattacharya, S.S.; Krishnamurthy, G.
1987-01-01
The design and fabrication of a Czerny-Turner monochromator cum spectrograph is described. It consists of a classically ruled grating having 1200 grooves/mm. The collimator is a concave spherical mirror having a radius of curvature 1.025 metre while the focusing element is a concave spherical mirror of radius of curvature 0.925 metre. The design of two unequal radii of curvature for collimating and focusing mirrors is chosen to eliminate the chromatic aberration at the wavelength of 5000A. The linear reciprocal dispersion on the focal surface is about 8A/mm. The resolution of the instrument at the coma corrected wavelength i.e. 5000A is 0.1A. The resolution at the other wavelengths is limited by the residual chromatic aberration which increases linearly with wavelength on either side of the 5000A. Therefore the resolution at the wavelength 2000A and 8000A is about 0.2A. 7 figures. (author)
Zu, Xianpeng; Zhang, Mingjian; Li, Wencai; Xie, Haisheng; Lin, Zhang; Yang, Niao; Liu, Xinru; Zhang, Weidong
2017-11-01
Preliminary studies conducted in our laboratory have confirmed that Bacopaside I (BS-I), a saponin compound isolated from Bacopa monnieri, displayed antidepressant-like activity in the mouse behavioral despair model. The present investigation aimed to verify the antidepressant-like action of BS-I using a mouse model of behavioral deficits induced by chronic unpredictable mild stress (CUMS) and further probe its underlying mechanism of action. Mice were exposed to CUMS for a period of 5 consecutive weeks to induce depression-like behavior. Then, oral gavage administrations with vehicle (model group), fluoxetine (12 mg/kg, positive group) or BS-I (5, 15, 45 mg/kg, treated group) once daily were started during the last two weeks of CUMS procedure. The results showed that BS-I significantly ameliorated CUMS-induced depression-like behaviors in mice, as characterized by an elevated sucrose consumption in the sucrose preference test and reduced immobility time without affecting spontaneous locomotor activity in the forced swimming test, tail suspension test and open field test. It was also found that BS-I treatment reversed the increased level of plasma corticosterone and decreased mRNA and protein expressions of glucocorticoid receptor induced by CUMS exposure, indicating that hypothalamic-pituitary-adrenal (HPA) axis hyperactivity of CUMS-exposed mice was restored by BS-I treatment. Furthermore, chronic administration of BS-I elevated expression levels of brain-derived neurotrophic factor (BDNF) (mRNA and protein) and activated the phosphorylation of extracellular signal-regulated kinase and cAMP response element-binding protein in the hippocampus and prefrontal cortex in mice subjected to CUMS procedure. Taken together, these results indicated that BS-I exhibited an obvious antidepressant-like effect in mouse model of CUMS-induced depression that was mediated, at least in part, by modulating HPA hyperactivity and activating BDNF signaling pathway.
Effect of atomic spontaneous decay on entanglement in the generalized Jaynes-Cummings model
International Nuclear Information System (INIS)
Hessian, H.A.; Obada, A.-S.F.; Mohamed, A.-B.A.
2010-01-01
Some aspects of the irreversible dynamics of a generalized Jaynes-Cummings model are addressed. By working in the dressed-state representation, it is possible to split the dynamics of the entanglement and coherence. The exact solution of the master equation in the case of a high-Q cavity with atomic decay is found. Effects of the atomic spontaneous decay on the temporal evolution of partial entropies of the atom or the field and the total entropy as a quantitative measure entanglement are elucidated. The degree of entanglement, through the sum of the negative eigenvalues of the partially transposed density matrix and the negative mutual information has been studied and compared with other measures.
Wang, Jun-Ming; Pei, Li-Xin; Zhang, Yue-Yue; Cheng, Yong-Xian; Niu, Chun-Ling; Cui, Ying; Feng, Wei-Sheng; Wang, Gui-Fang
2018-06-01
The dried roots of Rehmannia glutinosa Libosch. (Scrophulariaceae) are of both medicinal and nutritional importance. Our previous study has found that the 80% ethanol extract of R. glutinosa (RGEE) produced antidepressant-like activities in mouse behavioral despair depression models. However, its mechanisms are still unclear. The present study aimed to observe the antidepressant-like mechanisms of RGEE on a rat chronic unpredictable mild stress (CUMS) model by involving monoaminergic neurotransmitters and brain-derived neurotrophic factor (BDNF). CUMS-stressed rats were orally given RGEE daily (150, 300, and 600 mg/kg) or fluoxetine hydrochloride (FH) for 3 weeks after starting the CUMS procedure. Sucrose preference test was carried out to observe depression-like behavior, and serum and brain tissues were used for neurochemical and fluorescent quantitative reverse transcription PCR analysis. Results demonstrated that CUMS induced depression-like behavior, whereas RGEE and FH administration inhibited this symptom. Furthermore, CUMS caused excessively elevated levels of serum corticosterone (CORT), an index of hypothalamic-pituitary-adrenal (HPA) axis hyperactivity, in a manner attenuated by RGEE and FH administration. RGEE administration also further elevated monoamine neurotransmitters and BDNF levels, up-regulated the mRNA expression of BDNF and tropomyosin-related kinase B (TrkB) in hippocampus of rats suffering CUMS. Together, our findings suggest that RGEE can improve CUMS-evoked depression-like behavior, and indicate its mechanisms may partially be associated with restoring HPA axis dysfunctions, enhancing monoamineergic nervous systems, and up-regulating BDNF and TrkB expression.
Qiao, Hui; An, Shu-Cheng; Xu, Chang; Ma, Xin-Ming
2017-05-15
Major depressive disorder (MDD) is one of the most common psychiatric disorder, but the underlying mechanisms are largely unknown. Increasing evidence shows that brain-derived neurotrophic factor (BDNF) plays an important role in the structural plasticity induced by depression. Considering the opposite effects of BDNF and its precursor proBDNF on neural plasticity, we hypothesized that the balance of BDNF and proBDNF plays a critical role in chronic unpredicted mild stress (CUMS)-induced depressive-like behaviors and structural plasticity in the rodent hippocampus. The aims of this study were to compare the functions of BDNF and proBDNF in the CUMS-induced depressive-like behaviors, and determine the effects of BDNF and proBDNF on expressions of kalirin-7, postsynaptic density protein 95 (PSD95) and NMDA receptor subunit NR2B in the hippocampus of stressed and naïve control rats, respectively. Our results showed that CUMS induced depressive-like behaviors, caused a decrease in the ratio of BDNF/proBDNF in the hippocampus and resulted in a reduction in spine density in hippocampal CA1 pyramidal neurons; these alterations were accompanied by a decrease in the levels of kalirin-7, PSD95 and NR2B in the hippocampus. Injection of exogenous BDNF into the CA1 area of stressed rats reversed CUMS-induced depressive-like behaviors and prevented CUMS-induced spine loss and decrease in kalirin-7, NR2B and PSD95 levels. In contrast, injection of exogenous proBDNF into the CA1 region of naïve rats caused depressive-like behavior and an accompanying decrease in both spine density and the levels of kalirin-7, NR2B and PSD95. Taken together, our results suggest that the ratio of BDNF to proBDNF in the hippocampus plays a key role in CUMS-induced depressive-like behaviors and alterations of dendritic spines in hippocampal CA1 pyramidal neurons. Kalirin-7 may play an important role during this process. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Verlan, E.M.
2003-01-01
A two-level atom interacting with a field mode is considered. The field frequency is assumed to be equal to the atom transition frequency. The relaxation equations of the atom - field system are written in the basis of dressed states of the Jaynes - Cummings model taking into account quasi-resonant pumping. Their solutions are derived for a stationary regime. The average amplitude of a coherent electromagnetic field is found
Competitive-cum-cooperative interfirm relations and dynamics in the Japanese semiconductor industry
Okada, Yoshitaka
2000-01-01
Japanese semiconductor firms are well known for obtaining dynamics in a short period of time and achieving even global leadership. A significant portion of their success are attributable to cooperative interfirm relations and the development of intermediate organizational structure based on long-term relationship between firms. The purpose of this book is to explain how interfirm relations contributed to their dynamics during the golden age of the semiconductor industry. Meanwhile this book clarifies the real source of dynamics in interfirm relations and how the firms have interacted. The author concludes that the competitive-cum-cooperative (CCC) interfirm interaction are observed. Quantitative and qualitative findings show that firms enjoy not only flexible cooperation based synergy effects, but also dynamics market-like effects by creating competition among partners through CCC interaction.
Luo, Min; Song, Zhi-Qin; Yang, Ping-Fei; Liu, Hai; Yang, Zai-Gang; Wu, Ming-Kai
2017-01-01
Using four Uncariae Cum Uncis materials including Uncaria sinensis (HGT), U. hirsutea (MGT), Jianhe U. rhynchophylla (JHGT) and U. rhynchophylla(GT) as the research objects, the correlations between medicinal materials' yield and photosynthetic ecophysiology-factors in the plant exuberant growth period were studied. Results showed that the Uncaria plants net photosynthetic rate (Pn) changed by unimodal curve. There was not "midday depression" phenomenon. There was a different relationship among the photosynthetic ecophysiology-factors and between photosynthetic ecophysiology-factors and medicinal materials' yield. Pn,Tl,Gs had a significant correlation with medicinal materials' yield(M)and were the most important factors of growth. Copyright© by the Chinese Pharmaceutical Association.
Antidepressant-Like Effects of Cordycepin in a Mice Model of Chronic Unpredictable Mild Stress
Directory of Open Access Journals (Sweden)
Zhang Tianzhu
2014-01-01
Full Text Available Cordycepin (3′-deoxyadenosine, a major bioactive component isolated from Cordyceps militaris, has multiple pharmacological activities. This study is attempted to investigate whether cordycepin (COR possesses beneficial effects on chronic unpredictable mild stress- (CUMS- induced behavioral deficits (depression-like behaviors and explore the possible mechanisms. ICR mice were subjected to chronic unpredictable mild stress for 42 consecutive days. Then, COR and fluoxetine (FLU, positive control drug were administered for 21 consecutive days at the last three weeks of CUMS procedure. The classical behavioral tests, open field test (OFT, sucrose preference test (SPT, tail suspension test (TST, and forced swimming test (FST, were applied to evaluate the antidepressant effects of COR. Then the serotonin (5-HT and noradrenaline (NE concentrations in hippocampal were evaluated by HPLC; tumor necrosis factor-α (TNF-α and interleukin-6 (IL-6 in hippocampal were evaluated, and the proteins of TNF-α, IL-6, NF-κBP65 5-HT receptor (5-HTR, and brain-derived neurotrophic factor (BDNF in hippocampal were evaluated by Western blot. Our results indicated that 6 weeks of CUMS exposure induced significant depression-like behavior, with low 5-HT and NE levels, high TNF-α and IL-6 in brain and high hippocampal TNF-α, IL-6, P-NF-κBP65, and 5-HTR levels, and low BDNF expression levels. Whereas, chronic COR (20, 40 mg/kg treatments reversed the behavioral deficiency induced by CUMS exposure, treatment with COR normalized the change of TNF-α, IL-6, 5-HT, and NE levels, which demonstrated that COR could partially restore CUMS-induced 5-HT receptor impairments and inflammation. Besides, hippocampal BDNF expressions were also upregulated after COR treatments. In conclusion, COR remarkably improved depression-like behavior in CUMS mice and its antidepressant activity is mediated, at least in part, by the upregulating BDNF and downregulating 5-HTR levels and
Vacuum Rabi Splitting and Dynamics of the Jaynes—Cummings Model for Arbitrary Coupling
International Nuclear Information System (INIS)
Zhang Yu-Yu; Chen Qing-Hu; Zhu Shi-Yao
2013-01-01
The effects of counter-rotating terms (CRTs) on Rabi splitting and the dynamic evolution of atomic population in the Jaynes—Cummings model are studied with a coherent-state approach. When the coupling strength increases, the Rabi splitting becomes of multi-Rabi frequencies for the initial state of an excited atom in a vacuum field, and the collapses and revivals gradually disappear, and then reappear with quite good periodicity. Without the rotating-wave approximation (RWA), the initial excited state contains many eigenstates rather than two eigenstates under the RWA, which results in the multi-peak emission spectrum. An analytical approximate solution for the strong coupling regime is obtained, which gives a new oscillation frequency and explains the recovery of collapses and revivals due to the equal energy spacing
Hu, Hua; Zhang, Yingchun; Xu, Yeqing; Liu, Chunfeng; Wang, Liwei
2015-06-16
To investigate behavioral changes in a rat hyperlipidemia model induced by high lipid feed combined with depression by Chronic Unpredictable Mild Stress (CUMS). A total of 40 rats were randomly divided into control (CON), control feed for 9 weeks followed by CUMS for 4 weeks (CON + CUMS), high fat diet (HFD) and high lipid feed for 9 weeks followed by CUMS for 4 weeks (HFD + CUMS) (n = 10 each). Open-field test was individually measured at baseline, week 9 and week 13. (1) Serum lipids: total cholesterol [(2.67 ± 0.04) mmol/L, (2.68 ± 0.02) mmol/L] and low density lipoprotein [(1.08 ± 0.03) mmol/L, (1.06 ± 0.01) mmol/L] of HFD and HFD + CUMS were both significantly higher than those of CON and CON + CUMS [(1.78 ± 0.12) mmol/L, (0.79 ± 0.04) mmol/L; (1.76 ± 0.09) mmol/L, (0.76 ± 0.06) mmol/L, all P Open-field test: at week 13, compared to CON rats, CON + CUMS rats exhibited enhanced locomotor activity during the first minute, reduced activity in the center squares and rearing, and increased the number of grooming and defecation (all P < 0.05). In comparison to the CON rats, a decrease in total squares in 5 min, central squares and peripheral squares was observed in HFD rats at week 13 (all P < 0.05). However, compared with HFD, CON, CON + CUMS rats, when high lipid feed for 9 weeks combined with depression, significant decrease activities in total squares in 5 min, central squares and peripheral squares were observed in HFD + CUMS rats at week 13. Besides these, the number of rearing was reduced, however, locomotor activity during the first minute and the number of grooming and defecation was significantly increased (all P < 0.001). Under uncontrolled hyperlipidemia, severe depressive symptoms will present more early once exposure to a series of chronic stressors followed by significant autonomic nervous dysfunctional symptoms.
Stress-induced endocrine response and anxiety: the effects of comfort food in rats.
Ortolani, Daniela; Garcia, Márcia Carvalho; Melo-Thomas, Liana; Spadari-Bratfisch, Regina Celia
2014-05-01
The long-term effects of comfort food in an anxiogenic model of stress have yet to be analyzed. Here, we evaluated behavioral, endocrine and metabolic parameters in rats submitted or not to chronic unpredictable mild stress (CUMS), with access to commercial chow alone or to commercial chow and comfort food. Stress did not alter the preference for comfort food but decreased food intake. In the elevated plus-maze (EPM) test, stressed rats were less likely to enter/remain in the open arms, as well as being more likely to enter/remain in the closed arms, than were control rats, both conditions being more pronounced in the rats given access to comfort food. In the open field test, stress decreased the time spent in the centre, independent of diet; neither stress nor diet affected the number of crossing, rearing or grooming episodes. The stress-induced increase in serum corticosterone was attenuated in rats given access to comfort food. Serum concentration of triglycerides were unaffected by stress or diet, although access to comfort food increased total cholesterol and glucose. It is concluded that CUMS has an anorexigenic effect. Chronic stress and comfort food ingestion induced an anxiogenic profile although comfort food attenuated the endocrine stress response. The present data indicate that the combination of stress and access to comfort food, common aspects of modern life, may constitute a link among stress, feeding behavior and anxiety.
Wang, Jun-Ming; Yang, Lian-He; Zhang, Yue-Yue; Niu, Chun-Ling; Cui, Ying; Feng, Wei-Sheng; Wang, Gui-Fang
2015-11-01
Catalpol, a major compound in Rehmannia glutinosa with both medicinal and nutritional values, has been previously confirmed to shorten the duration of immobility in mice exposed to tail suspension and forced swimming tests. This study attempted to examine the anti-depressive mechanisms of catalpol in rats undergoing chronic unpredictable mild stress (CUMS) by involving brain-derived neurotrophic factor (BDNF) and cyclooxygenase-2 (COX-2). CUMS-exposed rats were given catalpol daily (5, 10, and 20mg/kg, ig) or a reference drug, fluoxetine hydrochloride (FH, 10mg/kg, ig), at 5 weeks after starting the CUMS procedure. Sucrose preference test was performed to observe depression-like behavior, and serum and brain tissues were used for neurochemical and fluorescent quantitative reverse transcription PCR analysis. CUMS induced depression-like behavior, whereas catalpol and FH administration attenuated this symptom. Moreover, CUMS caused excessively elevated levels of serum corticosterone, an index of hypothalamic-pituitary-adrenal (HPA) axis hyperactivation, in a manner attenuated by catalpol and FH administration. Catalpol administration also further decreased BDNF activities, downregulated the mRNA expression of BDNF and tropomyosin-related kinase B (TrkB), and reversed the excessive elevation in the activities and mRNA expression levels of COX-2 and prostaglandin E2 (PGE2) in the hippocampus and frontal cortex of rats undergoing CUMS. Results indicate that catalpol can ameliorate CUMS-induced depression-like behavior, and suggest its mechanisms may partially be ascribed to restoring HPA axis dysfunctions, upregulating BDNF expression and its cognate receptor TrkB, and downregulating COX-2 expression, thereby reducing PGE2 levels in the brain. Copyright © 2015 Elsevier Inc. All rights reserved.
Dynamics of the Jaynes-Cummings and Rabi models: old wine in new bottles
Energy Technology Data Exchange (ETDEWEB)
Larson, Jonas [ICFO-Institut de Ciencies Fotoniques, E-08860 Castelldefels, Barcelona (Spain)
2007-08-15
By using a wavepacket approach, this paper reviews the Jaynes-Cummings model with and without the rotating wave approximation (RWA) in a non-standard way. This gives new insight, not only of the two models themselves, but of the RWA as well. Expressing the models by field quadrature operators, instead of the typically used boson ladder operators, wavepacket simulations are presented. Several known phenomena of these systems, such as collapse-revivals, Rabi oscillation, squeezing and entanglement, are reviewed and explained in this new picture, either in an adiabatic or diabatic frame. The harmonic shape of the potential curves that the wavepackets evolve on and the existence of a level crossing make these results interesting in a broader sense not only for models in quantum optics, but especially in atomic and molecular physics.
Institute of Scientific and Technical Information of China (English)
李春先; 方卯发
2003-01-01
We study the squeezing for a two-level atom in the Jaynes-Cummings model with intensity-dependent coupling using quantum information entropy, and examine the influences of the initial state of the system on the squeezed component number and direction of the information entropy squeezing. Our results show that, the squeezed component number depends on the atomic initial distribution angle, while the squeezed direction is determined by both the phases of the atom and the field for the information entropy squeezing. Quantum information entropy is shown to be a remarkable precision measure for atomic squeezing.
Directory of Open Access Journals (Sweden)
Bing HAN
2015-08-01
Full Text Available Objective To observe the effect of chronic unpredictable mild stress (CUMS on the cognitive function and brain morphological changes in APP/PS-1 mice, one of the genetic mouse models of Alzheimer's disease (AD, and to investigate the possible role of environmental factors in genetic mouse model of AD. Methods There were 22-week-old wild-type C57BL/6 male mice (control group, N = 15 and APP/PS-1 double transgenic male mice [N = 27: AD group (N = 13 and AD + CUMS group (N = 14] tested in this study. Morris water maze test was used to evaluate spatial learning and memory of the mice. Amyloid deposition in the hippocampus was determined by Congo red staining. The ultrastructure of neurons in hippocampal CA1 region was observed by transmission electron microscope (TEM. Results Compared with control group, AD + CUMS group had significantly longer fifth-day escape latency [(33.14 ± 14.37 s vs (21.22 ± 12.16 s; t = -2.701, P = 0.045], and significantly shortened time spent in platform quadrant [(9.74±1.35 s vs (15.02 ± 1.33 s; t = 2.639, P = 0.012] in Morris water maze test. Compared with AD group, the percentage of amyloid plaque area in hippocampal area was increased in AD + CUMS group [(0.59 ± 0.03% vs (0.04 ± 0.03%; t = -2.900, P = 0.005]. The ultrastructure of hippocampal neurons in AD group was slightly damaged: cellular membrane was intact; cell matrix was uniform; intracelluar lipofuscin could be seen; the structure of nucleus and nuclear membrane had no obvious changes; mild fusion of cristae and membrane was seen in mitochondria; Golgi apparatus was partially indistinct; endoplasmic reticulum was mildly expanded. The ultrastructure of hippocampal neurons in AD + CUMS group was obviously damaged, including blurred cell membrane, reduced low-density and high-density granules in cytoplasm, uneven cell matrix, reduced number of organelles, lipofuscin and autophagosome deposition, obvious condensation of chromatin distributing over
Directory of Open Access Journals (Sweden)
Hong-Mei Jia
Full Text Available Depression is a type of complex psychiatric disorder with long-term, recurrent bouts, and its etiology remains largely unknown. Here, an integrated approach utilizing (1H NMR and UPLC-Q-TOF/MS together was firstly used for a comprehensive urinary metabonomics study on chronic unpredictable mild stress (CUMS treated rats. More than twenty-nine metabolic pathways were disturbed after CUMS treatment and thirty-six potential biomarkers were identified by using two complementary analytical technologies. Among the identified biomarkers, nineteen (10, 11, 16, 17, 21-25, and 27-36 were firstly reported as potential biomarkers of CUMS-induced depression. Obviously, this paper presented a comprehensive map of the metabolic pathways perturbed by CUMS and expanded on the multitude of potential biomarkers that have been previously reported in the CUMS model. Four metabolic pathways, including valine, leucine and isoleucine biosynthesis; phenylalanine, tyrosine and tryptophan biosynthesis; tryptophan metabolism; synthesis and degradation of ketone bodies had the deepest influence in the pathophysiologic process of depression. Fifteen potential biomarkers (1-2, 4-6, 15, 18, 20-23, 27, 32, 35-36 involved in the above four metabolic pathways might become the screening criteria in clinical diagnosis and predict the development of depression. Moreover, the results of Western blot analysis of aromatic L-amino acid decarboxylase (DDC and indoleamine 2, 3-dioxygenase (IDO in the hippocampus of CUMS-treated rats indicated that depletion of 5-HT and tryptophan, production of 5-MT and altered expression of DDC and IDO together played a key role in the initiation and progression of depression. In addition, none of the potential biomarkers were detected by NMR and LC-MS simultaneously which indicated the complementary of the two kinds of detection technologies. Therefore, the integration of (1H NMR and UPLC-Q-TOF/MS in metabonomics study provided an approach to identify
International Nuclear Information System (INIS)
Hasan, S.S.; Kushwaha, A.K.S.
1987-01-01
Effect of X rays was studied on normally fed and starved rats vis-a-vis neomercazole, a sulfur containing carbimazone as a chemical radioprotector. Levels of 5-hydroxyindoleacetic acid and vinylmandelic acid which were found rising following exposure to X-rays, were significantly curtailed by the treatment with radioprotector in the protected-cum-irradiated rats. Administration of neomercazole offered protection to the testes against radiation injury by increasing alkaline phophatase and cholesterol contents in the testes of drug-treated-cum-irradiated animals. Pretreatment of neomercazole reduced the rate of mortality in the starvation-cum-irradiated animals as compared to the nontreated starvation-cum-irradiated animals. (author)
Choon, S E; Sapiah, W; Ismail, Z; Balan, V
1997-12-01
A study was conducted in the Dermatology cum Genitourinary Clinic, Hospital Sultanah Aminah Johor Bahru to determine a local population's knowledge of HIV and their sexual behaviour in relation to it. A total of 231 men and 217 women were interviewed. The sexual culture seen is one of relatively late age of first sexual intercourse, low level of partner change and low level of condom use. Men reported a higher involvement in risk behaviour. Nearly all the respondents (95.8%) have heard of HIV/AIDS but had incorrect perceptions of its mode of transmission and its associations with risk groups. This study enable us to gain background information about our patients sexual behaviour and HIV knowledge. There is a need to continue HIV education to improve our public's HIV knowledge and the results of this study provides a baseline against which future educational interventions can be gauged.
Ji, Wei-Wei; Li, Rui-Peng; Li, Meng; Wang, Shu-Yuan; Zhang, Xian; Niu, Xing-Xing; Li, Wei; Yan, Lu; Wang, Yang; Fu, Qiang; Ma, Shi-Ping
2014-10-01
Perilla frutescens (Perilla leaf), a garnishing vegetable in East Asian countries, as well as a plant-based medicine, has been used for centuries to treat various conditions, including depression. Several studies have demonstrated that the essential oil of P. frutescens (EOPF) attenuated the depressive-like behavior in mice. The present study was designed to test the anti-depressant effects of EOPF and the possible mechanisms in an chronic, unpredictable, mild stress (CUMS)-induced mouse model. With the exposure to stressor once daily for five consecutive weeks, EOPF (3, 6, and 9 mg·kg(-1)) and a positive control drug fluoxetine (20 mg·kg(-1)) were administered through gastric intubation to mice once daily for three consecutive weeks from the 3(rd) week. Open-field test, sucrose consumption test, tail suspension test (TST), and forced swimming test (FST) were used to evaluate the behavioral activity. The contents of 5-hydroxytryptamine (5-HT) and its metabolite, 5-hydroxyindoleacetic acid (5-HIAA), in mouse hippocampus were determined by HPLC-ECD. Serum interleukin (IL)-1, IL-6, and tumor necrosis factor (TNF)-α levels were evaluated by enzyme-linked immunosorbent assay (ELISA). The results showed that CUMS significantly decreased the levels of 5-HT and 5-HIAA in the hippocampus, with an increase in plasma IL-6, IL-1β, and TNF-α levels. CUMS also reduced open-field activity, sucrose consumption, as well as increased immobility duration in FST and TST. EOPF administration could effectively reverse the alterations in the concentrations of 5-HT and 5-HIAA; reduce the IL-6, IL-1β, and TNF-α levels. Moreover, EOPF could effectively reverse alterations in immobility duration, sucrose consumption, and open-field activity. However, the effect was not dose-dependent. In conclusion, EOPF administration exhibited significant antidepressant-like effects in mice with CUMS-induced depression. The antidepressant activity of EOPF might be related to the relation between
Entanglement generation and entropy growth due to intrinsic decoherence in the Jaynes-Cummings model
International Nuclear Information System (INIS)
Obada, A.-S.F.; Hessian, Hosny A.
2004-01-01
We study how intrinsic decoherence leads to growing entropy and a strong degradation of the maximal generated entanglement in the multiquanta Jaynes-Cummings model. We find an exact solution of the Milburn equation in multiquanta precesses and calculate the partial entropy of the particle (atom or trapped ion) and field subsystem as well as total entropy. As the total entropy is not conserved, and it is shown to increase as time develops, one cannot use the partial field or atomic entropy as a direct measure of particle-field entanglement. For a good entropy measure, we also calculate the negativity of the eigenvalues of the partially transposed density matrix. We find that, at least qualitatively, the difference of the total entropy to the sum of field and atom partial entropies can be also used as an entanglement measure. Our results show that the degree of entanglement is very sensitive to any change in the intrinsic decoherence parameter
Liu, Chungang; Wang, Juan; Xu, Shiqi; An, Shengshu; Tang, Siying; He, Jian; Liu, Yang; Lee, Robert J; Wang, Di
2017-08-01
The medicinal fungus Paecilomyces tenuipes exhibits a variety of pharmacological effects, including antidepressive effects. The chronic unpredictable mild stress (CUMS)‑induced rat model has served an important role in studies involving antidepressants screening. The aim of the present study was to evaluate the antidepressant‑like activity of P. tenuipes N45 aqueous extract (PTNE) in a CUMS‑induced rat model of behavioral despair depression. Following 4 weeks of PTNE treatment, behavioral tests were conducted to investigate the antidepressant‑like activities, and the levels of neurotransmitters and hormones in blood and hypothalamus were measured. The results demonstrated that PTNE treatment significantly increased movement in the forced running test, whereas the immobility time was reduced in the hotplate test and the forced swim test in depression‑model rats. PTNE treatment was able to normalize the levels of hormones and neurotransmitters in serum and hypothalamus of CUMS rats. The data demonstrated that PTNE treatment may be a potential pharmaceutical agent in treatment‑resistant depression, and the effects of PTNE may be partly mediated through normalizing the levels of neurotransmitters.
Rayyan, S; Fossen, T; Solheim Nateland, H; Andersen, O M
2005-01-01
Twelve flavonoids, including seven flavones, four flavonols and one flavanone, were isolated from methanolic extract of the herbal drug 'Crataegi folium cum flore' (hawthorn leaves and flowers) by a combination of CC (over Amberlite XAD-7 and Sephadex LH-20) and preparative HPLC. Their structures, including that of the novel flavonol 8-methoxykaempferol 3-O-(6"-malonyl-beta-glucopyranoside), were elucidated by homo- and heteronuclear NMR and electrospray/MS. The 1H- and 13C-NMR of all compounds, including rotameric pairs of five flavone C-glycosides, were assigned. The presence and relative proportion of each rotamer was shown by various NMR experiments, including two-dimensional nuclear Overhauser and exchange spectroscopy, to depend on solvent, linkage position and structure of the C-glycosyl substituent.
Properties of Linear Entropy in k-Photon Jaynes-Cummings Model with Stark Shift and Kerr-Like Medium
International Nuclear Information System (INIS)
Liao Qinghong; Wang Yueyuan; Liu Shutian; Ahmad, Muhammad Ashfaq
2010-01-01
The time evolution of the linear entropy of an atom in k-photon Jaynes-Cummings model is investigated taking into consideration Stark shift and Kerr-like medium. The effect of both the Stark shift and Kerr-like medium on the linear entropy is analyzed using a numerical technique for the field initially in coherent state and in even coherent state. The results show that the presence of the Kerr-like medium and Stark shift has an important effect on the properties of the entropy and entanglement. It is also shown that the setting of the initial state plays a significant role in the evolution of the linear entropy and entanglement. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Abuelezz, Sally A; Hendawy, Nevien; Magdy, Yosra
2017-06-01
Depression is a major health problem in which oxidative stress and inflammation are inextricably connected in its pathophysiology. Coenzyme Q10 (CoQ10) is an important anti-oxidant compound with anti-inflammatory and neuro-protective properties. This study was designed to investigate the hypothesis that CoQ10 by its anti-oxidant and anti-inflammatory potentials can alleviate depressive- like behavior by restoring the balance of the tryptophan catabolites kynurenine/serotonin toward the serotonin pathway by down-regulation of hippocampal indoleamine 2,3-dioxygenase 1 (IDO-1). Depressive-like behavior was induced by chronic unpredictable mild stress (CUMS) protocol including food or water deprivation, cage tilting, reversed light cycle etc. Male Wistar rats were randomly divided into five groups; Control, CUMS, CUMS and CoQ10 (50,100 and 200 mg/kg/day i.p. respectively) groups. CoQ10 effects on different behavioral and biochemical tests were analyzed. CoQ10 showed significant antidepressant efficacy, as evidenced by significantly decreased stress induced changes to forced swimming challenge and open field test, as well as attenuating raised corticosterone level and adrenal glands weight. The anti-oxidant effect of CoQ10 was exhibited by its ability to significantly reduce hippocampal elevated malondialdehyde and 4-hydroxynonenal levels and elevate the reduced glutathione and catalase levels. CoQ10 significantly reduced different pro-inflammatory cytokines levels including interleukin (IL)-1β, IL-2, IL-6 and tumor necrosis factor-α. It suppressed hippocampal IDO-1 and subsequent production of kynurenine and enhanced the hippocampal contents of tryptophan and serotonin. Immunohistochemical analysis revealed that CoQ10 was able to attenuate the elevated microglial CD68 and elevate the astrocyte glial fibrillary acidic protein compared to CUMS group. CoQ10 exhibited antidepressant-like effects on rats exposed to CUMS. This could be attributed to its ability to reduce
Directory of Open Access Journals (Sweden)
Mohamed Saleem Abdul Shukkoor
2016-01-01
Full Text Available This study evaluated the antidepressant-like effect of lipid extract of C. striatus in chronic unpredictable mild stress (CUMS model of depression in male rats and its mechanism of action. The animals were subjected to CUMS for six weeks by using variety of stressors. At the end of CUMS protocol, animals were subjected to forced swimming test (FST and open field test followed by biochemical assay. The CUMS protocol produced depressive-like behavior in rats by decreasing the body weight, decreasing the sucrose preference, and increasing the duration of immobility in FST. The CUMS protocol increased plasma corticosterone and decreased hippocampal and prefrontal cortex levels of monoamines (serotonin, noradrenaline, and dopamine and brain-derived neurotrophic factor. Further, the CUMS protocol increased interleukin-6 (in hippocampus and prefrontal cortex and nuclear factor-kappa B (in prefrontal cortex but not in hippocampus. The lipid extract of C. striatus (125, 250, and 500 mg/kg significantly (p<0.05 reversed all the above parameters in rats subjected to CUMS, thus exhibiting antidepressant-like effect. The mechanism was found to be mediated through decrease in plasma corticosterone, increase in serotonin levels in prefrontal cortex, increase in dopamine and noradrenaline levels in hippocampus and prefrontal cortex, increase in BDNF in hippocampus and prefrontal cortex, and decrease in IL-6 and NF-κB in prefrontal cortex.
Shang, Xueliang; Shang, Yingchun; Fu, Jingxuan; Zhang, Tao
2017-08-01
The aim of this study was to examine if nicotine was able to improve cognition deficits in a mouse model of chronic mild stress. Twenty-four male C57BL/6 mice were divided into three groups: control, stress, and stress with nicotine treatment. The animal model was established by combining chronic unpredictable mild stress (CUMS) and isolated feeding. Mice were exposed to CUMS continued for 28 days, while nicotine (0.2 mg/kg) was also administrated for 28 days. Weight and sucrose consumption were measured during model establishing period. The anxiety and behavioral despair were analyzed using the forced swim test (FST) and open-field test (OFT). Spatial cognition was evaluated using Morris water maze (MWM) test. Following behavioral assessment, both long-term potentiation (LTP) and depotentiation (DEP) were recorded in the hippocampal dentate gyrus (DG) region. Both synaptic and Notch1 proteins were measured by Western. Nicotine increased stressed mouse's sucrose consumption. The MWM test showed that spatial learning and reversal learning in stressed animals were remarkably affected relative to controls, whereas nicotine partially rescued cognitive functions. Additionally, nicotine considerably alleviated the level of anxiety and the degree of behavioral despair in stressed mice. It effectively mitigated the depression-induced impairment of hippocampal synaptic plasticity, in which both the LTP and DEP were significantly inhibited in stressed mice. Moreover, nicotine enhanced the expression of synaptic and Notch1 proteins in stressed animals. The results suggest that nicotine ameliorates the depression-like symptoms and improves the hippocampal synaptic plasticity closely associated with activating transmembrane ion channel receptors and Notch signaling components. Graphical Abstract ᅟ.
International Nuclear Information System (INIS)
1993-01-01
The Workshop cum Symposium on Application of Neural Networks in Nuclear Science and Industry was held at Bombay during November 24-26. 1993. The past decade has seen many important advances in the design and technology of artificial neural networks in research and industry. Neural networks is an interdisciplinary field covering a broad spectrum of applications in surveillance, diagnosis of nuclear power plants, nuclear spectroscopy, speech and written text recognition, robotic control, signal processing etc. The objective of the symposium was to promote awareness of advances in neural network research and applications. It was also aimed at conducting the review of the present status and giving direction for future technological developments. Contributed papers have been organized into the following groups: a) neural network architectures, learning algorithms and modelling, b) computer vision and image processing, c) signal processing, d) neural networks and fuzzy systems, e) nuclear applications and f) neural networks and allied applications. Papers relevant to INIS are indexed separately. (M.K.V.)
Wang, Bo; Lian, Yong-Jie; Su, Wen-Jun; Peng, Wei; Dong, Xin; Liu, Lin-Lin; Gong, Hong; Zhang, Ting; Jiang, Chun-Lei; Wang, Yun-Xia
2017-11-28
Our previous study has reported that the proactive secretion and role of central high mobility group box 1 (HMGB1) in lipopolysaccharide-induced depressive behavior. Here, the potential mechanism of HMGB1 mediating chronic-stress-induced depression through the kynurenine pathway (KP) was further explored both in vivo and in vitro. Depression model was established with the 4-week chronic unpredictable mild stress (CUMS). Sucrose preference and Barnes maze test were performed to reflect depressive behaviors. The ratio of kynurenine (KYN)/tryptophan (Trp) represented the enzyme activity of indoleamine-2,3-dioxygenase (IDO). Gene transcription and protein expression were assayed by real-time RT-PCR and western-blot or ELISA kit respectively. Along with depressive behaviors, HMGB1 concentrations in the hippocampus and serum substantially increased post 4-week CUMS exposure. Concurrent with the upregulated HMGB1 protein, the regulator of translocation of HMGB1, sirtuin 1 (SIRT1) concentration in the hippocampus remarkably increased. In addition to HMGB1 and SIRT1, IDO, the rate limiting enzyme of KP, was upregulated at the level of mRNA expression and enzyme activity in stressed hippocampi and LPS/HMGB1-treated hippocampal slices. The gene transcription of kynurenine monooxygenase (KMO) and kynureninase (KYNU) in the downstream of KP also increased both in vivo and in vitro. Mice treated with ethyl pyruvate (EP), the inhibitor of HMGB1 releasing, were observed with lower tendency of developing depressive behaviors and reduced activation of enzymes in KP. All of these experiments demonstrate that the role of HMGB1 on the induction of depressive behavior is mediated by KP activation. Copyright © 2017 Elsevier Inc. All rights reserved.
Extension of the excitation functions of deuteron induced reactions on {sup nat}Sn up to 50 MeV
Energy Technology Data Exchange (ETDEWEB)
Hermanne, A., E-mail: aherman@vub.ac.be [Cyclotron Laboratory, Vrije Universiteit Brussel, B1050 Brussels (Belgium); Tárkányi, F.; Ditrói, F.; Takács, S. [Institute of Nuclear Research of the Hungarian Academy of Sciences, H4026 Debrecen (Hungary)
2017-01-15
Using the stacked-foil activation technique, cross-sections of deuteron induced reactions on natural Sn targets were determined up to 50 MeV. Excitation functions are reported for the product nuclides {sup 116m}Sb, {sup 117}Sb, {sup 118m}Sb, {sup 120m}Sb {sup 122m+g}Sb, {sup 124m+g}Sb, {sup 110}Sn(cum), {sup 113m+g}Sn(cum), {sup 117m}Sn, {sup 110m}In(cum), {sup 110g}In, {sup 111m+g}In(cum), {sup 113m}In, {sup 114m}In {sup 115m}In. Comparison with earlier published data at lower energy is discussed. For all excitation functions a theoretical calculation using the TALYS 1.6 (on-line TENDL-2015 library) code is shown.
A novel magnetic suspension cum linear actuator system for satellite cryo coolers
International Nuclear Information System (INIS)
Sivadasan, K.K.
1994-01-01
Stirling cycle cryogenic coolers have been widely used for device cooling in satellites. Various types of magnetic bearings and linear actuators find application in such systems. The most widely used configurations have two-axis-radially-active suspension stations placed at either ends of a reciprocating shaft in the compression and expansion sections. Separate or integral liner motors are provided in each section for axial shaft movement. It may be noted that such configurations are rather complicated and less reliable because of the presence of numerous electro-mechanical components, sensors and electronic servo channels. In this paper, a simple and reliable scheme is suggested which axially stabilizes and linearly perturbs the piston so that the need for a separate motor for axial actuation can be totally dispensed with. The piston is radially supported by passive repulsive bearings. In the axial direction, a servo actuator ''balances'' the piston and also actuates it bi-directionally. Implemented of this ''bearing cum motor theme,'' reduces the number of electromechanical and electronic components required to operate the system and hence minimizes the chances of system failure. Apart from this, the system's power consumption is reduced and efficiency is improved as electrical heating losses caused by quiescent-operating currents are removed and electromagnetic losses on the moving parts are minimized. The necessary system parameters have been derived using finite element analysis techniques. Finally, the proposed design is validated by computer-aided system simulation
International Nuclear Information System (INIS)
Gruver, J.L.; Aliaga, J.; Cerdeira, H.A.; Proto, A.N.
1995-03-01
The dynamics and thermodynamics of a quantum time-dependent field coupled to a two-level system, well known as the Jaynes-Cummings Hamiltonian, is studied, using the maximum entropy principle. In the framework of this approach we found three different infinite sets of relevant operators that describe the dynamics of the system for any temporal dependence. These sets of relevant operators are connected by isomorphisms, which allow us to consider the case of mixed initial conditions. A consistent set of initial conditions is established using the maximum entropy principle density operator, obtaining restrictions to the physically feasible initial conditions of the system. The behaviour of the population inversion is shown for different time dependencies of the Hamiltonian and initial conditions. For the time-independent case, an explicit solution for the population inversion in terms of the relevant operators of one of the sets is given. It is also shown how the well-known formulas for the population inversion are recovered for the special cases where the initial conditions correspond to a pure, coherent, and thermal field. (author). 35 refs, 9 figs
Directory of Open Access Journals (Sweden)
Bing Han
2017-03-01
Full Text Available Background/Aims: Stress response is determined by the brain, and the brain is a sensitive target for stress. Our previous experiments have confirmed that once the stress response is beyond the tolerable limit of the brain, particularly that of the hippocampus, it will have deleterious effects on hippocampal structure and function; however, the metabolic mechanisms for this are not well understood. Methods: Here, we used morris water maze, elisa and gas chromatography-time of flight/mass spectrometry to observe the changes in cognition, neuropathology and metabolomics in the hippocampus of APP/PS1 mice and wild-type (C57 mice caused by chronic unpredictable mild stress (CUMS, we also further explored the correlation between cognition and metabolomics. Results: We found that 4 weeks of CUMS aggravated cognitive impairment and increased amyloid-β deposition in APP/PS1 mice, but did not affect C57 mice. Under non-stress conditions, compared with C57 mice, there were 8 different metabolites in APP/PS1 mice. However, following CUMS, 3 different metabolites were changed compared with untreated C57 mice. Compared to APP/PS1 mice, there were 7 different metabolites in APP/PS1+CUMS mice. Among these alterations, 3-hydroxybutyric acid, valine, serine, beta-alanine and o-phosphorylethanolamine, which are involved in sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism. Conclusion: The results indicate that APP/PS1 mice are more vulnerable to stress than C57 mice, and the metabolic mechanisms of stress-related cognitive impairment in APP/PS1 mice are related to multiple pathways and networks, including sphingolipid metabolism, synthesis and degradation of ketone bodies, and amino acid metabolism.
Institute of Scientific and Technical Information of China (English)
王盟; 赵亚鑫
2015-01-01
目的:测定钩藤的不同药用部位中异钩藤碱的含量。方法应用高效液相色谱法(HPLC)测定8批不同产地钩藤的不同药用部位中异钩藤碱含量。采用Waters Symmetry C18色谱柱(250 mm×4.6 mm,5μm),流动相为甲醇-0.01 mol/L醋酸铵缓冲液(pH 8.0)(60∶40),柱温25℃,进样量20μl,流速1.0 ml/min,检测波长246 nm。结果8批不同产地钩藤药材中均能检测出异钩藤碱,但产地间差异较大;不同药用部位中异钩藤碱的含量:主杆>带钩茎枝>无钩茎枝>无茎枝钩>叶。结论钩藤不同药用部位大部分含异钩藤碱成分,为扩展钩藤植物的药用部位提供试验依据。%ObjectiveTo explore the content of isorhynchophylline in different medicinal parts of Ramulus Uncariae Cum Uncis.MethodsHPLC was adopted to determine 8 batches of different Ramulus Uncariae Cum Uncis of different origin and different medicinal parts. The Waters Symmetry C18 color(4.6 mm×250 mm, 5μm) was used with mobile phase of methanol -0.01 mol/L ammonium acetate buffer(pH 8.0)(60∶40), column temperature of 25℃ , 20μl sample volume, velocity of 1.0 ml/min, and detection wavelength of 246 nm. ResultsIsorhynchophylline can be detected in all 8 batchs of Ramulus Uncariae Cum Uncis in different regions, and different content were found among different origins. The content of isorhynchophylline in different parts of the same origin showed a decreasing sequence of the rhabd, stem with hook, stem without hook, and twig without hook and leaves.ConclusionMost of medicinal part of Ramulus Uncariae Cum Uncis contains isorhynchophylline, which provide a lab basis for exploring medicinal parts of this herbal medicine.
Yang, Jin Ling; Liu, De Xiang; Jiang, Hong; Pan, Fang; Ho, Cyrus Sh; Ho, Roger Cm
2016-10-14
Leptin plays a key role in the pathogenesis of obesity and depression via the long form of leptin receptor (LepRb). An animal model of comorbid obesity and depression induced by high-fat diet (HFD) combined with chronic unpredictable mild stress (CUMS) was developed to study the relationship between depression/anxiety-like behavior, levels of plasma leptin and LepRb in the brains between four groups of rats, the combined obesity and CUMS (Co) group, the obese (Ob) group, the CUMS group and controls. Our results revealed that the Co group exhibited most severe depression-like behavior in the open field test (OFT), anxiety-like behavior in elevated plus maze test (EMT) and cognitive impairment in the Morris water maze (MWM). The Ob group had the highest weight and plasma leptin levels while the Co group had the lowest levels of protein of LepRb in the hypothalamus and hippocampus. Furthermore, depressive and anxiety-like behaviors as well as cognitive impairment were positively correlated with levels of LepRb protein and mRNA in the hippocampus and hypothalamus. The down-regulation of leptin/LepRb signaling might be associated with depressive-like behavior and cognitive impairment in obese rats facing chronic mild stress.
Jindal, Ankur; Mahesh, Radhakrishnan; Bhatt, Shvetank
2013-11-01
Preliminary study in our laboratory showed that etazolate produced antidepressant- and anxiolytic-like effects in rodent models, however, the ability of etazolate to produce antidepressant- and anxiolytic-like effects and underlying mechanism(s) in chronic unpredictable mild stress (CUMS) model have not been adequately addressed. This study was aimed to investigate the beneficial effects of etazolate on CUMS-induced behavioral deficits (depression- and anxiety-like behaviors). In addition, the possible underlying mechanism(s) of etazolate in CUMS model was also investigated by measuring serum corticosterone (CORT) and brain-derived neurotrophic factor (BDNF) levels. Mice were subjected to a battery of stressors for 28 days. Etazolate (0.5 and 1 mg/kg, p.o.) and fluoxetine (20mg/kg, p.o.) were administered during the last 21 days (8-28th) of the CUMS paradigm. The results showed that 4-weeks CUMS produces significant depression-like behavior in tail suspension test (TST) and partial anxiety-like behavior in elevated plus maze (EPM) and open field test (OFT). Stressed mice have also shown a significant high serum CORT and low BDNF level. Chronic treatment with etazolate (0.5 and 1mg/kg., p.o.) and fluoxetine (20mg/kg., p.o.) produced significant antidepressant-like behavior in TST (decreased duration of immobility), whereas, partial anxiolytic-like behavior in EPM (increased percentage of open arm entries) and OFT (increased % central ambulation score, total ambulation score and time spent in center zone). In addition, etazolate and fluoxetine treatment significantly (pBDNF level and inhibited the hypothalamic-pituitary-adrenocortical (HPA) axis hyperactivity, as evidenced by low serum CORT level in stressed mice. In addition, etazolate and fluoxetine also showed significant antidepressant- and anxiolytic-like effects in normal control mice. In this study no significant changes were observed in locomotor activity in actophotometer test. Moreover, we did not find any
Directory of Open Access Journals (Sweden)
Yeshwant Kurhe
2016-06-01
Full Text Available Pioglitazone, a peroxisome proliferator activated receptor gamma (PPARγ agonist belonging to thiazolidinedione class, is mainly used in diabetes mellitus. Obese subjects are twice likely to become depressed than non-obese individuals. The biological mechanisms linking depression with obesity still remain poorly understood and there is immense need for better therapeutic intervention against such co-morbid disorders. The present study investigates the effect of pioglitazone on the chronic unpredictable mild stress (CUMS induced depression in obese mice by using behavioral tests and biochemical estimations. Mice were fed with high fat diet (HFD for 14 weeks and were further subjected to different stress procedures for 28 days to induce depressive behavior. Animals were administered orally with pioglitazone (30 mg/kg p.o./escitalopram (10 mg/kg p.o./vehicle (10 ml/kg p.o. daily from day 15–28. Various behavioral paradigms such as sucrose preference test, forced swim test (FST, tail suspension test (TST and elevated plus maze (EPM were performed. Biochemical estimations including plasma glucose, total cholesterol, triglycerides, and total proteins were performed. The data obtained from behavioral assays and biochemical assessments indicated that obese animals exhibited severe depressive-like behavior compared to non-obese animals. Furthermore, obese animals subjected to CUMS worsen the depressive behavior compared to obese control animals. Repetitive treatment with pioglitazone reversed the CUMS induced behavioral and biochemical alterations in HFD fed obese mice which atleast in part may be mediated through improving altered plasma glucose. The study suggests that pioglitazone needs further attention with respect to molecular mechanisms that could provide a better therapeutic strategy against depression associated with obesity.
Gawali, Nitin B; Bulani, Vipin D; Gursahani, Malvika S; Deshpande, Padmini S; Kothavade, Pankaj S; Juvekar, Archana R
2017-05-15
Agmatine, a neurotransmitter/neuromodulator, has shown to exert numerous effects on the CNS. Chronic stress is a risk factor for development of depression, anxiety and deterioration of cognitive performance. Compelling evidences indicate an involvement of nitric oxide (NO) pathway in these disorders. Hence, investigation of the beneficial effects of agmatine on chronic unpredictable mild stress (CUMS)-induced depression, anxiety and cognitive performance with the involvement of nitrergic pathway was undertaken. Mice were subjected to a battery of stressors for 28days. Agmatine (20 and 40mg/kg, i.p.) alone and in combination with NO modulators like L-NAME (15mg/kg, i.p.) and l-arginine (400mg/kg i.p.) were administered daily. The results showed that 4-weeks CUMS produces significant depression and anxiety-like behaviour. Stressed mice have also shown a significant high serum corticosterone (CORT) and low BDNF level. Chronic treatment with agmatine produced significant antidepressant-like behaviour in forced swim test (FST) and sucrose preference test, whereas, anxiolytic-like behaviour in elevated plus maze (EPM) and open field test (OFT) with improved cognitive impairment in Morris water maze (MWM). Furthermore, agmatine administration reduced the levels of acetylcholinesterase and oxidative stress markers. In addition, agmatine treatment significantly increased the BDNF level and inhibited serum CORT level in stressed mice. Treatment with L-NAME (15mg/kg) potentiated the effect of agmatine whereas l-arginine abolished the anxiolytic, antidepressant and neuroprotective effects of agmatine. Agmatine showed marked effect on depression and anxiety-like behaviour in mice through nitrergic pathway, which may be related to modulation of oxidative-nitrergic stress, CORT and BDNF levels. Copyright © 2017 Elsevier B.V. All rights reserved.
"Sentire cum Ecclesia" –Archbishop Oscar Romero in a crossfire of dissent
Directory of Open Access Journals (Sweden)
Andrzej Dobrzyński
2006-12-01
Full Text Available The article Sentire cum Ecclesia Archbishop Romero caught between the fires of division: presents a clear picture of the difficult situation the Archbishop was involved in while ministering the war torn politically explosive Archdiocese of San Salvador (1977-1998 and the importance of maintaining his relationship with Rome. He lived his life between two burning fires: the cold war and the revolution, right and left wing factions, the unity of the Church and Liberation theology, and at the same time bearing within the strain of the dichotomy between the tendency for the mystic and his prophetic gift. The Archbishop was committed to put into practice the teaching of Vatican II, the social doctrine of the Church, and to the documents written by the Latin American Bishops in the conferences of Medellin (1968 and Puebla (1979. Paying attention to the circumstances of the Archdiocese and to the needs of Salvadorian society as a whole, Romero searched for solutions, taking into account his conscience and the Magisterium of the Church, while living a deeply spiritual life. His Episcopal motto, “To be of one mind with the Church” signifies his dedication and compassion with the suffering poor and disenfranchised, and the Church as an institution. Proof of this stems from always referring his feelings back to Rome and his dedication to the poor and persecuted. Even though it is not easy to draw any conclusions or make any judgments regarding Oscar Romero’s mission of the Church in the midst of the countries crisis, the article underlines the Historical-Ecclesiastical perspective that allows the avoidance of myths that continue to exist, in both liberal and conservative Catholic surroundings.
Luo, Ying; Kuang, Shengnan; Li, Huan; Ran, Dongzhi; Yang, Junqing
2017-05-30
To investigate the mechanism of cyclooxygenase 2 (COX2) in learning and memory impairments in rats subjected to chronic unpredictable mild stress (CUMS), meloxicam was used intragastrically to inhibit the activity of cyclooxygenase 2. Moreover, cyclooxygenase 2 over-expressing or RNA interfere lentivirus was injected intraventricularly to increase or decrease the enzyme's expression, respectively. The body weights and sucrose consumption were used to analyze depressive behaviors, while the Morris water maze and step-down-type passive avoidance tests were carried out to evaluate the learning-memory functions. The levels of inflammatory cytokines were measured to estimate inflammation and the contents of cyclic adenosine monophosphate (cAMP) were used to measure the levels of the second messenger. Changes in cyclooxygenase 2 mRNA levels were analyzed using reverse transcription polymerase chain reaction. Moreover, the expression of cyclooxygenase 2, brain-derived neurotrophic factor (BDNF), prostaglandins receptor 3 (EP3), protein kinase A (PKA), cAMP response element binding protein (CREB), and phosphorylated CREB were estimated using immunohistochemical staining or western blotting. The results showed that CUMS led to significant depressive-like behaviors and learning and memory dysfunctions. Also, the cAMP levels decreased significantly, while levels of inflammatory cytokines and prostaglandins E2 increased significantly. The expressions of PKA, BDNF, phosphorylated CREB/CREB declined and cyclooxygenase 2 was increased. Meloxicam and cyclooxygenase 2 RNA interfere lentivirus reversed the changes caused by CUMS while cyclooxygenase 2-overexpressing lentivirus worsened these abnormalities. The findings also showed that CUMS increased cyclooxygenase 2 expression, which can cause learning and memory impairments, mainly through activating the hippocampal neuronal cAMP/PKA-CREB-BDNF signaling pathways.
Directory of Open Access Journals (Sweden)
Jun Shen
2016-01-01
Full Text Available Angelica sinensis (AS, a traditional Chinese herbal medicine, has pharmaceutical effects on menstrual illness, cerebrovascular diseases, cardiovascular diseases, and cognitive impairments. However, until recently, few studies had explored its antidepressant effect. The current study attempts to investigate the effect of AS extracts on chronic unpredictable mild stress- (CUMS- induced depression in rats. Male SD rats were exposed to a CUMS-inducing procedure for 5 weeks, resulting in rodent depressive behaviors that included reduced sucrose consumption and lessened sucrose preference ratios in sucrose preference test, prolonged immobility times and decreased struggling time in force swim test, and decreased locomotor activity in open field test. Moreover, the expression of brain derived neurotrophic factor (BDNF and the phosphorylation of cAMP-response element binding protein (CREB and extracellular signal-regulated protein kinase (ERK 1/2 were markedly decreased in the hippocampus in depressed rats. However, chronically treating the depressed rats with AS (1 g/kg normalized their depression-related behaviors and molecular profiles. In conclusion, in the present study, we show that AS extracts exerted antidepressant effects that were mediated by the BDNF signaling pathway: in AS-treated depressed rats, the expression of the BDNF protein and the phosphorylation of its downstream targets (ERK 1/2, CREB were upregulated in the hippocampus.
Directory of Open Access Journals (Sweden)
Yang Yang
2017-07-01
Full Text Available In the clinic selective serotonin reuptake inhibitors (SSRIs, like Fluoxetine, remain the primary treatment for major depression. It has been suggested that miR-16 regulates serotonin transporters (SERT via raphe nuclei and hippocampal responses to antidepressants. However, the underlying mechanism and regulatory pathways are still obtuse. Here, a chronic unpredicted mild stress (CUMS depression model in rats was established, and then raphe nuclei miR-16 and intragastric Fluoxetine injections were administered for a duration of 3 weeks. An open field test and sucrose preference quantification displayed a significant decrease in the CUMS groups when compare to the control groups, however these changes were attenuated by both miR-16 and Fluoxetine treatments. A dual-luciferase reporter assay system verified that hsa-miR-16 inhibitory effects involve the targeting of 3′UTR on the 5-HTT gene. Expression levels of miR-16 and BDNF in the hippocampus were examined with RT-PCR, and it was found that increased 5-HT2a receptor expression induced by CUMS can be decreased by miR-16 and Fluoxetine administration. Immunofluorescence showed that expression levels of neuron NeuN and MAP-2 in CUMS rats were lower. Apoptosis and autophagy levels were evaluated separately through relative expression of Bcl-2, Caspase-3, Beclin-1, and LC3II. Furthermore, CUMS was found to decrease levels of hippocampal mTOR, PI3K, and AKT. These findings indicate that apoptosis and autophagy related pathways could be involved in the effectiveness of antidepressants, in which miR-16 participates in the regulation of, and is likely to help integrate rapid therapeutic strategies to alleviate depression clinically. These findings indicate that miR-16 participates in the regulation of apoptosis and autophagy and could account for some part of the therapeutic effect of SSRIs. This discovery has the potential to further the understanding of SSRIs and accelerate the development of new
Desigualdades de género en la medicación: un tortuoso recorrido por el Vademécum
Directory of Open Access Journals (Sweden)
Lourdes Pérez González
2010-12-01
Full Text Available Análisis de las diferencias de género en la medicalización —entendida como la apropiación de parcelas de la vida cotidiana por el ámbito médico/farmacéutico— y sus repercusiones en la vida y la salud de las mujeres. Este análisis utiliza como referencia fundamental el Vademécum, base de datos que nos ha permitido la búsqueda de los fármacos (centrándonos en los efectos adversos y las interacciones que se expiden sin receta y están destinados fundamentalmente, o únicamente, a las mujeres ―sanas Analysis of gender differences in medicalization - understood as the appropriation of daily life areas by the medical/pharmaceutical field - and their impact on women’s health and lives. This study relies on the Vademecum as the main reference, database that has allowed us the search of drugs (focusing on the adverse effects and the interactions that are given without a prescription and are basically, or only, addressed to ―healthy‖ women.
Properties influencing cracking and separation of palm nuts in a mechanical cracker cum separator
Directory of Open Access Journals (Sweden)
JOSHUA OLANREWAJU OLAOYE
2018-01-01
Full Text Available Experimental studies of some properties influencing cracking and separation of palm kernel from the shell was conducted in a palm kernel dual processing machine. A mechanical cracking cum separating machine was developed for the study. The cracking unit consists of feed hopper, impeller shaft, cracking drum and impeller blade. The nut falls by gravity through the hopper channel into the cracking drum where the cracking process takes place through the help of impeller blades that flip the palm nut against the walls of cylindrical cracking drum. The mass of cracked nut flows through the separating unit that separates the kernel from the shell. The separation is induced by high current of air mass generated by an axial fan. A dura palm variety was selected and a total sample of eighteen thousand (18000 palm nuts were obtained and divided into two groups (feed rates, A and B, of eight thousand and ten thousand palm nuts respectively. Sample groups A and B were further divided into five sub – groups of four hundred (400 and five hundred (500 palm kernel nuts. Each sub group (feed rate was replicated four times at different shaft speeds (600, 900, 1200, 1500 and 1800 rpm. Results showed that cracking efficiencies increased with respect to speed. Un-cracked nuts percentage ranged from 1.3 to 5.3% at 7.1% moisture content, and 1.6 to 4.5% for 400 and 500 feed rates, respectively. Cracking time for both feed rates decreased with shaft speed. Throughput capacity of 11.49 kg/h was observed to be the lowest at 600 rpm and moisture content of 7.1% for both 400 feed rates and the highest throughput capacity of 37.16 kg/h was recorded at 1800 rpm at moisture contents of 9.3% and 16.1%. The results of this study shows that moisture content, engine speed and feed rate are significant parameters that influence cracking of nuts and separation of palm kernel from the shell.
Quasiperiodicity in time evolution of the Bloch vector under the thermal Jaynes-Cummings model
Azuma, Hiroo; Ban, Masashi
2014-07-01
We study a quasiperiodic structure in the time evolution of the Bloch vector, whose dynamics is governed by the thermal Jaynes-Cummings model (JCM). Putting the two-level atom into a certain pure state and the cavity field into a mixed state in thermal equilibrium at initial time, we let the whole system evolve according to the JCM Hamiltonian. During this time evolution, motion of the Bloch vector seems to be in disorder. Because of the thermal photon distribution, both a norm and a direction of the Bloch vector change hard at random. In this paper, taking a different viewpoint compared with ones that we have been used to, we investigate quasiperiodicity of the Bloch vector’s trajectories. Introducing the concept of the quasiperiodic motion, we can explain the confused behaviour of the system as an intermediate state between periodic and chaotic motions. More specifically, we discuss the following two facts: (1) If we adjust the time interval Δt properly, figures consisting of plotted dots at the constant time interval acquire scale invariance under replacement of Δt by sΔt, where s(>1) is an arbitrary real but not transcendental number. (2) We can compute values of the time variable t, which let |Sz(t)| (the absolute value of the z-component of the Bloch vector) be very small, with the Diophantine approximation (a rational approximation of an irrational number).
Multi-atom Jaynes-Cummings model with nonlinear effects
International Nuclear Information System (INIS)
Aleixo, Armando Nazareno Faria; Balantekin, Akif Baha; Ribeiro, Marco Antonio Candido
2001-01-01
The standard Jaynes-Cummings (JC) model and its extensions, normally used in quantum optics, idealizes the interaction of matter with electromagnetic radiation by a simple Hamiltonian of a two-level atom coupled to a single bosonic mode. This Hamiltonian has a fundamental importance to the field of quantum optics and it is a central ingredient in the quantized description of any optical system involving the interaction between light and atoms. The JC Hamiltonian defines a molecule, a composite system formed from the coupling of a two-state system and a quantized harmonic oscillator. For this Hamiltonian, mostly the single-particle situation has been studied. This model can also be extended for the situation where one has N two-level systems, which interact only with the electromagnetic radiation. In this case the effects of the spatial distribution of the particles it is not taken into account and the spin angular momentum S-circumflex i of each particle contributes to form a total angular momentum J-circumflex of the system. When one considers the effects due to the spatial variation in the field intensity in a nonlinear medium it is necessary to further add a Kerr term to the standard JC Hamiltonian. This kind of nonlinear JC Hamiltonian is used in the study of micro masers. Another nonlinear variant of the JC model takes the coupling between matter and the radiation to depend on the intensity of the electromagnetic field. This model is interesting since this kind of interaction means that effectively the coupling is proportional to the amplitude of the field representing a very simple case of a nonlinear interaction corresponding to a more realistic physical situation. In this work we solve exactly the problem of the interaction of a N two-level atoms with an electromagnetic radiation when nonlinear effects due to the spatial variation in the field intensity in a nonlinear Kerr medium and the dependence on the intensity of the electromagnetic field on the matter
Directory of Open Access Journals (Sweden)
Xiaoxia Gao
2018-01-01
Full Text Available The petroleum ether fraction of Bupleuri Radix which is contained in the traditional Chinese medicine prescription of Xiaoyaosan (XYS may have a therapeutic effect in depressed subjects based on the results of our previous study. It has been reported that Bupleuri Radix can cause liver toxicity following overdosing or long-term use. Therefore, this study aimed to decipher the differential effective and toxic responses of Bupleuri Radix in chronic unpredictable mild stress (CUMS (with depression and healthy rats based on serum metabolic profiles. Serum metabolic profiles were obtained using the UHPLC- Q Exactive Orbitrap-MS technique. Our results demonstrated that the petroleum ether fraction of Bupleuri Radix (PBR produces an antidepressant effect through regulating glycometabolism, amino acid metabolism, sphingolipid metabolism, glycerophospholipid metabolism, and fatty acid metabolism. It also induces more severe toxic reactions in the liver or kidney in healthy rats than in CUMS rats, which exhibited a comparatively mild drug-induced toxic reaction. The altered lysine degradation, sphingolipid metabolism, glycerophospholipid metabolism, fatty acid metabolism, and bile acid metabolism could be at least partly responsible for the PBR toxic responses in healthy rats. The differential effective and toxic response of PBR in CUMS rats and healthy rats provide a new standard for the more rational and safer application of clinical drugs in the future.
Liu, Yu-Jie; Mo, Xue-Lin; Tang, Xiao-Zhang; Li, Jiang-Hua; Hu, Mei-Bian; Yan, Dan; Peng, Wei; Wu, Chun-Jie
2017-06-09
In this study, the ultrasound-assisted extraction of polysaccharides (PSA) from Pinelliae Rhizoma Praeparatum Cum Alumine (PRPCA) was optimized by response surface methodology (RSM). The structural characteristics of PSA were analyzed by UV-vis spectroscopy, infrared spectroscopy, scanning electron microscopy, high performance gel permeation chromatography and high performance liquid chromatography, respectively. In addition, antioxidant and antimicrobial activities of PSA were studied by different in vitro assays. Results indicated that the optimal extraction conditions were as follows: the ratio of water to raw of 30 mL/g, extraction time of 46.50 min, ultrasonic temperature of 72.00 °C, and ultrasonic power of 230 W. Under these conditions, the obtained PSA yield (13.21 ± 0.37%) was closely agreed with the predicted yield by the model. The average molecular weights of the PSA were estimated to be 5.34 × 10³ and 6.27 × 10⁵ Da. Monosaccharide composition analysis indicated that PSA consisted of mannose, galactose uronic acid, glucose, galactose, arabinose with a molar ratio of 1.83:0.55:75.75:1.94:0.45. Furthermore, PSA exhibited moderate antioxidant and antibacterial activities in vitro. Collectively, this study provides a promising strategy to obtain bioactive polysaccharides from processed products of herbal medicines.
Theoria cum Praxi? The (In- Compatibility of Demands in Science and Business World
Directory of Open Access Journals (Sweden)
Monika Kritzmöller
2004-05-01
Full Text Available The necessity for co-operation between (scientific theory and (management praxis is apparent more than ever. There are countless parallels in the goals and objectives of social and marketing research, for example, learning more about communities—respectively customers—and explaining their behavior. Extending social research services to businesses can create synergistic effects. On the one hand, the scientists can benefit financially in dimensions not feasible at universities and have a fruitful dialogue with business practitioners. On the other hand, the business management have access to the latest scientific results of high quality before these results are available to competitors as official publications. These opportunities and advantages can no longer permit a prejudice-based, mutual ideological rejection, which can still be found in both spheres. In the course of my "Habilitation" at the University of St. Gallen (Switzerland, I created a successful method for combining theory with practice. I developed a sociological theory of social structure, which can be put into practice in order to analyze and comprehend the behavior of target groups in marketing. I co-operated with selected furniture manufacturers and received advanced payments during the entire period of my research. In return, these manufacturers received my consulting services. I applied the research findings directly to their business demands after the end of my project. On the one hand, this procedure requires that a scientist is experienced in business affairs and has the ability and readiness for transferring scientific results into every-day practice. On the other hand, management needs to give up short-term thinking of "KISS" (keep it short and simple and care about understanding things instead of merely describing them. My co-operation in the project and the implementation of "theoria cum praxi" approach was a positive experience, which I will continue using in future
Yan, Zhiyi; Jiao, Haiyan; Ding, Xiufang; Ma, Qingyu; Li, Xiaojuan; Pan, Qiuxia; Wang, Tingye; Hou, Yajing; Jiang, Youming; Liu, Yueyun; Chen, Jiaxu
2018-05-03
Background: The apelin-APJ system has been considered to play a crucial role in HPA axis function, and how the traditional Chinese compound prescription Xiaoyaosan regulates the apelin-APJ system as a supplement to treat depressive disorders. Objective: To investigate the depression-like behaviors and expression of apelin and APJ in hypothalamus of chronic unpredictable mild stress (CUMS) mice and study whether these changes related to the regulation of Xiaoyaosan. Methods: 60 adult C57BL/6J mice were randomly divided into four groups, including control group, CUMS group, Xiaoyaosan treatment group and fluoxetine treatment group. Mice in the control group and CUMS group received 0.5 mL physiological saline once a day by intragastric administration. Mice in two treatment groups received Xiaoyaosan (0.25 g/kg/d) and fluoxetine (2.6 mg/kg/d), respectively. After 21 days of modeling with CUMS, the expression of apelin and APJ in hypothalamus were measured by real-time fluorescence quantitative PCR, western blot and immunohistochemical staining. The physical condition, body weight, food intake and behavior tests such as open field test, sucrose preference test and force swimming test were measured to evaluate depressive-like behaviors. Results: In this study, significant behavioral changes were found in CUMS-induced mice, meanwhile the expressions of apelin and APJ in the hypothalamus were changed after modeling. The body weight, food-intake and depressive-like behaviors in CUMS-induced mice could be improved by Xiaoyaosan treatment which is similar with the efficacy of fluoxetine, while the expressions of apelin and APJ in hypothalamus were modified by Xiaoyaosan. Conclusions: The data suggest that apelin-APJ system changes in the hypothalamus may be a target of depressive disorders, and the beneficial effects of Chinese compound prescription Xiaoyaosan on depressive-like behaviors may be mediated by the apelin-APJ system.
Ni, Yu-Fei; Wang, Hao; Gu, Qiu-Yan; Wang, Fei-Ying; Wang, Ying-Jie; Wang, Jin-Liang; Jiang, Bo
2018-04-01
Major depressive disorder has become one of the most serious neuropsychiatric disorders worldwide. However, currently available antidepressants used in clinical practice are ineffective for a substantial proportion of patients and always have side effects. Besides being a lipid-regulating agent, gemfibrozil is an agonist of peroxisome proliferator-activated receptor-α (PPAR-α). We investigated the antidepressant effects of gemfibrozil on C57BL/6J mice using the forced swim test (FST) and tail suspension test (TST), as well as the chronic unpredictable mild stress (CUMS) model of depression. The changes in brain-derived neurotrophic factor (BDNF) signaling cascade in the brain after CUMS and gemfibrozil treatment were further assessed. Pharmacological inhibitors and lentivirus-expressed short hairpin RNA (shRNA) were also used to clarify the antidepressant mechanisms of gemfibrozil. Gemfibrozil exhibited significant antidepressant actions in the FST and TST without affecting the locomotor activity of mice. Chronic gemfibrozil administration fully reversed CUMS-induced depressive-like behaviors in the FST, TST and sucrose preference test. Gemfibrozil treatment also restored CUMS-induced inhibition of the hippocampal BDNF signaling pathway. Blocking PPAR-α and BDNF but not the serotonergic system abolished the antidepressant effects of gemfibrozil on mice. Gemfibrozil produced antidepressant effects in mice by promoting the hippocampal BDNF system.
Yang, Xin-Hua; Song, Su-Qi; Xu, Yun
2017-01-01
Classic antidepressant drugs are modestly effective across the population and most are associated with intolerable side effects. Recently, numerous lines of evidence suggest that resveratrol (RES), a natural polyphenol, possesses beneficial therapeutic activity for depression. The aim of the present study was to explore whether RES exhibits an antidepressant-like effect in a depression model and to explore the possible mechanism. A depression model was established via chronic unpredictable mild stress (CUMS), after which the model rats in the RES and fluoxetine groups received a daily injection of RES or fluoxetine, respectively. The sucrose preference test, open field test, and forced swimming test were used to explore the antidepressant-like effects of RES. The activity of the hypothalamic-pituitary-adrenal (HPA) axis was evaluated by detecting the plasma corticosterone concentration and hypothalamic mRNA expression of corticotrophin-releasing hormone. The plasma interleukin-6 (IL-6), C-reactive protein (CRP), and tumor necrosis factor-α (TNF-α) concentrations were measured by enzyme-linked immunosorbent assay. Hippocampal protein expression of brain-derived neurotrophic factor (BDNF) and the Wnt/β-catenin pathway were analyzed by western blot. The results showed that RES relieved depression-like behavior of CUMS rats, as indicated by the increased sucrose preference and the decreased immobile time. Rats that received RES treatment exhibited reduced plasma corticosterone levels and corticotrophin-releasing hormone mRNA expression in the hypothalamus, suggesting that the hyperactivity of the HPA axis in CUMS rats was reversed by RES. Moreover, after RES treatment, the rats exhibited increased plasma IL-6, CRP, and TNF-α concentrations. Furthermore, RES treatment upregulated the hippocampal protein levels of BDNF and the relative ratio of p-β-catenin/β-catenin while downregulating the relative ratio of p-GSK-3β/GSK-3β. Our findings suggest that RES improved
Revivals and entanglement from initially entangled mixed states of a damped Jaynes-Cummings model
International Nuclear Information System (INIS)
Rendell, R.W.; Rajagopal, A.K.
2003-01-01
An exact density matrix of a phase-damped Jaynes-Cummings model (JCM) with entangled Bell-like initial states formed from a model two-state atom and sets of adjacent photon number states of a single-mode radiation field is presented. The entanglement of the initial states and the subsequent time evolution is assured by finding a positive lower bound on the concurrence of local 2x2 projections of the full 2x∞ JCM density matrix. It is found that the time evolution of the lower bound of the concurrence systematically captures the corresponding collapse and revival features in atomic inversion, relative entropies of atomic and radiation, mutual entropy, and quantum deficit. The atom and radiation subsystems exhibit alternating sets of collapses and revivals in a complementary fashion due to the initially mixed states of the atom and radiation employed here. This is in contrast with the result obtained when the initial state of the dissipationless system is a factored pure state of the atom and radiation, where the atomic and radiation entropies are necessarily the same. The magnitudes of the entanglement lower bound and the atomic and radiation revivals become larger as both the magnitude and phase of the Bell-like initial state contribution increase. The time evolution of the entropy difference of the total system and that of the radiation subsystem exhibit negative regions called 'supercorrelated' states which do not appear in the atomic subsystem. Entangled initial states are found to enhance this supercorrelated feature. Finally, the effect of phase damping is to randomize both the subsystems for asymptotically long times. It may be feasible to experimentally investigate the results presented here using the Rabi oscillation methods of microwave and optical cavity quantum electrodynamics since pure photon number states have recently been produced and observed
Directory of Open Access Journals (Sweden)
Fanny Gaignier
2018-05-01
Full Text Available During spaceflight, astronauts face radiations, mechanical, and socio-environmental stressors. To determine the impact of chronic socio-environmental stressors on immunity, we exposed adult male mice to chronic unpredictable mild psychosocial and environmental stressors (CUMS model for 3 weeks. This duration was chosen to simulate a long flight at the human scale. Our data show that this combination of stressors induces an increase of serum IgA, a reduction of normalized splenic mass and tends to reduce the production of pro-inflammatory cytokines, as previously reported during or after space missions. However, CUMS did not modify major splenic lymphocyte sub-populations and the proliferative responses of splenocytes suggesting that these changes could be due to other factors such as gravity changes. Thus, CUMS, which is an easy to implement model, could contribute to deepen our understanding of some spaceflight-associated immune alterations and could be useful to test countermeasures.
Directory of Open Access Journals (Sweden)
Yang X
2017-10-01
Full Text Available Xin-Hua Yang,1 Su-Qi Song,2 Yun Xu3 1Department of Pharmacy, Hefei Eighth People’s Hospital, Hefei, 2Department of Psychiatry, Chaohu Hospital of Anhui Medical University, Hefei, 3Faculty of Pharmacy, Anhui Medical University, Hefei, China Abstract: Classic antidepressant drugs are modestly effective across the population and most are associated with intolerable side effects. Recently, numerous lines of evidence suggest that resveratrol (RES, a natural polyphenol, possesses beneficial therapeutic activity for depression. The aim of the present study was to explore whether RES exhibits an antidepressant-like effect in a depression model and to explore the possible mechanism. A depression model was established via chronic unpredictable mild stress (CUMS, after which the model rats in the RES and fluoxetine groups received a daily injection of RES or fluoxetine, respectively. The sucrose preference test, open field test, and forced swimming test were used to explore the antidepressant-like effects of RES. The activity of the hypothalamic–pituitary–adrenal (HPA axis was evaluated by detecting the plasma corticosterone concentration and hypothalamic mRNA expression of corticotrophin-releasing hormone. The plasma interleukin-6 (IL-6, C-reactive protein (CRP, and tumor necrosis factor-α (TNF-α concentrations were measured by enzyme-linked immunosorbent assay. Hippocampal protein expression of brain-derived neurotrophic factor (BDNF and the Wnt/β-catenin pathway were analyzed by western blot. The results showed that RES relieved depression-like behavior of CUMS rats, as indicated by the increased sucrose preference and the decreased immobile time. Rats that received RES treatment exhibited reduced plasma corticosterone levels and corticotrophin-releasing hormone mRNA expression in the hypothalamus, suggesting that the hyperactivity of the HPA axis in CUMS rats was reversed by RES. Moreover, after RES treatment, the rats exhibited increased
What can we learn from the dynamics of entanglement and quantum discord in the Tavis-Cummings model?
Restrepo, Juliana; Rodriguez, Boris A.
We revisit the problem of the dynamics of quantum correlations in the exact Tavis-Cummings model. We show that many of the dynamical features of quantum discord attributed to dissipation are already present in the exact framework and are due to the well known non-linearities in the model and to the choice of initial conditions. Through a comprehensive analysis, supported by explicit analytical calculations, we find that the dynamics of entanglement and quantum discord are far from being trivial or intuitive. In this context, we find states that are indistinguishable from the point of view of entanglement and distinguishable from the point of view of quantum discord, states where the two quantifiers give opposite information and states where they give roughly the same information about correlations at a certain time. Depending on the initial conditions, this model exhibits a fascinating range of phenomena that can be used for experimental purposes such as: Robust states against change of manifold or dissipation, tunable entanglement states and states with a counterintuitive sudden birth as the number of photons increase. We furthermore propose an experiment called quantum discord gates where discord is zero or non-zero depending on the number of photons. This work was supported by the Vicerrectoria de Investigacion of the Universidad Antonio Narino, Colombia under Project Number 20141031 and by the Departamento Administrativo de Ciencia, Tecnologia e Innovacion (COLCIENCIAS) of Colombia under Grant Number.
Directory of Open Access Journals (Sweden)
Xiaoxia Zhu
2014-01-01
Full Text Available Xiao Yao San (XYS is a classical Chinese medicine formula that has been widely used to treat mood disorders for hundreds of years. To confirm the effect of XYS and better understand its underlying mechanism, high-performance liquid chromatography-mass spectrometry analysis-based quality control of XYS extracts and proteomics-based identification of differential proteins in the hippocampus were adopted in social isolation and chronic unpredictable mild stress- (CUMS- treated rats. The depressive-like behavior of rats induced by CUMS resembled the manifestation of human depression. The upregulated corticosterone (CORT and urocortin 2 (UCN2 levels demonstrated the existence of hypothalamic-pituitary-adrenal (HPA axis hyperactivity. XYS was effective in ameliorating the depressive-like behavior and downregulating UCN2 and CORT. XYS decreased the expression of serine/threonine-protein phosphatase 2A subunit B and increased the expression of β-arrestin 2. The expressions of brain-derived neurotrophic factor (BDNF, tyrosine receptor kinase B (TrkB, and mammalian target of rapamycin (mTOR were also elevated by XYS. In conclusion, XYS improves social isolation and CUMS-induced depressive-like behavior and ameliorates HPA hyperactivation through the downregulation of corticotrophin releasing hormone (CRH receptor 2. The upregulation of BDNF/TrkB and the phosphorylation of mTOR require β-arrestin 2 as a scaffold to regulate stress signaling.
Tripathy, A; Ghosh, A; Dey, A; Pakhira, B P; Ghosh, D
2017-10-01
This study was designed to explore the cyproterone acetate (CPA)-induced andrological hypofunction and its correction by oral administration of lycopene. In this concern, spermatogenic, biochemical, histological and genomic profiles were studied. Cyproterone acetate administration for 1 month helped to develop infertile model rats. A significant recovery was noted in sperm motility, sperm count, sperm viability, hypo-osmotic swelling tail-coiled spermatozoa; activities of testicular ∆ 5 , 3β-hydroxysteroid dehydrogenase (HSD), 17β-HSD, catalase (CAT) and superoxide dismutase (SOD); and levels of conjugated diene (CD), malondialdehyde (MDA), testicular cholesterol and serum testosterone after the administration of lycopene at 1.5 mg/0.5 ml Tween-80/100 g body weight/day for last 1 month to infertile model rats. Simultaneously, qRT-PCR study of Bax, Bcl-2, caspase-3, ∆ 5 , 3β-HSD and 17β-HSD genes in testicular tissue showed a significant rectification towards the control in CPA-pre-treated cum CPA-lycopene-cotreated rats. Side-by-side histological and histometric studies showed a significant correction in qualitative analysis of spermatogenesis and seminiferous tubular diameter (STD) in CPA-pre-treated cum CPA-lycopene-cotreated rats. Lycopene showed outstanding efficacy in the management of CPA-induced testicular hypofunction with special reference to correction in oxidative stress-induced testicular apoptosis at genomic level. © 2016 Blackwell Verlag GmbH.
Ai, Zhong; Cheng, Ai-Fang; Yu, Yuan-Tao; Yu, Long-Jiang; Jin, Wenwen
2014-05-01
Maca has been consumed as a medical food in Peru for thousands of years, and exerts anxiolytic and antidepressant effects. Our present study aimed to evaluate the behavior and anatomical and biochemical effects of petroleum ether extract from maca (ME) in the chronic unpredictable mild stress (CUMS) model of depression in mice. Three different doses of maca extract (125, 250, and 500 mg/kg) were orally administrated in the six-week CUMS procedure. Fluoxetine (10 mg/kg) was used as a positive control drug. Maca extract (250 and 500 mg/kg) significantly decreased the duration of immobility time in the tail suspension test. After treatment with maca extract (250 and 500 mg/kg), the granule cell layer in the dentate gyrus appeared thicker. Maca extract (250 and 500 mg/kg) also induced a significant reduction in corticosterone levels in mouse serum. In mouse brain tissue, after six weeks of treatment, noradrenaline and dopamine levels were increased by maca extract, and the activity of reactive oxygen species was significantly inhibited. Serotonin levels were not significantly altered. These results demonstrated that maca extract (250 and 500 mg/kg) showed antidepressant-like effects and was related to the activation of both noradrenergic and dopaminergic systems, as well as attenuation of oxidative stress in mouse brain.
Dendritic Spines in Depression: What We Learned from Animal Models
Directory of Open Access Journals (Sweden)
Hui Qiao
2016-01-01
Full Text Available Depression, a severe psychiatric disorder, has been studied for decades, but the underlying mechanisms still remain largely unknown. Depression is closely associated with alterations in dendritic spine morphology and spine density. Therefore, understanding dendritic spines is vital for uncovering the mechanisms underlying depression. Several chronic stress models, including chronic restraint stress (CRS, chronic unpredictable mild stress (CUMS, and chronic social defeat stress (CSDS, have been used to recapitulate depression-like behaviors in rodents and study the underlying mechanisms. In comparison with CRS, CUMS overcomes the stress habituation and has been widely used to model depression-like behaviors. CSDS is one of the most frequently used models for depression, but it is limited to the study of male mice. Generally, chronic stress causes dendritic atrophy and spine loss in the neurons of the hippocampus and prefrontal cortex. Meanwhile, neurons of the amygdala and nucleus accumbens exhibit an increase in spine density. These alterations induced by chronic stress are often accompanied by depression-like behaviors. However, the underlying mechanisms are poorly understood. This review summarizes our current understanding of the chronic stress-induced remodeling of dendritic spines in the hippocampus, prefrontal cortex, orbitofrontal cortex, amygdala, and nucleus accumbens and also discusses the putative underlying mechanisms.
Energy Technology Data Exchange (ETDEWEB)
Hermanne, A.; Adam Rebeles, R. [Cyclotron Laboratory, Vrije Universiteit Brussel, Brussel 1090 (Belgium); Tárkányi, F.; Takács, S. [Institute of Nuclear Research, Hungarian Academy of Science, 4026 Debrecen (Hungary)
2015-08-01
Thin {sup nat}Cr targets were obtained by electroplating, using 23.75 μm Cu foils as backings. In five stacked foil irradiations, followed by high resolution gamma spectroscopy, the cross sections for production of {sup 52g}Fe, {sup 49,51cum}Cr, {sup 52cum,54,56cum}Mn and {sup 48cum}V in Cr and {sup 61}Cu,{sup 68}Ga in Cu were measured up to 39 MeV incident α-particle energy. Reduced uncertainty is obtained by simultaneous remeasurement of the {sup nat}Cu(α,x){sup 67,66}Ga monitor reactions over the whole energy range. Comparisons with the scarce literature values and results from the TENDL-2013 on-line library, based on the theoretical code family TALYS-1.6, were made. A discussion of the production routes for {sup 52g}Fe with achievable yields and contamination rates was made.
Xu, Jingjing; Wang, Rui; Liu, Yuan; Liu, Dexiang; Jiang, Hong; Pan, Fang
2017-12-01
Exposure to stressful events induces depressive-like symptoms and increases susceptibility to depression. However, the molecular mechanisms are not fully understood. Studies reported that FK506 binding protein51 (FKBP5), the co-chaperone protein of glucocorticoid receptors (GR), plays a crucial role. Further, miR-124a and miR-18a are involved in the regulation of FKBP5/GR function. However, few studies have referred to effects of early life stress on depressive-like behaviours, GR and FKBP5, as well as miR-124a and miR-18a in the basolateral amygdala (BLA) from adolescence to adulthood. This study aimed to examine the dynamic alternations of depressive-like behaviours, GR and FKBP5, as well as miR-124a and miR-18a expressions in the BLA of chronic unpredictable mild stress (CUMS) rats and dexamethasone administration rats during the adolescent period. Meanwhile, the GR antagonist, RU486, was used as a means of intervention. We found that CUMS and dexamethasone administration in the adolescent period induced permanent depressive-like behaviours and memory impairment, decreased GR expression, and increased FKBP5 and miR-124a expression in the BLA of both adolescent and adult rats. However, increased miR-18a expression in the BLA was found only in adolescent rats. Depressive-like behaviours were positively correlated with the level of miR-124a, whereas GR levels were negatively correlated with those in both adolescent and adult rats. Our results suggested FKBP5/GR and miR-124a in the BLA were associated with susceptibility to depressive disorder in the presence of stressful experiences in early life. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Guangjun Xi
Full Text Available It is generally accepted that cognitive processes, such as learning and memory, are affected in depression. The present study used a rat model of depression, chronic unpredictable mild stress (CUMS, to determine whether hippocampal volume and neurochemical changes were involved in learning and memory alterations. A further aim was to determine whether these effects could be ameliorated by escitalopram treatment, as assessed with the non-invasive techniques of structural magnetic resonance imaging (MRI and magnetic resonance spectroscopy (MRS. Our results demonstrated that CUMS had a dramatic influence on spatial cognitive performance in the Morris water maze task, and CUMS reduced the concentration of neuronal marker N-acetylaspartate (NAA in the hippocampus. These effects could be significantly reversed by repeated administration of escitalopram. However, neither chronic stress nor escitalopram treatment influenced hippocampal volume. Of note, the learning and memory alterations of the rats were associated with right hippocampal NAA concentration. Our results indicate that in depression, NAA may be a more sensitive measure of cognitive function than hippocampal volume.
Directory of Open Access Journals (Sweden)
Yi-Nan Zhang
2017-11-01
Full Text Available Uncariae Ramulus Cum Uncis (URCU is a widely used traditional Chinese medicine, and is reported to have various central nervous system effects. Alkaloids have been demonstrated to be the predominant pharmacological active components of URCU. In order to evaluate the blood-brain barrier (BBB permeability and transport mechanism of six typical indole alkaloids from URCU, the MDCK-pHaMDR cell monolayer model was used as an in vitro surrogate model for BBB. The samples were analyzed by high-performance liquid chromatography, and the apparent permeability coefficients (Papp were calculated. Among the six alkaloids, isorhynchophylline (2, isocorynoxeine (4, hirsutine (5 and hirsuteine (6 showed high permeability, with Papp values at 10−5 cm/s level in bidirectional transport. For rhynchophylline (1 and corynoxeine (3, they showed moderate permeability, with Papp values from the apical (AP side to the basolateral (BL side at 10−6 cm/s level and efflux ratio (Papp BL→AP/Papp AP→BL above 2. The time- and concentration-dependency experiments indicated that the main mechanism for 2, 4, 5 and 6 through BBB was passive diffusion. The efflux mechanism involved in the transports of compounds 1 and 3 could be reduced significantly by verapamil, and molecular docking screening also showed that 1 and 3 had strong bindings to P-glycoprotein. This study provides useful information for predicting the BBB permeability for 1–6, as well as better understanding of their central nervous system pharmacological activities.
Choon, S E; Mathew, M; Othman, B S
2000-06-01
The demographic characteristics, risk behaviourand prevalence of other sexually transmitted diseases (STDs) were determined in 132 HIV-infected individuals seen in a Dermatology cum Genitourinary Clinic, Hospital Sultanah Aminah Johor Bahru. Sixty-one (46.2%) were Malays, 37.9% Chinese, 10.6% Indians and 5.3% were of other ethnic groups. The male to female ratio was 4.5:1. Most of the patients (82.5%) were between 20 to 40 years-old. Seventy (53.0%) were single, 34.1% were married and 7.5% were divorcees. The majority of them (97.7%) were heterosexual. Fifty seven (53.3%) of our male patients patronised commercial workers. Eighty-one (61.8%) were not intravenous drug users (IVDU). Of the 50 IVDUs, 24 had multiple sexual exposures. Fifty-three (48.2%) of the 109 patients screened for STDs had one or more other STDs. Thirty-four patients (31.9%) reported one STD in the past and 3.6% reported two STDs in the past. Fifty-six patients (42.4%) had developed AIDS. Thirteen had passed away. The main mode of transmission of HIV infection in this population is through heterosexual intercourse and the prevalence of STDs is high. These findings indicate a need to advocate responsible sexual behaviour and to detect as well as treat STDs early to prevent the sexual transmission of HIV.
Directory of Open Access Journals (Sweden)
Ageliki Gerovassili
2017-03-01
Full Text Available One hundred and seventy two men at the State of Thessaly, Greece, inquiring semen analysis were enrolled in the study in order to investigate the incidence of Chlamydia, Ureaplasma and Mycoplasma (C-U-M genera in respect to total sperm number (TSN, progressive motility (grades a and b and total motility (grades a, b and c. Putative relation of C-U-M acquirement with sexual behavior was also investigated. Incidence of C-U-M among non-oligozoospermic and oligozoospermic men was similar. Νο correlation of C-U-M carriage to either oligozoospermia or asthenozoospermia was found. The tested semen parameters were negatively correlated to the age of sexual intercourse initiation and positively correlated to the number of sex partners. Early age of sexual intercourse initiation or high number of sexual partners was not statistical significantly correlated to C-U-M acquirement. Overall, TSN and motility (either progressive or total were not influenced by the presence of C-U-M genera in a sample of Greek population undergoing semen evaluation. To distinguish the role of C-U-M in male infertility and clarify the so far controversial scarce literature, large control case studies are needed using nucleic acid amplification techniques to detect these pathogens.
Xia, Maosheng; Yang, Li; Sun, Guangfeng; Qi, Shuang; Li, Baoman
2017-02-01
Many studies have indicated that a history of depression increases the risk of developing Alzheimer's disease (AD); however, the potential pathogenestic mechanism by which depression functions as a high risk factor for AD remains unknown. Recently, a "cerebral lymphatic system" referred to as "glymphatic system" has been demonstrated to be responsible for neuronal extracellular waste protein clearance via a paravascular pathway. However, the function of glymphatic pathway has not been determined in depressive disorders. The present study used an animal model of chronic unpredictable mild stress (CUMS) to determine the function of glymphatic pathway by using fluorescence tracers. Immunohistochemistry was used to assess the accumulation of endogenous mouse and exogenous human amyloid beta 42 (Aβ42) in CUMS-treated mice with or without treatment with antidepressant fluoxetine. Glymphatic pathway circulation was impaired in mice treated with CUMS; moreover, glymphatic pathway dysfunction suppressed Aβ42 metabolism, because the accumulation of endogenous and exogenous Aβ42 was increased in the brains of the CUMS-treated mice. However, treatment with fluoxetine reversed these destructive effects of CUMS on glymphatic system. In anhedonic mice, the expression of the water channel aquaporin 4 (AQP4), a factor in glymphatic pathway dysfunction, was down-regulated in cortex and hippocampus. The dysfunction of glymphatic system suggested why a history of depression may be a strong risk factor for AD in anhedonic mice. We hope our study will contribute to an understanding of the risk mechanism of depressive disorder in the development of AD and the mechanisms of antidepressant therapies in AD.
Predictive Value of Cumulative Blood Pressure for All-Cause Mortality and Cardiovascular Events
Wang, Yan Xiu; Song, Lu; Xing, Ai Jun; Gao, Ming; Zhao, Hai Yan; Li, Chun Hui; Zhao, Hua Ling; Chen, Shuo Hua; Lu, Cheng Zhi; Wu, Shou Ling
2017-02-01
The predictive value of cumulative blood pressure (BP) on all-cause mortality and cardiovascular and cerebrovascular events (CCE) has hardly been studied. In this prospective cohort study including 52,385 participants from the Kailuan Group who attended three medical examinations and without CCE, the impact of cumulative systolic BP (cumSBP) and cumulative diastolic BP (cumDBP) on all-cause mortality and CCEs was investigated. For the study population, the mean (standard deviation) age was 48.82 (11.77) years of which 40,141 (76.6%) were male. The follow-up for all-cause mortality and CCEs was 3.96 (0.48) and 2.98 (0.41) years, respectively. Multivariate Cox proportional hazards regression analysis showed that for every 10 mm Hg·year increase in cumSBP and 5 mm Hg·year increase in cumDBP, the hazard ratio for all-cause mortality were 1.013 (1.006, 1.021) and 1.012 (1.006, 1.018); for CCEs, 1.018 (1.010, 1.027) and 1.017 (1.010, 1.024); for stroke, 1.021 (1.011, 1.031) and 1.018 (1.010, 1.026); and for MI, 1.013 (0.996, 1.030) and 1.015 (1.000, 1.029). Using natural spline function analysis, cumSBP and cumDBP showed a J-curve relationship with CCEs; and a U-curve relationship with stroke (ischemic stroke and hemorrhagic stroke). Therefore, increases in cumSBP and cumDBP were predictive for all-cause mortality, CCEs, and stroke.
Enhanced Radiosensitization Effect of Curcumin Delivered by PVP-PCL Nanoparticle in Lung Cancer
Directory of Open Access Journals (Sweden)
Cuixia Wen
2017-01-01
Full Text Available Curcumin, the principal polyphenolic curcuminoid, has been reported in numerous studies for its antitumor effect in a series of cancers. It is also reported that curcumin possesses radiosensitization effect in some cancers. However, the poor solubility and unsatisfied bioavailability of curcumin significantly undermine its potential application. Here we prepared curcumin loaded nanoparticles by employing PVP-PCL as drug carrier. Characterization studies indicated the satisfied drug loading efficiency and a sustained in vitro release pattern. Quantification uptake study showed that the uptake efficiency of Cum-NPs by lung cancer cells was time- and dose-dependent. In vitro anticancer study demonstrated the superior cytotoxic effect of Cum-NPs with stronger apoptotic induction over free Cum. Most importantly, there is almost no report on the radiosensitization effect of curcumin loaded nanoparticles. Here, Cum-NPs led to more inhibition of the colony forming ability of A549 cells as compared to the equivalent concentration of free Cum as shown in clonogenic assay. Furthermore, Cum-NPs are much more effective in enhancing the tumor growth inhibitory effect of radiation therapy in a A549 xenograft model. Therefore, results from the current study seem to be the first report on the radiosensitization effect of Cum-NPs and paved the way for a curcumin nanodrug delivery system as a potential radiation adjuvant.
Directory of Open Access Journals (Sweden)
Hongwei Wu
2015-05-01
Full Text Available Corydalis Rhizoma, named YuanHu in China, is the dried tuber of Corydalis yanhusuo W.T. Wang which is used in Traditional Chinese Medicine for pain relief and blood activation. Previous pharmacological studies showed that apart from analgesics, the alkaloids from YuanHu may be useful in the therapy of depression by acting on the GABA, dopamine and benzodiazepine receptors. In this study, the antidepressive effect of the total alkaloid of YuanHu (YHTA was investigated in a chronic unpredictable mild stress (CUMS rat model using 1H-NMR-based metabonomics. Plasma metabolic profiles were analyzed and multivariate data analysis was applied to discover the metabolic biomarkers in CUMS rats. Thirteen biomarkers of CUMS-introduced depression were identified, which are myo-inositol, glycerol, glycine, creatine, glutamine, glutamate, β-glucose, α-glucose, acetoacetate, 3-hydroxybutyrate, leucine and unsaturated lipids (L7, L9. Moreover, a metabolic network of the potential biomarkers in plasma perturbed by CUMS was detected. After YHTA treatment, clear separation between the model group and YHTA-treated group was achieved. The levels of all the abnormal metabolites mentioned above showed a tendency of restoration to normal levels. The results demonstrated the therapeutic efficacy of YHTA against depression and suggested that NMR-based metabolomics can provide a simple and easy tool for the evaluation of herbal therapeutics.
Journal of Genetics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Keywords. cytosine methylation; DNA methylation mechanisms; DNA demethylation mechanisms; Darwinian-cum-Lamarckian evolution; epialleles; epigenetic modifications; genetic recombination; heritable induced defence; mutational hotspots; transgenerational inheritance.
Directory of Open Access Journals (Sweden)
Catharine Bomhold
2018-01-01
Full Text Available A Review of: Cummings, J., Merrill, A., & Borrelli, S. (2010. The use of handheld mobile devices: Their impact and implications for library services. Library Hi Tech, (281, 22-40. https://doi.org/10.1108/07378831011026670 Abstract Objective – The authors undertook this study to understand the relatively new phenomenon of handheld computing and the use of small-screen devices among academic library users. They sought to determine if users would be inclined to search the online library catalogue on their devices and, by extension, if there would be a growing demand for small-screen compatible library services. Design – Online and paper surveys were used with both closed and open questions. Respondents included students, faculty, and staff at Washington State University (WSU. Setting – Washington State University Library, Pullman, Washington, United States of America. Subjects – The survey was open to any user of the Washington State University (Pullman Library. The 206 respondents included 126 (61.2% undergraduates, 26 (12.6% graduate or professional students, 32 (15.3% WSU employees, and 15 (7.3% faculty members. Methods – A survey was distributed both online and on paper. The online version used Surveymonkey.com and participation was solicited through various social media. It was open for three months during the Spring semester, 2007. The paper version was distributed to all library users on two days in June 2007. Eighty-four online and 122 paper responses were received. Main Results – Most of the respondents (58.4% who owned a personal digital assistant (PDA or Web-enabled cell phone (WECP indicated that they would search the library catalogue on a small-screen device. Responses to the open question “How would you use the OPAC [online public access catalogue] if it was available on a PDA or WECP?” were mixed, both positive and negative. The positive responders noted the possible time savings associated with the availability of
Some remarks on ‘superradiant’ phase transitions in light-matter systems
International Nuclear Information System (INIS)
Larson, Jonas; Irish, Elinor K
2017-01-01
In this paper we analyze properties of the phase transition that appears in a set of quantum optical models; Dicke, Tavis–Cummings, quantum Rabi, and finally the Jaynes–Cummings model. As the light-matter coupling is increased into the deep strong coupling regime, the ground state turns from vacuum to become a superradiant state characterized by both atomic and photonic excitations. It is pointed out that all four transitions are of the mean-field type, that quantum fluctuations are negligible, and hence these fluctuations cannot be responsible for the corresponding vacuum instability. In this respect, these are not quantum phase transitions. In the case of the Tavis–Cummings and Jaynes–Cummings models, the continuous symmetry of these models implies that quantum fluctuations are not only negligible, but strictly zero. However, all models possess a non-analyticity in the ground state in agreement with a continuous quantum phase transition. As such, it is a matter of taste whether the transitions should be termed quantum or not. In addition, we also consider the modifications of the transitions when photon losses are present. For the Dicke and Rabi models these non-equilibrium steady states remain critical, while the criticality for the open Tavis–Cummings and Jaynes–Cummings models is completely lost, i.e. in realistic settings one cannot expect a true critical behaviour for the two last models. (paper)
Perez, E A; Scudder, S A; Meyers, F A; Tanaka, M S; Paradise, C; Gandara, D R
1991-02-01
Twenty-nine patients with biopsy-confirmed metastatic melanoma (17) or metastatic renal cell carcinoma (12) were treated with escalating doses or recombinant human interleukin-2 (IL-2) administered as weekly 24-h intravenous infusions. Patients received from 3 to 12 x 10(6) C.U./m2 (18-72 x 10(6) I.U./m2) weekly over a treatment period of 1 to 16 weeks, with a median of eight weekly cycles administered. Patients in all treatment groups experienced non-life-threatening systemic side effects consisting of fever, nausea, vomiting, fluid retention, and diarrhea. Grade III hypotension was seen in four of six patients (67%) at 12 x 10(6) C.U./m2, and represented the dose-limiting toxicity. Grade IV hypotension occurred in 1 of 14 patients at 6 x 10(6) C.U./m2; no other grade IV toxicities were observed. Grade III fever occurred in 3 of 11 patients (27%) treated at 3 x 10(6) C.U./m2, 3 of 14 patients (21%) at 6 x 10(6) C.U./m2, and 3 of 6 patients (50%) at 9 x 10(6) C.U./m2. An objective response was observed in 3 of 28 evaluable patients (10%): 1 complete response and 1 partial response in renal cell cancer, and 1 partial response in a melanoma patient. We conclude that for future studies, the recommended dose of IL-2 given as a weekly 24-h infusion is 9 x 10(6) C.U./m2 and that a low rate of objective tumor response can be obtained in patients with melanoma and renal cell carcinoma using this regimen.
Sweeney, Michael O; Ellenbogen, Kenneth A; Casavant, David; Betzold, Robert; Sheldon, Todd; Tang, Feng; Mueller, Megan; Lingle, John
2005-08-01
Ventricular desynchronization caused by right ventricular pacing may impair ventricular function and increase risk of heart failure (CHF), atrial fibrillation (AF), and death. Conventional DDD/R mode often results in high cumulative percentage ventricular pacing (Cum%VP). We hypothesized that a new managed ventricular pacing mode (MVP) would safely provide AAI/R pacing with ventricular monitoring and DDD/R during AV block (AVB) and reduce Cum%VP compared to DDD/R. MVP RAMware was downloaded in 181 patients with Marquis DR ICDs. Patients were initially randomized to either MVP or DDD/R for 1 month, then crossed over to the opposite mode for 1 month. ICD diagnostics were analyzed for cumulative percentage atrial pacing (Cum%AP), Cum%VP, and duration of DDD/R pacing for spontaneous AVB. Baseline characteristics included age 66 +/- 12 years, EF 36 +/- 14%, and NYHA Class II-III 36%. Baseline PR interval was 190 +/- 53 msec and programmed AV intervals (DDD/R) were 216 +/- 50 (paced)/189 +/- 53 (sensed) msec. Mean Cum%VP was significantly lower in MVP versus DDD/R (4.1 +/- 16.3 vs 73.8 +/- 32.5, P MVP were 85.0 and 99.9, respectively. Mean Cum%AP was not different between MVP versus DDD/R (48.7 +/- 38.5 vs 47.3 +/- 38.4, P = 0.83). During MVP overall time spent in AAI/R was 89.6% (intrinsic conduction), DDD/R 6.7% (intermittent AVB), and DDI/R 3.7% (AF). No adverse events were attributed to MVP. MVP safely achieves functional atrial pacing by limiting ventricular pacing to periods of intermittent AVB and AF in ICD patients, significantly reducing Cum%VP compared to DDD/R. MVP is a universal pacing mode that adapts to AVB and AF, providing both atrial pacing and ventricular pacing support when needed.
Acoustic Neuroma Educational Video
Full Text Available ... Cumming, GA 30041 770-205-8211 info@ANAUSA.org The world’s #1 acoustic neuroma resource Click to ... Cumming, GA 30041 770-205-8211 info@ANAUSA.org About ANA Mission, Vision & Values Leadership & Staff Annual ...
Jin, Peng; Yu, Hai-Ling; Tian-Lan; Zhang, Feng; Quan, Zhe-Shan
2015-06-01
Oleoylethanolamide (OEA) is an endocannabinoid analog that belongs to a family of endogenous acylethanolamides. Increasing evidence suggests that OEA may act as an endogenous neuroprotective factor and participate in the control of mental disorder-related behaviors. In this study, we examined whether OEA is effective against depression and investigated the role of circulating endogenous acylethanolamides during stress. Mice were subjected to 28days of chronic unpredictable mild stress (CUMS), and during the last 21days, treated with oral OEA (1.5-6mg/kg) or 6mg/kg fluoxetine. Sucrose preference and open field test activity were used to evaluate depression-like behaviors during CUMS and after OEA treatment. Weights of the prefrontal cortex and hippocampus were determined, and the adrenal index was measured. Furthermore, changes in serum adrenocorticotropic hormone (ACTH), corticosterone (CORT) and total antioxidant capacity (T-AOC), brain-derived neurotrophic factor (BDNF), and lipid peroxidation product malondialdehyde (MDA) levels, and superoxide dismutase (SOD) activities in the hippocampus and prefrontal cortex were detected. Our findings indicate that OEA normalized sucrose preferences, locomotion distances, rearing frequencies, prefrontal cortex and hippocampal atrophy, and adrenal indices. In addition, OEA reversed the abnormalities of BDNF and MDA levels and SOD activities in the hippocampus and prefrontal cortex, as well as changes in serum levels of ACTH, CORT, and T-AOC. The antidepressant effects of OEA may be related to the regulation of BDNF levels in the hippocampus and prefrontal cortex, antioxidant defenses, and normalizing hyperactivity in the hypothalamic-pituitary-adrenal axis (HPA). Copyright © 2015 Elsevier Inc. All rights reserved.
Spasojevic, Natasa; Jovanovic, Predrag; Dronjak, Sladjana
2015-03-01
We have recently shown that chronic fluoxetine treatment acted significantly increasing plasma norepinephrine and epinephrine concentrations both in control and chronically stressed adult male rats. However, possible effects of fluoxetine on catecholamine synthesis and re-uptake in adrenal medulla have been largely unknown. In the present study the effects of chronic fluoxetine treatment on tyrosine hydroxylase, a rate-limiting enzyme in catecholamine synthesis, as well as a norepinephrine transporter and vesicular monoamine transporter 2 gene expressions in adrenal medulla of animals exposed to chronic unpredictable mild stress (CUMS) for 4 weeks, were investigated. Gene expression analyses were performed using a real-time quantitative reverse transcription-PCR. Chronically stressed animals had increased tyrosine hydroxylase mRNA levels and decreased expression of both transporters. Fluoxetine increased tyrosine hydroxylase and decreased norepinephrine transporter gene expression in both unstressed and CUMS rats. These findings suggest that chronic fluoxetine treatment increased plasma catecholamine levels by affecting opposing changes in catecholamine synthesis and uptake.
Directory of Open Access Journals (Sweden)
NATASA SPASOJEVIC
2015-03-01
Full Text Available We have recently shown that chronic fluoxetine treatment acted significantly increasing plasma norepinephrine and epinephrine concentrations both in control and chronically stressed adult male rats. However, possible effects of fluoxetine on catecholamine synthesis and re-uptake in adrenal medulla have been largely unknown. In the present study the effects of chronic fluoxetine treatment on tyrosine hydroxylase, a rate-limiting enzyme in catecholamine synthesis, as well as a norepinephrine transporter and vesicular monoamine transporter 2 gene expressions in adrenal medulla of animals exposed to chronic unpredictable mild stress (CUMS for 4 weeks, were investigated. Gene expression analyses were performed using a real-time quantitative reverse transcription-PCR. Chronically stressed animals had increased tyrosine hydroxylase mRNA levels and decreased expression of both transporters. Fluoxetine increased tyrosine hydroxylase and decreased norepinephrine transporter gene expression in both unstressed and CUMS rats. These findings suggest that chronic fluoxetine treatment increased plasma catecholamine levels by affecting opposing changes in catecholamine synthesis and uptake.
Xing, Hang; Zhang, Kuo; Zhang, Ruowen; Shi, Huiyan; Bi, Kaishun; Chen, Xiaohui
2015-12-01
Water extract of the fixed combination of Gardenia jasminoides Ellis fruit, Citrus aurantium L. fruit and Magnolia officinalis Rehd. et Wils. bark, traditional name - Zhi-Zi-Hou-Po (ZZHPD) is used for treatment of depressive-like symptoms in traditional Chinese medicine for centuries. The present study aimed to explore antidepressant-like effects and potential mechanisms of ZZHPD in a rat model of chronic unpredictable mild stress (CUMS). Antidepressant-like effects of ZZHPD were investigated through behavioral tests, and potential mechanism was assessed by neuroendocrine system, neurotrophin and hippocampal neurogenesis. Antidepressant-like effects of ZZHPD (3.66, 7.32 and 14.64 g/kg/day) were estimated through coat state test, sucrose preference test, forced swimming test and open-field test. Effects of ZZHPD on hypothalamic-pituitary-adrenal (HPA) axis were evaluated by hormones measurement and dexamethasone suppression test. In addition, the expression of brain-derived neurotrophic factor (BDNF) in hippocampus was measured, as well as hippocampal neurogenesis was investigated by doublecortin (DCX) and 5-bromo-2-deoxyuridine/neuronal nuclei (BrdU/NeuN). The results demonstrated that ZZHPD significantly reversed the depressive-like behaviors, normalized the levels of adrenocorticotropic hormone (ACTH) and corticosterone (CORT), restored the negative feedback loop of HPA axis and improved the levels of BDNF, DCX and BrdU/NeuN compared with those in CUMS-induced rats. The above results revealed that ZZHPD exerted antidepressant-like effects possibly by normalizing HPA axis function, increasing expression of BDNF in hippocampus and promoting hippocampal neurogenesis. Copyright © 2015 Elsevier GmbH. All rights reserved.
Fluoxetine regulates mTOR signalling in a region-dependent manner in depression-like mice
Liu, Xiao-Long; Luo, Liu; Mu, Rong-Hao; Liu, Bin-Bin; Geng, Di; Liu, Qing; Yi, Li-Tao
2015-01-01
Previous studies have demonstrated that the mammalian target of rapamycin (mTOR) signaling pathway has an important role in ketamine-induced, rapid antidepressant effects despite the acute administration of fluoxetine not affecting mTOR phosphorylation in the brain. However, the effects of long-term fluoxetine treatment on mTOR modulation have not been assessed to date. In the present study, we examined whether fluoxetine, a type of commonly used antidepressant agent, alters mTOR signaling following chronic administration in different brain regions, including the frontal cortex, hippocampus, amygdala and hypothalamus. We also investigated whether fluoxetine enhanced synaptic protein levels in these regions via the activation of the mTOR signaling pathway and its downstream regulators, p70S6K and 4E-BP-1. The results indicated that chronic fluoxetine treatment attenuated the chronic, unpredictable, mild stress (CUMS)-induced mTOR phosphorylation reduction in the hippocampus and amygdala of mice but not in the frontal cortex or the hypothalamus. Moreover, the CUMS-decreased PSD-95 and synapsin I levels were reversed by fluoxetine, and these effects were blocked by rapamycin only in the hippocampus. In conclusion, our findings suggest that chronic treatment with fluoxetine can induce synaptic protein expression by activating the mTOR signaling pathway in a region-dependent manner and mainly in the hippocampus. PMID:26522512
Dendritic Spines in Depression: What We Learned from Animal Models
Qiao, Hui; Li, Ming-Xing; Xu, Chang; Chen, Hui-Bin; An, Shu-Cheng; Ma, Xin-Ming
2016-01-01
Depression, a severe psychiatric disorder, has been studied for decades, but the underlying mechanisms still remain largely unknown. Depression is closely associated with alterations in dendritic spine morphology and spine density. Therefore, understanding dendritic spines is vital for uncovering the mechanisms underlying depression. Several chronic stress models, including chronic restraint stress (CRS), chronic unpredictable mild stress (CUMS), and chronic social defeat stress (CSDS), have ...
Microstructure and phase transformation on milled and unmilled Ti induced by water quenching
CSIR Research Space (South Africa)
Bolokang, AS
2014-10-01
Full Text Available Materials Letters Vol. 132 Microstructure and phase transformation on milled and unmilled Ti induced by water quenching A.S.Bolokang a,b,n, M.J.Phasha c, D.E.Motaung b, F.R.Cummings a,d, T.F.G.Muller a, C.J.Arendse a a Department of...Physics,UniversityoftheWesternCape,PrivateBagx17,Bellville7535,SouthAfrica bDST/CSIR Nanotechnology InnovationCentre ,National Centre for Nano-Structured Materials, Council for Scientific and Industrial Research, P.O.Box395, Pretoria 0001, SouthAfrica c Transnet Engineering, Product...
An Analytical Study on Evaluating the Performance of Developed ...
African Journals Online (AJOL)
cum-seed drill was 0.46 with CV of 1.8 % and that for conventional seed drill was 0.41 and 1.5 % respectively.The effective field capacity of the cultivator-cum seed drill was 0.537 ha/h with field efficiency of 82.8 % as compared to conventional ...
Institution's Title and Shibboleth: A Construct of Grammatical Relationship in Advertising Plates
Dalamu, Taofeek
2017-01-01
Institutions are known through the names-cum-titles shown on their signboards, internet websites, letterheads, etc. However, it seems that such cultures could not satisfy the yearning of most organizations. So, they further propagate their core values and traits by constructing short linguistic bursts-cum-contents that can expatiate on what the…
2006-06-16
whale that caused the ship to sink, forcing Marion and three others to take refuge in one of the lifeboats (Cummings 2005, 1). He spent a week on...disorder (2004, 4). The post-traumatic stress disorder then often spurs other addictive behaviors, increasing the inability to regain normalcy among
Human-Centered Command and Control of Future Autonomous Systems
2013-06-01
introduce challenges with situation awareness, automation reliance, and accountability (Bainbridge, 1983). If not carefully designed and integrated...into users’ tasks, automation’s costs can quickly outweigh its benefits. A tempting solution to compensate for inherent human cognitive limitations is... Drury & Scott, 2008; Nehme, Scott, Cummings, & Furusho, 2006; Scott & Cummings, 2006). However, there have not been detailed prescriptive task
Dong, Huina; Chen, Deliang; Wang, Kai; Zhang, Rui
2016-09-01
Cost-effective and scalable preparation of two-dimensional (2D) molybdenum disulfide (MoS2) has been the bottleneck that limits their applications. This paper reports a novel coupled ultrasonication-milling (CUM) process to exfoliate natural molybdenite powders to achieve few-layer MoS2 (FL-MoS2) nanosheets in the solvent of N-methyl-2-pyrrolidone (NMP) with polyvinylpyrrolidone (PVP) molecules. The synergistic effect of ultrasonication and sand milling highly enhanced the exfoliation efficiency, and the precursor of natural molybdenite powders minimizes the synthetic cost of FL-MoS2 nanosheets. The exfoliation of natural molybdenite powders was conducted in a home-made CUM system, mainly consisting of an ultrasonic cell disruptor and a ceramic sand mill. The samples were characterized by X-ray diffraction, UV-vis spectra, Raman spectra, FT-IR, SEM, TEM, AFM, and N2 adsorption-desorption. The factors that influence the exfoliation in the CUM process, including the initial concentration of natural molybdenite powders ( C in, 15-55 g L-1), ultrasonic power ( P u, 200-350 W), rotation speed of sand mill ( ω s, 1500-2250 r.p.m), exfoliation time ( t ex, 0.5-6 h), and the molar ratio of PVP unit to MoS2 ( R pm, 0-1), were systematically investigated. Under the optimal CUM conditions (i.e., C in = 45 g L-1, P u = 280 W, ω s = 2250 r.p.m and R pm = 0.5), the yield at t ex = 6 h reaches 21.6 %, and the corresponding exfoliation rate is as high as 1.42 g L-1 h-1. The exfoliation efficiency of the CUM mode is much higher than that of either the ultrasonication (U) mode or the milling (M) mode. The synergistic mechanism and influencing rules of the CUM process in exfoliating natural molybdenite powders were elaborated. The as-obtained FL-MoS2 nanosheets have a high specific surface area of 924 m2 g-1 and show highly enhanced electrocatalytic performance in hydrogen evolution reaction and good electrochemical sensing property in detecting ascorbic acid. The CUM process
The alternative sigma factor sigmaB and the stress response of Bacillus cereus
Schaik, van W.
2005-01-01
cum laude graduation (with distinction) The bacterium Bacillus cereus is responsible for a large number of cases of foodborne illness across the world. It is also an important cause of spoilage of food, in particular of milk and dairy-products. The growth and survival of B. cereus in food or during
Kurhe, Yeshwant; Radhakrishnan, Mahesh; Gupta, Deepali
2014-09-01
The aim of the present work was to investigate the role of ondansetron on the high fat diet (HFD) induced obese mice for behavioral and biochemical alterations using chronic unpredictable mild stress (CUMS) model of depression. Animals were fed with high fat diet for 14 weeks and subjected to different stress procedures for 4 weeks. Treatment with ondansetron was started on day 15. After day 28 behavioral assays and biochemical estimations were performed. Behavioral paradigms viz. sucrose preference test, locomotor score, forced swim test (FST) and elevated plus maze (EPM), whereas biochemical parameters like plasma glucose, total cholesterol, triglycerides and total proteins were estimated. Results examines that in behavioral assays, ondansetron significantly (P glucose, total cholesterol, triglycerides and total proteins were significantly (P glucose level indicates that, it could be "altered glucose level" playing an important role in depression co-morbid with obesity. Ondansetron through allosteric modulation of serotonergic system elevates the serotonin level and thereby regulates the insulin secretion and hence, reversing the "altered glucose level", could be the possible antidepressive-like mechanism against depression co-morbid with obesity.
Cumming, Royce T; Leong, Jing V; Lohman, David J
2017-12-17
Examination of unidentified Phylliidae specimens revealed a number of undescribed species from the island of Luzon, Philippines. Morphological and molecular study of specimens from the obscure phasmid genus Microphyllium Zompro, 2001, revealed a new species, which we describe as Microphyllium haskelli Cumming sp. nov.. It is here described and differentiated from the two other species in the genus, both currently only known from adults of a single sex. Pseudomicrophyllium Cumming gen. nov. is described as a new genus within Phylliidae with the type species Pseudomicrophyllium faulkneri Cumming gen. et sp. nov. as the sole known species in the genus. As is unfortunately often the case in the leaf-mimicking family Phylliidae, this new genus and species is only known from a single specimen. In addition to the new genus, two new Phyllium (Phyllium) species from the siccifolium species-group are named and described as Ph. (Ph.) antonkozlovi Cumming sp. nov. and Ph. (Ph.) bourquei Cumming Le Tirant sp. nov.. In addition to the newly described species, Phyllium (Phyllium) geryon Gray, 1843 is redescribed from a nearly perfect specimen, completing some of the morphological knowledge gaps currently missing because of the severely damaged holotype specimen. A key to all known species of Phylliidae from Luzon is included. Holotype specimens for all four new species will be deposited in the National Museum of the Philippines type collection and paratype specimens will be deposited into the San Diego Natural History Museum collection or retained within the first author's collection.
Thy-1+ dendritic cells in murine epidermis are bone marrow-derived
International Nuclear Information System (INIS)
Breathnach, S.M.; Katz, S.I.
1984-01-01
Thy-1+, Ly-5+ dendritic cells have recently been described as a resident cell population in murine epidermis, but their ontogeny and function are unknown. The origin and turnover of epidermal Thy-1+ cells utilizing chimeric mice were investigated. Lethally x-irradiated AKR/J (Thy-1.1+) and AKR/Cum (Thy-1.2+) mice were reconstituted with allogeneic bone marrow cells with or without thymocytes from congenic AKR/Cum or AKR/J mice, respectively. The density of residual indigenous Thy-1.1+ cells in AKR/J chimeras and Thy-1.2+ cells in AKR/Cum chimeras was substantially reduced following x-irradiation, as determined by immunofluorescence staining of epidermal sheets. Epidermal repopulation by allogeneic Thy-1+ dendritic epidermal cells was first observed at 5 weeks in AKR/J chimeras and at 7 weeks in AKR/Cum chimeras and progressed slowly. Repopulation was not enhanced by increasing the number of allogeneic bone marrow cells injected from 2 X 10(7) to 10(8) cells or by the addition of 8 X 10(7) allogeneic thymocytes to the donor inoculate. Epidermal repopulation by allogeneic Thy-1.2+ cells was not seen in AKR/J mice reconstituted with syngeneic bone marrow cells and allogeneic Thy-1.2+ AKR/Cum thymocytes. Taken together, these results indicate that Thy-1+ dendritic epidermal cells are derived from the bone marrow and suggest that they are not related to conventional peripheral T-lymphocytes
Li, Qing; Qu, Fa-Lin; Gao, Yue; Jiang, Yi-Ping; Rahman, Khalid; Lee, Kuo-Hsiung; Han, Ting; Qin, Lu-Ping
2017-03-06
There are many plants of genus Piper which have been reported to induce antidepressant-like effects, Piper sarmentosum (PS) is one of them. PS is a Chinese herbal medicine and a traditional edible vegetable. In the present study, the antidepressant-like effects of PS extracts and the ethyl acetate fraction of PS extracts (PSY) were assessed using the open field test (OFT), forced swimming test (FST), and tail suspension test (TST) in mice. Furthermore, we applied a 4 consecutive weeks of chronic unpredictable mild stress (CUMS) as a model of depression in rats, followed by a sucrose preference test. Then we examined the possible mechanisms of this action. The activity of the hypothalamic-pituitary-adrenal (HPA) axis was evaluated by detecting the serum corticosterone (CORT) concentrations, and the protein expression levels of brain-derived neurotrophic factor (BDNF), the phosphorylated form CREB and ERK1/2 were detected by qRT-PCR or Western blot. The results showed that PS extracts (100, 200mg/kg) and PSY (12.5, 25, 50mg/kg) treatment produced antidepressant-like effects in mice similar to fluoxetine (20mg/kg), indicated by the reduced immobility time in the FST and TST, while both had no influence on the locomotor activity in the OFT. PSY treatment significantly increased sucrose preference and reduced serum CORT levels in CUMS rats. Moreover, PSY up-regulated BDNF protein levels, and increased CREB and ERK phosphorylation levels in the hippocampus on CUMS rats. These findings suggest that the antidepressant-like effects of PS extracts and PSY are mediated, at least in part, by modulating HPA axis, BDNF, CREB and ERK phosphorylation and expression in the hippocampus. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.
Spin-orbit-induced strong coupling of a single spin to a nanomechanical resonator
DEFF Research Database (Denmark)
Pályi, András; Struck, P R; Rudner, Mark
2012-01-01
as a realization of the Jaynes-Cummings model of quantum electrodynamics in the strong-coupling regime. A quantized flexural mode of the suspended tube plays the role of the optical mode and we identify two distinct two-level subspaces, at small and large magnetic field, which can be used as qubits in this setup......We theoretically investigate the deflection-induced coupling of an electron spin to vibrational motion due to spin-orbit coupling in suspended carbon nanotube quantum dots. Our estimates indicate that, with current capabilities, a quantum dot with an odd number of electrons can serve...
Development of sparse-seeded mutant kinnow (Citrus reticulata ...
African Journals Online (AJOL)
... crops like citrus, induced mutation for seedlessness in Kinnow with gamma irradiation of dormant bud which was attempted at the Nuclear Institute for Agriculture and Biology (NIAB), Faisalabad. Dormant bud irradiation-cum-grafting technique was employed, using the Citrus jambhiri rootstock for propagation of the scion.
Directory of Open Access Journals (Sweden)
W. Eschenbach
2013-02-01
Full Text Available Knowledge about the spatial variability of denitrification rates and the lifetime of denitrification in nitrate-contaminated aquifers is crucial to predict the development of groundwater quality. Therefore, regression models were derived to estimate the measured cumulative denitrification of aquifer sediments after one year of incubation from initial denitrification rates and several sediment parameters, namely total sulphur, total organic carbon, extractable sulphate, extractable dissolved organic carbon, hot water soluble organic carbon and potassium permanganate labile organic carbon.
For this purpose, we incubated aquifer material from two sandy Pleistocene aquifers in Northern Germany under anaerobic conditions in the laboratory using the 15N tracer technique. The measured amount of denitrification ranged from 0.19 to 56.2 mg N kg−1 yr−1. The laboratory incubations exhibited high differences between non-sulphidic and sulphidic aquifer material in both aquifers with respect to all investigated sediment parameters. Denitrification rates and the estimated lifetime of denitrification were higher in the sulphidic samples. For these samples, the cumulative denitrification measured during one year of incubation (Dcum(365 exhibited distinct linear regressions with the stock of reduced compounds in the investigated aquifer samples. Dcum(365 was predictable from sediment variables within a range of uncertainty of 0.5 to 2 (calculated Dcum(365/measured Dcum(365 for aquifer material with a Dcum(365 > 20 mg N kg−1 yr−1. Predictions were poor for samples with lower Dcum(365, such as samples from the NO3− bearing groundwater zone, which includes the non-sulphidic samples, from the upper part of both aquifers where denitrification is not sufficient to
The South Carolina Collaborative Undergraduate HBCU Student Summer Training Program
2016-02-01
found that lack of exercise and high fat and sugar filled diets aid greatly to the aid of AGE pools. Foods containing abundant AGE’s promote... Smoking & Cancer Michael Cummings, PhD July 11 (D) Periodontal Disease – BSB 451 Keith Kirkwood, DDS,PhD July 12 (D) Oral Pharyngeal Cancer – BSB...Materials – ROOM BSB 252 Joe Vuthiganon, DMD July 10 (C) Smoking & Cancer Michael Cummings, PhD July 10 (D) Periodontal Disease – BSB 252
The Impacts of Heating Strategy on Soil Moisture Estimation Using Actively Heated Fiber Optics.
Dong, Jianzhi; Agliata, Rosa; Steele-Dunne, Susan; Hoes, Olivier; Bogaard, Thom; Greco, Roberto; van de Giesen, Nick
2017-09-13
Several recent studies have highlighted the potential of Actively Heated Fiber Optics (AHFO) for high resolution soil moisture mapping. In AHFO, the soil moisture can be calculated from the cumulative temperature ( T cum ), the maximum temperature ( T max ), or the soil thermal conductivity determined from the cooling phase after heating ( λ ). This study investigates the performance of the T cum , T max and λ methods for different heating strategies, i.e., differences in the duration and input power of the applied heat pulse. The aim is to compare the three approaches and to determine which is best suited to field applications where the power supply is limited. Results show that increasing the input power of the heat pulses makes it easier to differentiate between dry and wet soil conditions, which leads to an improved accuracy. Results suggest that if the power supply is limited, the heating strength is insufficient for the λ method to yield accurate estimates. Generally, the T cum and T max methods have similar accuracy. If the input power is limited, increasing the heat pulse duration can improve the accuracy of the AHFO method for both of these techniques. In particular, extending the heating duration can significantly increase the sensitivity of T cum to soil moisture. Hence, the T cum method is recommended when the input power is limited. Finally, results also show that up to 50% of the cable temperature change during the heat pulse can be attributed to soil background temperature, i.e., soil temperature changed by the net solar radiation. A method is proposed to correct this background temperature change. Without correction, soil moisture information can be completely masked by the background temperature error.
Classical-driving-assisted entanglement dynamics control
Energy Technology Data Exchange (ETDEWEB)
Zhang, Ying-Jie, E-mail: yingjiezhang@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Han, Wei [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Xia, Yun-Jie, E-mail: yjxia@qfnu.edu.cn [Shandong Provincial Key Laboratory of Laser Polarization and Information Technology, Department of Physics, Qufu Normal University, Qufu 273165 (China); Fan, Heng, E-mail: hfan@iphy.ac.cn [Beijing National Laboratory of Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing, 100190 (China); Collaborative Innovation Center of Quantum Matter, Beijing, 100190 (China)
2017-04-15
We propose a scheme of controlling entanglement dynamics of a quantum system by applying the external classical driving field for two atoms separately located in a single-mode photon cavity. It is shown that, with a judicious choice of the classical-driving strength and the atom–photon detuning, the effective atom–photon interaction Hamiltonian can be switched from Jaynes–Cummings model to anti-Jaynes–Cummings model. By tuning the controllable atom–photon interaction induced by the classical field, we illustrate that the evolution trajectory of the Bell-like entanglement states can be manipulated from entanglement-sudden-death to no-entanglement-sudden-death, from no-entanglement-invariant to entanglement-invariant. Furthermore, the robustness of the initial Bell-like entanglement can be improved by the classical driving field in the leaky cavities. This classical-driving-assisted architecture can be easily extensible to multi-atom quantum system for scalability.
DEFF Research Database (Denmark)
Schmidt, Johannes Dragsbæk
2012-01-01
The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models of contemporary capitalism – the discredited Anglo-Saxon finance-driven model versus the export-driven product......The first part of the paper briefly describes the causes and impacts of the US induced financial crisis cum “Great Depression”. The second part discusses the status of the various models of contemporary capitalism – the discredited Anglo-Saxon finance-driven model versus the export......-driven production model of growth, with weak safety nets, adopted by East Asian countries in contrast to the export-oriented Nordic social welfare model. The third section documents the impact of the crisis on the economies, and discusses core examples of state intervention in the socio-economic sectors...... such as labor markets and social welfare in the Nordic as well as Korean contexts. The final section discusses some tentative conclusions about the resilience of the Nordic and ROK models and their potential for recovery....
Directory of Open Access Journals (Sweden)
Brandon M Casper
Full Text Available Juvenile Chinook salmon, Oncorhynchus tshawytscha, were exposed to simulated high intensity pile driving signals to evaluate their ability to recover from barotrauma injuries. Fish were exposed to one of two cumulative sound exposure levels for 960 pile strikes (217 or 210 dB re 1 µPa(2·s SEL(cum; single strike sound exposure levels of 187 or 180 dB re 1 µPa(2⋅s SEL(ss respectively. This was followed by an immediate assessment of injuries, or assessment 2, 5, or 10 days post-exposure. There were no observed mortalities from the pile driving sound exposure. Fish exposed to 217 dB re 1 µPa(2·s SEL(cum displayed evidence of healing from injuries as post-exposure time increased. Fish exposed to 210 dB re 1 µPa(2·s SEL(cum sustained minimal injuries that were not significantly different from control fish at days 0, 2, and 10. The exposure to 210 dB re 1 µPa(2·s SEL(cum replicated the findings in a previous study that defined this level as the threshold for onset of injury. Furthermore, these data support the hypothesis that one or two Mild injuries resulting from pile driving exposure are unlikely to affect the survival of the exposed animals, at least in a laboratory environment.
International Nuclear Information System (INIS)
Santos, Flora L.; Pabroa, Preciosa Corazon B.; Morco, Ryan P.; Racho, Joseph Michael D.
2007-01-01
In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project P articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques . Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the air
Electromagnetic pump technology
International Nuclear Information System (INIS)
Prabhakar, R.
1994-01-01
Fast Breeder Reactors have an important role to play in our nuclear power programme. Liquid metal sodium is used as the coolant for removing fission heat generated in fast reactors and a distinctive physical property of sodium is its high electrical conductivity. This enables application of electromagnetic (EM) pumps, working on same principle as electric motors, for pumping liquid sodium. Due to its lower efficiency as compared to centrifugal pumps, use of EM pumps has been restricted to reactor auxiliary circuits and experimental facilities. As part of our efforts to manufacture fast reactor components indigenously, work on the development of two types of EM pumps namely flat linear induction pump (FLIP) and annular linear induction pump (ALIP) has been undertaken. Design procedures based on an equivalent circuit approach have been established and results from testing a 5.6 x 10E-3 Cum/s (20 Cum/h) FLIP in a sodium loop were used to validate the procedure. (author). 7 refs., 6 figs
Lambuça, Ana Rita dos Santos
2014-01-01
Tese de Mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde, Núcleo de Psicologia Clínica Sistémica), 2014 É amplamente reconhecido o impato nocivo que o conflito parental tem sobre os mais diversos aspetos do ajustamento psicológico das crianças (e.g. Cummings & Davies, 2002; Cummings & Keller, 2006). Mais concretamente tipos de conflito destrutivos e hostis, caracterizados pela sua maior frequência e intensidade e fraca ou nenhuma resolução, mostram-se especialmente...
Directory of Open Access Journals (Sweden)
D. E. García
2005-01-01
Full Text Available Con el objetivo de detectar los principales grupos de fenoles en la biomasa de la morera y de-terminar el efecto del abonado (0, 100, 300 y 500 kg N/ha/año, la variedad (Cubana, Indonesia, Tigreada y Acorazonada y la época (periodo lluvioso y poco lluvioso, en el perfil polifenólico, se llevó a cabo una investigación con un diseño de bloques (al azar con arreglo factorial 4 x 4 x 2 y cinco repeticiones. Mediante el tamizaje fitoquímico se evaluó la presencia de siete grupos de compuestos, para posteriormente, determinar sus concentraciones. Únicamente se detectaron fenoles (FT, flavonoides (Flav y cumarinas (Cum, con presencia leve, notable o cuantiosa. Sólo se encontraron interacciones significativas entre los factores fertilización y variedad para los FT y las Cum (P<0,05. Los niveles máximos de FT y Cum encontrados en las hojas fueron de 2,86% MS (Tigreada abonada con 100 kg N/ha/año y 0,65% MS (Cubana e Indonesia fertilizadas con 100 kg N/ha/año, respectivamente. Las mayores concentraciones de FT y Cum en los tallos tiernos se observaron en la variedad Acorazonada con 100 kg N/ha/año (1,55% MS e Indonesia, con la aplicación de 500 kg N/ha/año (0,60% MS. En las hojas de las variedades (los contenidos de FT y Cum tendieron a disminuir con el incremento de los niveles de fertilización, a excepción de las concentraciones de FT, en la variedad Cubana. En el caso de los Flav, no se observó un efecto significativo de los factores fertilización, variedad y época. Solamente en los FT de las hojas, se observó un efecto representativo de la época a favor del PLL. Los resultados permiten concluir que las concentraciones de los FT se ven afectadas por los niveles de fertilización, la variedad y la época. Los contenidos de Cum presentan variaciones significativas entre los niveles de abonado orgánico y las variedades. Los niveles de Flav no muestran fluctuaciones cuantiosas con ninguna de las variables estudiadas.
Variability of African Farming Systems from Phenological Analysis of NDVI Time Series
Vrieling, Anton; deBeurs, K. M.; Brown, Molly E.
2011-01-01
Food security exists when people have access to sufficient, safe and nutritious food at all times to meet their dietary needs. The natural resource base is one of the many factors affecting food security. Its variability and decline creates problems for local food production. In this study we characterize for sub-Saharan Africa vegetation phenology and assess variability and trends of phenological indicators based on NDVI time series from 1982 to 2006. We focus on cumulated NDVI over the season (cumNDVI) which is a proxy for net primary productivity. Results are aggregated at the level of major farming systems, while determining also spatial variability within farming systems. High temporal variability of cumNDVI occurs in semiarid and subhumid regions. The results show a large area of positive cumNDVI trends between Senegal and South Sudan. These correspond to positive CRU rainfall trends found and relate to recovery after the 1980's droughts. We find significant negative cumNDVI trends near the south-coast of West Africa (Guinea coast) and in Tanzania. For each farming system, causes of change and variability are discussed based on available literature (Appendix A). Although food security comprises more than the local natural resource base, our results can perform an input for food security analysis by identifying zones of high variability or downward trends. Farming systems are found to be a useful level of analysis. Diversity and trends found within farming system boundaries underline that farming systems are dynamic.
Family Separation and Reunion, A Style of Life in the Military
1981-09-15
BOSS, P.G., WILSON, L.R., & LESTER, G.R. Developing family invulnera- bility to stress: coping patterns and strategies wives employ in managing family ...Jefferson Davis Highway University of Maryland Arlington VA 22202 College o’ Business and Management and Department of Psychology Dr. Larry Cummings...Smithsonian Institution 801 N. Pitt Street, Suite 120 Alexandria VA 22314 Dr. Richard Steers Graduate School of Management and Business University of Oregon
Directory of Open Access Journals (Sweden)
Pascaline Boudou-Rouquette
Full Text Available BACKGROUND: Identifying predictive biomarkers of drug response is of key importance to improve therapy management and drug selection in cancer therapy. To date, the influence of drug exposure and pharmacogenetic variants on sorafenib-induced toxicity remains poorly documented. The aim of this pharmacokinetic/pharmacodynamic (PK/PD study was to investigate the relationship between early toxicity and drug exposure or pharmacogenetic variants in unselected adult outpatients treated with single-agent sorafenib for advanced solid tumors. METHODS: Toxicity was recorded in 54 patients on days 15 and 30 after treatment initiation and sorafenib exposure was assessed in 51 patients. The influence of polymorphisms in CYP3A5, UGT1A9, ABCB1 and ABCG2 was examined in relation to sorafenib exposure and toxicity. Clinical characteristics, drug exposure and pharmacogenetic variants were tested univariately for association with toxicities. Candidate variables with p<0.1 were analyzed in a multivariate analysis. RESULTS: Gender was the sole parameter independently associated with sorafenib exposure (p = 0.0008. Multivariate analysis showed that increased cumulated sorafenib (AUC(cum was independently associated with any grade ≥ 3 toxicity (p = 0.037; UGT1A9 polymorphism (rs17868320 with grade ≥ 2 diarrhea (p = 0.015 and female gender with grade ≥ 2 hand-foot skin reaction (p = 0.018. Using ROC curve, the threshold AUC(cum value of 3,161 mg/L.h was associated with the highest risk to develop any grade ≥ 3 toxicity (p = 0.018. CONCLUSION: In this preliminary study, increased cumulated drug exposure and UGT1A9 polymorphism (rs17868320 identified patients at high risk for early sorafenib-induced severe toxicity. Further PK/PD studies on larger population are warranted to confirm these preliminary results.
Directory of Open Access Journals (Sweden)
Xiaoling Guo
2017-08-01
Full Text Available Abstract: To observe the effects of refined Xiaoyaosan (XYS on the depressive-like behaviors in rats with chronic unpredictable mild stress (CUMS, and to explore the relationship between the changes of neurosteroids and mRNA expressions of their synthesis and metabolic enzymes, and the mechanism of XYS in the treatment of depression. Methods: Eighty-four healthy male Sprague-Dawley rats were randomly divided into normal group, model group, XYS group and fluoxetine group. The latter three groups were subjected to 21 days of CUMS to prepare the stress depression model. Rats in the XYS group, and fluoxetine group were given intragastric administration with refined XYS and fluoxetine, respectively. The behavioral changes of the rats were observed after 21 days. The contents of pregnenolone (PREG, progesterone (PROG and alloprognanolone (ALLO in the plasma of rats were measured by ELISA. The levels of PREG, PROG and ALLO in the hippocampus and amygdala tissues were measured by LC-MS/MS. The mRNA expressions of 3α-hydroxysteroid dehydrogenase (3α-HSD, 3β-hydroxysteroid dehydrogenase (3β-HSD, cholesterol side-chain cleavage enzyme (P450scc and 5α-reductase (5a-R in the hippocampus and amygdala were detected by RT-qPCR methods. Results: There were changes in the model rats. The contents of PREG, PROG and ALLO changed similarly, which reflected in the decrease of PROG and ALLO, and the increase of PREG. The mRNA expression of P450scc was increased, and the mRNA expressions of 3α-HSD, 3β-HSD and 5a-R were decreased. Refined XYS could improve the behaviors of rats and the biological indicators. Conclusions: There is a neurosteroid dysfunction in the brain region of depression rat model animals, and the mechanism of refined XYS depression treatment may be related to the regulation of the control of mRNA expression of related synthesis and metabolic enzymes in the hippocampus and amygdala, further affecting the contents of neurosteroids.
Kuresepi, Salen; Vileno, Bertrand; Turek, Philippe; Lepoittevin, Jean-Pierre; Giménez-Arnau, Elena
2018-02-01
The first step in the development of skin sensitisation to a chemical, and in the elicitation of further allergic contact dermatitis (ACD), is the binding of the allergen to skin proteins after penetrating into the epidermis. The so-formed antigenic adduct is then recognised by the immune system as foreign to the body. Sensitising organic hydroperoxides derived from autoxidation of natural terpenes are believed to form antigens through radical-mediated mechanisms, although this has not yet been established. So far, in vitro investigations on reactive radical intermediates derived from these skin sensitisers have been conducted in solution, yet with experimental conditions being far away from real-life sensitisation. Herein, we report for the first time, the potential use of EPR spin-trapping to study the in situ generation of free radicals derived from cumene hydroperoxide CumOOH in a 3D reconstructed human epidermis (RHE) model, thus much closer to what may happen in vivo. Among the undesirable effects associated with dermal exposure to CumOOH, it is described to cause allergic and irritant dermatitis, being reported as a significant sensitiser. We considered exploiting the usage of spin-trap DEPMPO as an extensive view of all sort of radicals derived from CumOOH were observed all at once in solution. We showed that in the Episkin TM RHE model, both by incubating in the assay medium and by topical application, carbon radicals are mainly formed by redox reactions suggesting the key role of CumOOH-derived carbon radicals in the antigen formation process.
Energy Technology Data Exchange (ETDEWEB)
Santos, Flora L; Pabroa, Preciosa Corazon B; Morco, Ryan P; Racho, Joseph Michael D [Analytical Measurements Research Group, Philippine Nuclear Research Institute, Commonwealth Ave., Diliman, Quezon City (Philippines)
2007-07-01
In the Philippines, it has been a yearly tradition to welcome the coming of the New Year with the loudest noise as can be achieved. Firecrackers and fireworks have been a necessity for Filipinos during this time despite bans on the use of most of these and despite the Department of Health (DOH) campaign to use alternative safe practices to welcome the New Year. Data for PM 10 samples (fractionated as PM 10-2.2 or the course fraction and PM2.2 or the fine fraction) collected in four PNRI sampling sites in Metro Manila show the air pollution impacts of fireworks on New Year's Eve. Samples were collected from 1998 to 2006 using a Gent dichotomous sampler in connection with the PNRI project {sup P}articulate Matter Source Apportionment Using Nuclear and Related Analytical Techniques{sup .} Particulate mass was determined by gravimetry. Elemental analysis of the air filters was done using X-ray Fluorescence Spectrometry (X RF) or Particle induced X-ray Emission (PIXE), multielemental non-destructive nuclear analytical techniques. Black carbon was analyzed using reflectometry. PM 10 values increased by two to four times the usual averages (36.4 to 55.4 ug/cum) and in 2002 even exceeded the PNAAQ short-term guideline value of 150 ug/cum at the ADMU sampling station. PM2.2 values increased by two to six times the usual averages (15 to 28 ug/cum), even many times exceeding US EPA short-term guideline value of 65 ug/cum. The increase in the particulate mass of New Year's Day samples can be attributed more to an increase in the metal pollutants rather than the black carbon, with higher contribution to the fine fraction. Increase in the elemental concentrations of Al, S, Cl, K, Ba, Sr, Ti, V, Mn, Cu and Pb were observed with the highest contribution from K. Results show that the usual practices of burning firecrackers and fireworks during New Year's day celebration is a very strong source of air pollution which contributes significantly high amount of metal pollutants in the
Wang, Ming; Chen, Qian; Li, Mei; Zhou, Wei; Ma, Tengfei; Wang, Yun; Gu, Shuling
2014-06-01
Alarin is a newly identified member of the galanin family of peptides. Galanin has been shown to exert regulatory effects on depression. Similar to galanin in distribution, alarin is also expressed in the medial amygdala and hypothalamus, i.e., regions interrelated with depression. However, it remains a puzzle whether alarin is involved in depression. Accordingly, we established the depression-like mouse model using behavioral tests to ascertain the possible involvement of alarin, with fluoxetine as a positive control. With the positive antidepressant-like effects of alarin, we further examined its relationship to HPA axis activity and brain-derived neurotrophic factor (BDNF) levels in different brain areas in a chronic unpredictable mild stress (CUMS) paradigm. In the acute studies, alarin produced a dose-related reduction in the immobility duration in tail suspension test (TST) in mice. In the open-field test, intracerebroventricular (i.c.v.) injection of alarin (1.0 nmol) did not impair locomotion or motor coordination in the treated mice. In the CUMS paradigm, alarin administration (1.0 nmol, i.c.v.) significantly improved murine behaviors (FST and locomotor activity), which was associated with a decrease in corticotropin-releasing hormone (CRH) mRNA levels in the hypothalamus, as well as a decline in serum levels of CRH, adrenocorticotropic hormone (ACTH) and corticosterone (CORT), all of which are key hormones of the HPA axis. Furthermore, alarin upregulated BDNF mRNA levels in the prefrontal cortex and hippocampus. These findings suggest that alarin may potentiate the development of new antidepressants, which would be further secured with the identification of its receptor(s). Copyright © 2014 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Lostaglio, Matteo; Alhambra, Álvaro M.; Perry, Christopher
2018-01-01
To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes-Cummings in......To what extent do thermodynamic resource theories capture physically relevant constraints? Inspired by quantum computation, we define a set of elementary thermodynamic gates that only act on 2 energy levels of a system at a time. We show that this theory is well reproduced by a Jaynes......-Cummings interaction in rotating wave approximation and draw a connection to standard descriptions of thermalisation. We then prove that elementary thermal operations present tighter constraints on the allowed transformations than thermal operations. Mathematically, this illustrates the failure at finite temperature...... to do so, including necessary and sufficient conditions for a given change of the population to be possible. As an example, we describe the resource theory of the Jaynes-Cummings model. Finally, we initiate an investigation into how our resource theories can be applied to Heat Bath Algorithmic Cooling...
Cum grano salis - NAA of selected salts
International Nuclear Information System (INIS)
Steinhauser, G.; Sterba, J.H.; Poljanc, K.; Bichler, M.; Buchtela, K.
2006-01-01
The aim of this study was to investigate the trace element concentrations of salt samples from different regions, in particular Austria, Germany, Pakistan, Poland, Switzerland, and Ukraine. Investigated types of salt were Rock-, Sea-, Lake-, and Evaporated Salt. The main objective was to find out whether the consumption of salt can contribute significantly to the daily human requirements of trace elements. Therefore, trace element concentrations in the untreated samples were compared to those of specially treated samples, simulating digestive uptake using a simple model. Salt is a non-trivial matrix for Neutron Activation Analysis (NAA) because of very high background activities from 38 Cl and 24 Na, as well as the bremsstrahlung of 32 P (originating from 35 Cl(n,α) 32 P). Because of this fact, detection limits in salt are higher compared to other matrices. Nevertheless, several elements could be detected, namely Al, Ba, Br, (Ca), Ce, Cl, Co, Cr, Cs, Eu, Fe, Hf, La, Mn, Na, Rb, Sb, Sc, Sm, Sr, Ta, Tb, Th, and Zn, some of them only in single samples. In most samples the concentrations of trace elements in salt were too low to show biological effects. Salt can therefore only significantly contribute the essential elements sodium, chlorine, and, if added on purpose, fluorine and iodine to human nutrition. The contribution of all other traces in salt to the average daily human requirements can be neglected. Thus, from an analytical point of view, there is no health reason to use unpurified salt. There are, however, a few drawbacks to the use of unpurified salt, as hygroscopic compounds like MgCl 2 , and even toxic heavy metals like chromium or thorium. Especially rare earth element (REE) concentrations can often be used to obtain a chemical fingerprint, which can be used to identify the origin of an unknown sample. In the case of this study, the sample number from each region was too small to collect significant data. Therefore more analytical information is needed for a conclusive result in this respect. (author)
Thirteenth ISMAS symposium cum workshop on spectrometry
International Nuclear Information System (INIS)
Aggarwal, S.K.; Jaison, P.G.; Alamelu, D.
2008-01-01
Mass spectrometry is an important analytical tool and finds applications in almost all branches of science and technology like Physics, Chemistry, Biology, Material Science, Geology, Nuclear Science, Industry, Oceanography, Environment etc. Innovations in the designs of mass spectrometers coupled with new ionization techniques have further strengthened the capabilities of mass spectrometry for analyzing all types of molecules including thermally labile and non-volatile at concentrations down to femto gram levels. The applications of mass spectrometry to the biomedical sciences have provided a unique, easy and fast approach to genomics, proteomics and metabolomics. The availability of different types of mass spectrometers for inorganic elemental and isotopic composition determination have strengthened the role of mass spectrometry for analyzing all elements starting from hydrogen onwards. It is now possible to carry out speciation analysis using electrospray mass spectrometry. The individual conference papers in the proceedings covers fundamentals of mass spectrometry, qualitative and quantitative aspects and data interpretation, maintenance of mass spectrometers, selection of mass spectrometer, and recent advances in the field. Papers relevant to INIS are indexed separately
Solutions of two-mode Jaynes–Cummings models
Indian Academy of Sciences (India)
variety of problems [2–8] in quantum optics and it predicts many new features in the limit of strong coupling g of the ... mation in quantum mechanics by Sudha Singh and Roy [19,20] can be conveniently used to obtain the ... operators for modes 1 and 2, ˆσii = |i〉〈i| are the level occupation number and. ˆσij = |i〉〈j|(i = j) are the ...
SOCIO CUM LINGUISTIC INTERPLAY IN LANGUAGE CHOICE ...
African Journals Online (AJOL)
Sir George
2016-06-02
Jun 2, 2016 ... learn to speak a language by force, or refuse to speak it. This is a ... circumstances such as the effects of linguistic deprivation, how bilingual children can learn ..... the other; the effects of books, movies and so on. Out.
Yamaguchi, M; Kennedy, G
1984-09-01
The authors measured the positive and negative contributions of population and labor force growth to the growth of per capita income and sectoral output in Japan in the 1880-1970 period. A 2-sector growth accounting model that treats population and labor growth as separate variables was used. 3 alternative methods were used: the Residual method, the Verdoorn method, and the factor augmenting rate method. The total contribution of population cum labor growth to per capita income growth tended to be negative in the 1880-1930 period and positive in the 1930-40 and 1950-70. Over the 1880-1970 period as a whole, population cum labor growth made a positive contribution to per capita income growth under the Residual method (0.35%/year), the factor augmenting rate method (0.29%/year), and the Verdoorn method (0.01%/year). In addition, population cum labor growth contributed positively to sectoral output growth. The average contribution to agricultural output growth ranged from 1.03% (Verdoorn) - 1.46%/year (factor augmenting rate), while the average contribution to nonagricultural output growth ranged from 1.22% (Verdoorn) - 1.60%/year (Residual). Although these results are dependent on the model used, the fact that all 3 methods yielded consistent results suggests that population cum labor growth did make a positive contribution to per capita income and sectoral output growth in Japan. These findings imply that in economies where the rate of technical change in agricultural and nonagricultural sectors exceeds population growth, policies that reduce agricultural elasticities may be preferable; on the other hand, policies that reduce agricultural elasticities are to be avoided in economies with low rates of technical change. Moreover, in the early stages of economic development, policies that increase agricultural income and price elasticities should be considered.
Lifescience Database Archive (English)
Full Text Available E00477 Lysimachia foenum-graecum herb Lysimachiae herba Crude drug ... Lysimachia foenum-grae...cum [TAX:213265] ... Primulaceae (primrose family) Lysimachia foenum-graecum herb (dried) ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available cum USDA ... 110] ... Length = 121 ... Query: 179 FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLE...TTAIIGVARELGA 238 ... FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLETTAII...GVARELGA Sbjct: 1 ... FARSPFARCLGIRVNDDGTLTMPFSPKIIGNPILPAIHGGMTGAFLETTAIIGVARELGA 60 ... Query: 299 R 299 ... R Sbjct: 121 R 121
Wang, Jiajia; Li, Xiaofang; He, Shugui; Hu, Lijun; Guo, Jiewen; Huang, Xiangning; Hu, Jinqing; Qi, Yaoqun; Chen, Bin; Shang, Dewei; Wen, Yuguan
2018-03-25
Xiaoyao San (XYS) is a classic Chinese herbal formula for treatment of depression. The present study aimed to investigate the antidepressant effects of XYS in a rat model of chronic unpredictable mild stress (CUMS) and the underlying mechanisms. A CUMS rat model of depression was established via 4 weeks of unpredictable stimulation. Then the rats were orally administered paroxetine and XYS for 2 weeks with continued stress. Behavioral assessments, including an open field test (OFT), sucrose preference test (SPT) and forced swim test (FST), were conducted to evaluate the antidepressant effects of XYS. The concentrations in rat plasma of tryptophan (Trp) and its metabolic products, including kynurenine (Kyn) and quinolinic acid (QUIN), were determined using high performance liquid chromatography tandem mass spectrometry with electrochemical detection (HPLC-MS/MS). The mRNA and protein levels in rat hippocampus of depression-related brain derived neurotrophic factor (BDNF), cyclic AMP response element binding protein (CREB) and nerve cell adhesion molecule (NCAM) were determined by real-time qPCR and Western blot, respectively. Enzyme Linked Immunosorbent Assay (ELISA) was used to detect the activities of indoleamine 2,3-dioxygenase (IDO) and kynurenine-3-monooxygenase (KMO) in rat plasma. The results showed that a successful CUMS rat model was established through 4 weeks of continuous unpredictable stimulation, as indicated by the significant decrease in locomotor activity and increase in immobility time in the OFT, reduction in body weight and food intake etc. Compared with the normal group, the concentrations of Kyn and QUIN had significantly (p KMO. Compared with the normal group, the mRNA of NCAM, CREB and BDNF were significantly down-regulated (p < 0.001) in the control group, BDNF gene was up-regulated by paroxetine or XYS treatment, NCAM and CREB gene did not change in XYS group, protein expressions of BDNF and CREB were significantly increased, and NCAM was
Zaicz, Gábor
2000-01-01
Ungari arstiteadlase Sámuel Gyamathi ladinakeelsest uurimusest "Affinitas linguae Hungaricae cum linguis Fennicae originis grammaticae demonstrata" ("Grammatiline tõestus ungari keele ja soome päritolu keelte suguluse kohta")
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-03-07
Mar 7, 2018 ... imbalance, polysaccharide changes, infection and allergy as factors implicated in its development. [6]. ..... World Health Organization to use traditional medicine of different countries and its integration ... Cummings.
Tally, Mirjam, 1976-
2003-01-01
Uutest plaatidest "Mirjam Tally", Jennifer Love Hewitt "Barenaked", Sam "Being Under The Influence", Slade "Cum On Let's Party", The Dandy Warhols "Welcome To The Monkey House", Audio Bullys "Ego War"
La Mystagogie de Saint Maxime le Confesseur
Directory of Open Access Journals (Sweden)
Florin Crismareanu
2011-12-01
Full Text Available Review of: Maximi Confessoris, Mystagogia: una cum Latina interpretatione Anastasii Bibliothecarii, edita a Christian Boudignon, Turnhout: Brepols, Corpus Christianorum. Series Graeca, nr. 69, 2011, 187 + 99 p.
Energy Technology Data Exchange (ETDEWEB)
Densmore, J.D., E-mail: jeffery.densmore@unnpp.gov [Bettis Atomic Power Laboratory, P.O. Box 79, West Mifflin, PA 15122 (United States); Park, H., E-mail: hkpark@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States); Wollaber, A.B., E-mail: wollaber@lanl.gov [Computational Physics and Methods Group, Los Alamos National Laboratory, P.O. Box 1663, MS D409, Los Alamos, NM 87545 (United States); Rauenzahn, R.M., E-mail: rick@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States); Knoll, D.A., E-mail: nol@lanl.gov [Fluid Dynamics and Solid Mechanics Group, Los Alamos National Laboratory, P.O. Box 1663, MS B216, Los Alamos, NM 87545 (United States)
2015-03-01
We present a moment-based acceleration algorithm applied to Monte Carlo simulation of thermal radiative-transfer problems. Our acceleration algorithm employs a continuum system of moments to accelerate convergence of stiff absorption–emission physics. The combination of energy-conserving tallies and the use of an asymptotic approximation in optically thick regions remedy the difficulties of local energy conservation and mitigation of statistical noise in such regions. We demonstrate the efficiency and accuracy of the developed method. We also compare directly to the standard linearization-based method of Fleck and Cummings [1]. A factor of 40 reduction in total computational time is achieved with the new algorithm for an equivalent (or more accurate) solution as compared with the Fleck–Cummings algorithm.
International Nuclear Information System (INIS)
Densmore, J.D.; Park, H.; Wollaber, A.B.; Rauenzahn, R.M.; Knoll, D.A.
2015-01-01
We present a moment-based acceleration algorithm applied to Monte Carlo simulation of thermal radiative-transfer problems. Our acceleration algorithm employs a continuum system of moments to accelerate convergence of stiff absorption–emission physics. The combination of energy-conserving tallies and the use of an asymptotic approximation in optically thick regions remedy the difficulties of local energy conservation and mitigation of statistical noise in such regions. We demonstrate the efficiency and accuracy of the developed method. We also compare directly to the standard linearization-based method of Fleck and Cummings [1]. A factor of 40 reduction in total computational time is achieved with the new algorithm for an equivalent (or more accurate) solution as compared with the Fleck–Cummings algorithm
International Nuclear Information System (INIS)
Manenti, Simone; Alí Santoro, María del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia
2017-01-01
Deuteron-induced nuclear reactions for the generation of 103 Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to E d = 33 MeV. The excitation functions of the reactions 103 Rh(d,xn) 101,103 Pd, 103 Rh(d,x) 100g,cum,101m,g,102m,g Rh and 103 Rh(d,2p) 103 Ru have been measured, and the Thick-Target Yield for 103 Pd has been calculated.
Quantitative Study of Biogas Generation Potential from Different Landfill Sites of Nepal
Directory of Open Access Journals (Sweden)
Bikash Adhikari
2015-01-01
Full Text Available This research paper was study of waste composition and quantitative analysis of biogas generation potential with its recovery at Sisdole, Pokhara and Karaute Dada landfill sites (LFS of Nepal. The waste management practice in LFS are significant deciding factors for the assessment of environmental impacts caused including the release of green house gases like methane, carbondioxide etc to the atmosphere, that could contribute significantly to global warming and climate change. The total waste disposed to Sisdole LFS, Pokhara LFS and Karaute Dada LFS are 410, 80 and 7.8 tons respectively. The waste composition was studied onsite with waste reduction method and analyzed for their composition. The organic component of wastes was found high as 61.6%, 52.5% and 65% at Sisdole, Pokhara and Karaute Dada LFS respectively. The biogas potential at these landfill sites were 12157.78 cum, 851.99 cum and 169 cum of biogas per day in Sisdole, Pokhara and Karaute Dada LFS respectively. 4.68, 0.33 and 0.07 MW energy per day can be generated from these amounts of biogas produced in Sisdole, Pokhara and Karaute Dada LFS respectively. Proper gas collection system can be the source of income from these landfill sites and help to mitigate the adverse impact of methane that is being released from these landfill sites
Directory of Open Access Journals (Sweden)
Rong Zhang
2016-01-01
Full Text Available Metabolomic profiling was carried out on 53 post-mortem brain samples from subjects diagnosed with schizophrenia, depression, bipolar disorder (SDB, diabetes, and controls. Chromatography on a ZICpHILIC column was used with detection by Orbitrap mass spectrometry. Data extraction was carried out with m/z Mine 2.14 with metabolite searching against an in-house database. There was no clear discrimination between the controls and the SDB samples on the basis of a principal components analysis (PCA model of 755 identified or putatively identified metabolites. Orthogonal partial least square discriminant analysis (OPLSDA produced clear separation between 17 of the controls and 19 of the SDB samples (R2CUM 0.976, Q2 0.671, p-value of the cross-validated ANOVA score 0.0024. The most important metabolites producing discrimination were the lipophilic amino acids leucine/isoleucine, proline, methionine, phenylalanine, and tyrosine; the neurotransmitters GABA and NAAG and sugar metabolites sorbitol, gluconic acid, xylitol, ribitol, arabinotol, and erythritol. Eight samples from diabetic brains were analysed, six of which grouped with the SDB samples without compromising the model (R2 CUM 0.850, Q2 CUM 0.534, p-value for cross-validated ANOVA score 0.00087. There appears on the basis of this small sample set to be some commonality between metabolic perturbations resulting from diabetes and from SDB.
Double trisomy with 48, XXX+21 karyotype in a Down's syndrome ...
Indian Academy of Sciences (India)
Author Affiliations. Wahied Khawar Balwan1 Parvinder Kumar1 T. R. Raina1 Subash Gupta1. Human Genetic Research cum Counselling Centre, University of Jammu, Government Medical College, Jammu 180 006, India ...
Surfactant-assisted sacrificial template-mediated synthesis ...
Indian Academy of Sciences (India)
Heena Khajuria
Lanthanide ion based nanomaterials have gained much attention due to their ... A number of studies on the synthesis .... cum Steady State Luminescence Spectrometer, Edinburgh ..... and their application in lithium-ion batteries Adv. Mater.
Ramon Rask võitleb põhimõtte pärast / Marian Männi
Männi, Marian
2007-01-01
Portreelugu Tartu Ülikooli õigusteaduskonna cum laude lõpetanud Ramon Raskist, tema kohtuvõitlusest ülikooliga; professionaalse tasuta õigusabi võimalustest tudengitele Paul Varuli advokaadibüroo poolt Eesti Üliõpilasliidu juures
Murashov, A. A.; Sidorov, A. I.; Stoliarchuk, M. V.
2018-03-01
Experimental evidence is presented that nanosecond UV laser irradiation of silver- and copper-containing barium phosphate glasses leads to luminescence quenching in the visible range. Subsequent heat treatment induces an absorption in the range 350–500 nm. These effects are due to the ionisation and fragmentation of subnanometre molecular clusters by laser radiation and subsequent (heat treatment-induced) formation of nanoparticles possessing plasmon resonance. Our numerical modelling results demonstrate the feasibility of producing stable AgnCum hybrid molecular clusters in glass. Local modification of the optical properties of glass by laser light can be used for optical information recording.
When apparent schizophrenia is excluded
African Journals Online (AJOL)
Subsequently, the MRI in May 2010 showed only nonspecific changes. Finally, in July ... Town to instruct the development of the predictive .... Cummings JL. ... World Health Organization, and Global Health Observatory Data Repository. Global ...
Observation of a Dissipation-Induced Classical to Quantum Transition
Directory of Open Access Journals (Sweden)
J. Raftery
2014-09-01
Full Text Available Here, we report the experimental observation of a dynamical quantum phase transition in a strongly interacting open photonic system. The system studied, comprising a Jaynes-Cummings dimer realized on a superconducting circuit platform, exhibits a dissipation-driven localization transition. Signatures of the transition in the homodyne signal and photon number reveal this transition to be from a regime of classical oscillations into a macroscopically self-trapped state manifesting revivals, a fundamentally quantum phenomenon. This experiment also demonstrates a small-scale realization of a new class of quantum simulator, whose well-controlled coherent and dissipative dynamics is suited to the study of quantum many-body phenomena out of equilibrium.
DEFF Research Database (Denmark)
Paunova, Minna; Velikova, Silviya Svejenova
with learning in these and other organizations. Zooming in on a critical case of a performance arts’ organization–an orchestra-cum-laboratory–our study seeks to advance understanding of generative forms of organizing for individual and organizational learning and creativity. Unlike traditional orchestras...... for which performance is an end and rehearsing a means, for the orchestra-cum-laboratory rehearsing is an end in itself, satisfying musicians’ drives to learn and create. We are interested to advance understanding of why and how a creative collective operates as a learning-driven performance arts......Orchestras and other performing arts organizations exist to deliver superior performance of artistic and cultural works. While performing arts organizations often serve as analytical templates to understand collective learning, creativity, and innovation, performance is not always concerted...
Accardi contra Bell (cum mundi) : the impossible coupling
Gill, R.D.
2001-01-01
An experimentally observed violation of Bell s inequality is supposed to show the failure of local realism to deal with quantum reality. However, finite statistics and the time sequential nature of real experiments still allows a loophole for local realism. We show that the randomised design of
31 PLEA BARGAINING AND THE RELIGIOUS CUM SOCIO ...
African Journals Online (AJOL)
HP
2016-07-09
Jul 9, 2016 ... eradicating corruption in the country will not be a mere political ... have plea bargaining systems, albeit in different stages of development. .... dying as a result of socio-cultural disintegration being witnessed as a bye product.
Performance Of Animal-drawn, Ripper Attached Maize-Cum ...
African Journals Online (AJOL)
በፊት ከተሰራው በእርፍና ሞፈር ሊይ ታስሮ ከሚሰራ መዝሪያ (sweeper attached planter, SAP) እና መሬቱን. በነባሩ የአስተራረስ ዘዴ አዘጋጅቶ የሰው ሃይሌ (በእጅ) ዘር ...
HISTORIOGRAPHY OF THE PRINT MEDIA: A GLOBAL-CUM ...
African Journals Online (AJOL)
user
2012-07-01
Jul 1, 2012 ... longer were societies composed of rulers and subjects; printing sped the rise of democracy. No longer ..... As a nationalist,. Zik never ... These categories of newspapers constitute a new dimension in newspaper production.
Status and prospects of fish farming in Goa
Digital Repository Service at National Institute of Oceanography (India)
Parulekar, A.H.; Verlecar, X.N.
-cum-prawn culture. Relevant information on the indigenous methods of cultivating common species, their annual yield and economics of aquaculture are discussed in the paper with reference to future prospects of fish farming in Goa...
PROTECTING CRITICAL DATABASES – TOWARDS A RISK BASED ...
African Journals Online (AJOL)
njotim
LLB, (Vista University), LLM Cum Laude: Information Technology Law, ... information14 by or between governments, businesses or individual ICT users, thus .... web user into surrendering private information that will be used for identity theft ...
AJET VOL. 9. NO. 1 arrangement Backup New Correction
African Journals Online (AJOL)
Ayodele Azeez A
making them a force for profound change. Therefore, any ... has a significant effect on the development of individuals and on his/her ... that affect behaviour are spatial organization, Visual character, site ..... Cummings, N. G. (2012). Fostering.
Research Article Special Issue
African Journals Online (AJOL)
2017-02-15
Feb 15, 2017 ... The study population consisted of all employees of Tehran Bank ...... Deci, E.L., Connell, J.P., Ryan, R.M. (1989), "Self-determination in a work ... employeeempowerment", in Cummings, T. (Ed.), Handbook of Organizational.
NCBI nr-aa BLAST: CBRC-XTRO-01-0267 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0267 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 8e-16 18% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0132 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0132 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 1e-21 25% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-0470 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0470 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 1e-13 24% ...
NCBI nr-aa BLAST: CBRC-XTRO-01-2513 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-2513 ref|YP_419798.1| Ice nucleation protein [Magnetospirillum magneti...cum AMB-1] dbj|BAE49239.1| Ice nucleation protein [Magnetospirillum magneticum AMB-1] YP_419798.1 2e-12 28% ...
Animal Research International - Vol 9, No 2 (2012)
African Journals Online (AJOL)
Effects of Piliostigma thonningii ethyl acetate leaf extract on aluminium-cum extract treated wistar rats · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Macdonald O Ighodaro, JO Omole, SO Fadipe ...
ISSN 2073 East Cent. Afr. j. surg.
African Journals Online (AJOL)
DELL
2009-02-27
Feb 27, 2009 ... Bladder Tumours at Tikur Anbessa Hospital in Ethiopia. ... The most common presenting symptoms were hematuria in 89(91.8%). cystoscopy ..... West DA, Cummings JM, Longo WE, et al; Role of chronic catheterization in the.
AFRREV, 9(1), S/NO 36, JANUARY, 2015
African Journals Online (AJOL)
EMILIA
from the seizure of ivory (from ivory raids) buying of tusks from the interior or through direct .... products like textile, footwear, cigarette, processed foods and beverages cum cement .... preferences and behaviour of warring parties. This type of ...
Directory of Open Access Journals (Sweden)
Matjaž Babič
1995-12-01
Full Text Available Das Buch ist eine überarbeitete und verbesserte Version der Doktordissertation, die an der Universität von Pavia vorgelegt wurde. Es wird darin ein vielbesprochenes Prob lem der lateinischen Sprache erneut aufgegriffen, es wird eine neue Antwort auf die Frage über das Verhaltnis zwischen Accusativus cum infinitivo (Acl und Nebensätzen mit quod/quia dargeboten. Der Accusativus cum infinitivo, regiert von Verben wie 'sagen, denken', gilt als eine Besonderheit des Lateinischen und Altgriechischen im Verhältnis zu den modernen indogermanischen Sprachen. Für den Ursprung und Sinn dieser Infinitivkonstruktion wurden verschiedene Erklärungen vorgeschlagen oder zu mindest Richtungen für eine mögliche Lösung angezeigt. Der Verfasser dieses Buches versucht, die vorhandenen Losungen mit Hilfe der allgemeinlinguistischen Erkentnisse zu erganzen und sie in eine neue Lösung zu vereinen.
Comment on ‘Initial states of qubit–environment models leading to conserved quantities’
International Nuclear Information System (INIS)
Lo, C F
2014-01-01
Recently, Gardas and Dajka (2013 J. Phys. A: Math. Theor. 46 235301) proposed a theoretical scheme on how to prepare a proper initial state of a composite qubit–boson system which could assure no energy exchange between the two subsystems. For illustration, they applied the proposed scheme to both the Jaynes–Cummings model and the multi-photon Rabi model. However, it has already been rigorously proven that the k-photon Rabi model for k > 2 does not have eigenstates in the Hilbert space spanned by the eigenstates of the corresponding k-photon Jaynes–Cummings model and that the two-photon Rabi model has a discrete eigenenergy spectrum with normalizable eigenstates only if the coupling strength is smaller than a critical value. Hence, the proposed theoretical scheme is not applicable to the multi-photon Rabi model. (comment)
DOI: 10.18697/ajfand.79.15670 12325 ECONOMIC DIFFERENTIAL ...
African Journals Online (AJOL)
fish, rice cum poultry production integration platforms were set up to perfect the ... people along its divergent value chain, in addition to providing food and nutrition .... the application of organic manure at the recommended rate of 150kg fresh.
The U.S. EPA's SHEDS-Multimedia model was applied to enhance the understanding of children's exposures and doses to multiple pyrethroid pesticides, including major contributing chemicals and pathways. This paper presents combined dietary and residential exposure estimates and cum...
A 1 V supercapacitor device with nanostructured graphene oxide ...
Indian Academy of Sciences (India)
Polyaniline and graphene oxide composite on activated carbon cum reduced graphene oxide-supported supercapacitor electrodes are fabricated and electrochemically characterized in a three-electrode cell assembly. Attractive supercapacitor performance, namely high-power capability and cycling stability for graphene ...
Description d’un genre nouveau de la famille des Clérides
Fairmaire, L.
1887-01-01
Tarsi quadriarticulati. Prothorax haud marginatus, lateribus cum pleuris confusis. Oculi antice emarginati, subtiliter granulati. Antennæ breves, ab articulo 5° late serratae, articulo 4° brevissimo, ultimo emarginato, apice sat acuto. Palpi omnes articulo ultimo elongato, acuto. Elytra apice
Rijsdijk, K.F.; Hume, J.P.; de Louw, P.G.B.; Meijer, H.J.M.; Janoo, A.; de Boer, E.J.; Steel, L.; de Vos, J.; van der Sluis, L.G.; Hooghiemstra, H.; Florens, F.B.V.; Baider, C.; Vernimmen, T.J.J.; Baas, P.; van Heteren, A.H.; Rupear, V.; Beebeejaun, G.; Grihault, A.; van der Plicht, J.; Besselink, M.; Lubeek, J.K.; Jansen, M.; Kluiving, S.J.; Hollund, H.; Shapiro, B.; Collins, M.; Buckley, M.; Jayasena, R.M.; Porch, N.; Floore, R.; Bunnik, F.; Biedlingmaier, A.; Leavitt, J.; Monfette, G.; Kimelblatt, A.; Floore, P.; Claessens, L.P.A.M.
2016-01-01
The dodo Raphus cucullatus Linnaeus, 1758 Linnaeus, C. 1758. Systema Naturae per Tegna Tria Naturae, Secundum Classes, Ordines, Genera, Species, cum Characteribus, Differentiis, Synonymis, Locis. Tenth Edition. Laurentii Salvii, Stockholm, 824 pp., an extinct and flightless, giant pigeon endemic to
DEFF Research Database (Denmark)
Madsen, Kristian Høeg; Ates, Serkan; Reitzenstein, S.
2010-01-01
The coupling between a quantum dot (QD) and a micropillar cavity is experimentally investigated by performing time-resolved, correlation, and two-photon interference measurements. The Jaynes-Cummings model including dissipative Lindblad terms and dephasing is analyzed, and all the parameters...
An interesting new Bulbophyllum
Smith, J.J.
1935-01-01
Bulbophyllum (sect. Cirrhopetalum) Jacobsonii J. J. S. n. sp. — Rhizoma repens, teres. Pseudobulbi remoti, oblique ovoidei, manifesto quadranguli cum lateribus concavis, 1.8 cm longi, 0.75 et 0.95 cm diam., 1-folii. Folium lanceolatum, apice recurvulum, basi brevissime
Prevalence and correlates of chronic kidney disease among civil ...
African Journals Online (AJOL)
2014-01-31
Jan 31, 2014 ... Results: The prevalence of CKD in the study was 7.8%. Age >50 years was .... participant and preserved in lithium heparin bottle for subsequent ..... Craig JC, Barratt A, Cumming R, Irwig L, Salkeld G. Feasibility study of the.
Making Sense of Formalization in Interorganizational Relationships: Beyond Coordination and Control
P.W.L. Vlaar (Paul)
2006-01-01
textabstractPaul W.L. Vlaar (Obdam, January 4, 1978) obtained his M.Sc. degree in Economics (Cum Laude) from Wageningen University, The Netherlands. He is currently an assistant professor of strategic management at RSM Erasmus University. His research interests include interorganizational
Search Results | Page 16 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 151 - 160 of 9581 ... Estimating the effect of minimum wage on firm profitability in China ... minimum wage policy in China has not only direct effects on wage levels but ... Sustainable livelihoods for all the micro enterprise cum micro credit ...
Directory of Open Access Journals (Sweden)
Natasa Spasojevic
2012-12-01
Full Text Available Alterations in cardiac function were observed in antidepressants treated patients and published in several clinical reports. These detected changes could be either a consequence of the treatment or of depression itself, which has already been proved to be a risk factor in heart diseases. In order to determine a possible influence of chronic treatment with norepinephrinergic reuptake inhibitor, maprotiline, on the heart, we investigated gene expression of cardiac β-adrenoceptors both in controls and in animals with signs of depression. The rats were divided into two groups, unstressed controls and those exposed to chronic unpredictable mild stress (CUMS. The groups were further divided into two subgroups, one receiving daily intraperitoneal injections of vehicle (sterile water and another one maprotiline (10 mg/kg for four weeks. Tissue samples were collected after the last application. Gene expression of cardiac β1- and β2-adrenoceptor was determined using Real-time RT-PCR analysis. Our results show that in control animals expression of both adrenoreceptors was decreased in the right atria after 4 weeks of maprotiline application. Contrary, the same treatment led to a significant increase in expression of cardiac β1-adrenoceptor in the stressed rats, with no change in the characteristics of β2-adrenoceptor. Our findings might reflect the that molecular mechanisms are underlying factors involved in the development of cardiovascular diseases linked with antidepressant treatment.
Lopes Antunes, Ana Carolina; Dórea, Fernanda; Halasa, Tariq; Toft, Nils
2016-05-01
Surveillance systems are critical for accurate, timely monitoring and effective disease control. In this study, we investigated the performance of univariate process monitoring control algorithms in detecting changes in seroprevalence for endemic diseases. We also assessed the effect of sample size (number of sentinel herds tested in the surveillance system) on the performance of the algorithms. Three univariate process monitoring control algorithms were compared: Shewart p Chart(1) (PSHEW), Cumulative Sum(2) (CUSUM) and Exponentially Weighted Moving Average(3) (EWMA). Increases in seroprevalence were simulated from 0.10 to 0.15 and 0.20 over 4, 8, 24, 52 and 104 weeks. Each epidemic scenario was run with 2000 iterations. The cumulative sensitivity(4) (CumSe) and timeliness were used to evaluate the algorithms' performance with a 1% false alarm rate. Using these performance evaluation criteria, it was possible to assess the accuracy and timeliness of the surveillance system working in real-time. The results showed that EWMA and PSHEW had higher CumSe (when compared with the CUSUM) from week 1 until the end of the period for all simulated scenarios. Changes in seroprevalence from 0.10 to 0.20 were more easily detected (higher CumSe) than changes from 0.10 to 0.15 for all three algorithms. Similar results were found with EWMA and PSHEW, based on the median time to detection. Changes in the seroprevalence were detected later with CUSUM, compared to EWMA and PSHEW for the different scenarios. Increasing the sample size 10 fold halved the time to detection (CumSe=1), whereas increasing the sample size 100 fold reduced the time to detection by a factor of 6. This study investigated the performance of three univariate process monitoring control algorithms in monitoring endemic diseases. It was shown that automated systems based on these detection methods identified changes in seroprevalence at different times. Increasing the number of tested herds would lead to faster
Publii ovidii nasonis tristium liber IV commentario exegetico instructus
Jonge, Theodorus Jacobus de
1951-01-01
Sub finem anni 8 p. Chr. n. P. Ovidius Naso quinquagesimum annum egressus relegatus est. Duas causas ipse poeta affert: perdiderint cum me duo crimina, carmen et error. Verisimile est utrumque crimen pertinuisse ad formulam laesae maiestatis. Augusti temporibus autem crimen laesae maiestatis
Description de Coléoptères nouveaux de la Malaisie, de l’Inde et de la Chine
Fairmaire, L.
1897-01-01
Long. 13 mill. — Oblonga, sat convexa, dilute piceola, vage ænescens, opaca, labro dilute testaceo, elytris utrinque plaga magna media, intus constricta et parte apicali lutosis, lateribus utrinque plagulis 2 triangularibus cum prothoracis lateribus æneo-pernitidis, quasi specularibus; capite basin
A corpus-based Critical Discourse Analysis (CDA) of the linguistic ...
African Journals Online (AJOL)
Additionally, nominalisation-cum-thematisation of discourse topics, intertextuality, citation of views by experts and officials, the local nomenclature of HIV and AIDS and Shona for Specific Purposes (SSP) motivated by politeness, were variously used to reveal advances and challenges encountered regarding activities ...
Durán, Esperanza
2017-01-01
297 páginas.-- Tesis para obtener el título de Doctor por la Universidad de Sevilla con la calificación de Sobresaliente Cum laude.-- Tutora: Dra. Isabel González Díez, Profesora Titular de la Universidad de Sevilla
Exact and useful optimization methods for microeconomics
Balder, E.J.
2011-01-01
This paper points out that the treatment of utility maximization in current textbooks on microeconomic theory is deficient in at least three respects: breadth of coverage, completeness-cum-coherence of solution methods and mathematical correctness. Improvements are suggested in the form of a
Designing an Error Resolution Checklist for a Shared Manned-Unmanned Environment
2010-06-01
to many people who contributed to the successful completion of this thesis. First, a special thank you to Missy Cummings, my research advisor ...Management Using Treemaps. Proceedings of the Project Management Institute Research Conference. London, UK. Chandler, D. (2009). Robo -forklift keeps
Chirality Quantum Phase Transition in Noncommutative Dirac Oscillator
International Nuclear Information System (INIS)
Wang Shao-Hua; Hou Yu-Long; Jing Jian; Wang Qing; Long Zheng-Wen
2014-01-01
The charged Dirac oscillator on a noncommutative plane coupling to a uniform perpendicular magnetic held is studied in this paper. We map the noncommutative plane to a commutative one by means of Bopp shift and study this problem on the commutative plane. We find that this model can be mapped onto a quantum optics model which contains Anti—Jaynes—Cummings (AJC) or Jaynes—Cummings (JC) interactions when a dimensionless parameter ζ (which is the function of the intensity of the magnetic held) takes values in different regimes. Furthermore, this model behaves as experiencing a chirality quantum phase transition when the dimensionless parameter ζ approaches the critical point. Several evidences of the chirality quantum phase transition are presented. We also study the non-relativistic limit of this model and find that a similar chirality quantum phase transition takes place in its non-relativistic limit. (physics of elementary particles and fields)
EVALUATION OF PRE AND POST TRAINING PRACTICES REGARDING MANAGEMENT OF DIABETES
Directory of Open Access Journals (Sweden)
M Mohanty
1995-09-01
Full Text Available The study was conducted on 112 diabetic patients in S.S. Hospital.Varanasi to evaluate the pre- and post- training practices regarding management of Diabetes mellitus. A pre-tested structured respondent schedule urn used to collect information regarding the socio-economic status and some of the managerial aspects of the disease by questionaire cum interview method. Education cum training was imparted to all the respondents in the first three months and in the fourth month evaluation programme was carried out and their level ofpractive regarding different aspects of diabetic management were assessed by using seven point score method. It was found that training was proved effective for the aspect "Physical exercise" and "Restricted diet" but slight improvement in the practive score was seen in "Precaution in Special Hygienic Condition" aspects. So. continuous education programme was needed to improve their practice rate.
Role of hypothalamic cannabinoid receptors in post-stroke depression in rats.
Wang, Shanshan; Sun, Hong; Liu, Sainan; Wang, Ting; Guan, Jinqun; Jia, Jianjun
2016-03-01
One of the most common psychological consequences of stroke is post-stroke depression (PSD). While more than 30 percent of stroke patients eventually develop PSD, the neurobiological mechanisms underlying such a phenomenon have not been well investigated. Given the critical involvement of hypothalamic-pituitary-adrenal axis and endocannabinoid system in response to stressful stimuli, we evaluated the hypothesis that cannabinoid receptors in the hypothalamus are critical for modulation of post-stroke depression-like behaviors in rats. To this end, rats were treated with middle cerebral artery occlusion (MCAO) followed by chronic unpredictable mild stress (CUMS) treatment procedure. We then assessed the expression of CB1 and CB2 receptors in the hypothalamus, and evaluated the effects of pharmacological stimulations of CB1 or CB2 receptors on the expression and development of depression-like behaviors in PSD rats. We found that PSD rats exhibited decreased the expression of CB1 receptor, but not CB2 receptor, in the ventral medial hypothalamus (VMH). Such an effect was not observed in the dorsally adjacent brain regions. Furthermore, intra-VMH injections of CB2 receptor agonist, but not CB1 receptor agonist, attenuated the expression of depression-like behaviors in PSD rats. Finally, repeated intraperitoneal injections of CB1 or CB2 receptor agonists during CUMS treatment inhibited the development of depression-like behaviors in PSD rats. Taken together, these results suggest that decreased CB1 receptor expression is likely associated with the development of post-stroke depression, and CB2 receptor may be a potential therapeutic target for the treatment post-stroke depressive disorders. Copyright © 2016 Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Khasa, S.; Singh, Pradeep; Vinod Kumar
2013-01-01
The conference focusses on the contribution covering semiconducting materials and devices, magnetic nanomaterials and magnetic fluids, metals and alloys, advanced carbon products, polymers composites and soft materials, nuclear structure, proton radioactivity and clustering of nuclei, heavy ion induced nuclear reactions, accelerator and detector, hydrogen storage materials and fuel cells, liquid crystal, glasses and ceramic materials, high Tc superconducting materials, characterization of materials, thin films and sensors, biomedical applications of engineering materials, devices based application, renewable energy sources and applications. Papers relevant to INIS are indexed separately
Dhungana, Sanjeev Kumar; Kim, Il-Doo; Kwak, Hwa-Sook; Shin, Dong-Hyun
2016-06-01
Although a considerable number of studies about the effect of different insecticides on plant physiology and metabolism have been carried out, research work about the comparative action of structurally different classes of insecticide on physiological and biochemical properties of soybean seed germination and early growth has not been found. The objective of this study was to investigate the effect of different classes of insecticides on soybean seed germination and early plant growth. Soybean seeds of Bosuk cultivar were soaked for 24h in distilled water or recommended dose (2mLL(-1), 1mLL(-1), 0.5gL(-1), and 0.5gL(-1) water for insecticides Mepthion, Myungtaja, Actara, and Stonate, respectively) of pesticide solutions of four structurally different classes of insecticides - Mepthion (fenitrothion; organophosphate), Myungtaja (etofenprox; pyrethroid), Actara (thiamethoxam; neonicotinoid), and Stonate (lambda-cyhalothrin cum thiamethoxam; pyrethroid cum neonicotinoid) - which are used for controlling stink bugs in soybean crop. Insecticides containing thiamethoxam and lamda-cyhalothrin cum thiamethoxam showed positive effects on seedling biomass and content of polyphenol and flavonoid, however fenitrothion insecticide reduced the seed germination, seed and seedling vigor, and polyphenol and flavonoid contents in soybean. Results of this study reveal that different classes of insecticide have differential influence on physiologic and metabolic actions like germination, early growth, and antioxidant activities of soybean and this implies that yield and nutrient content also might be affected with the application of different types of insecticide. Copyright © 2015 Elsevier B.V. All rights reserved.
African Journals Online (AJOL)
Agenda for Change, the party pledged, inter alia, to reduce "the potential for, and level of ... According to her, "The Centre for Democratic Development (CDD) Ghana's 2005. Afro Barometer Round ... party organization, incompetence, victimization, personality cult etc. combine to perpetuate an ..... Cummings, Jeffreys. 1992.
Rhizobium as a crop enhancer and biofertilizer for increased cereal ...
African Journals Online (AJOL)
OHWESIRI IBUJE
2010-09-13
Sep 13, 2010 ... INTRODUCTION. The United Nations Food and Agriculture Organization ... new insights into recent development of rhizobia-cereal interaction. .... which caused changes in root morphology and physiology that resulted in .... Andrews M, James EK, Cummings SP, Zavalin AA, Vinogradova LV,. McKenzie BA ...
Florae Malesianae precursores I. Xyridaceae
Royen, van P.
1953-01-01
Xyris malmei sp. nov. — Folia ensiformia, 7—30 cm longa, subfalcata, minute papillosa. Scapus 20—45 cm longus, teres vel subteres, papillatus. Bracteae ovatae ad ellipticae, obtusae, emarginatae vel retusae; bracteae basales cum nervo uno completo et nervis 4 descendentibus incompletis. Sepala
Individualism and community consciousness in contemporary Africa ...
African Journals Online (AJOL)
The contemporary Africa is witnessing a subtle encroachment of Western styled socio-political cum economic individualism. This indiscriminate assimilation of values has invariably led to the gradual eroding and bastardization of her once cherished communal approach to life. This paper critically examines the foregoing ...
Physico-chemical parameters and heavy metal contents of Ibuya ...
African Journals Online (AJOL)
The physico-chemical parameters and heavy metal contents of Ibuya River were investigated between September 2012 and August 2013 from four stations using standard methods to etermine acceptable water quality standards and evaluate possible sustainability of a thriving fisheries cum tourist sport fishing venture.
Challenges of Local Government Administration in Edo State of ...
African Journals Online (AJOL)
This paper examined the fundamental problems that envelope local government administration in Edo State, and discovered that the challenges are constitutional issues. It also identified problems of graft, poor revenue generation by local authorities, and poor revenue allocation cum fiscal transfer to local governments.
143 OUR GRANDMOTHERS, EXCLUDED FROM HISTORY ...
African Journals Online (AJOL)
ecomatemalistic theory by Swila (2014) and Talitha cum theory by Dube ... Sexism is viewed as a prejudice backed by power directed against women ... dependent children (United Nations Statistical Department, 2000; Uchem, 2001; Ezenweke, .... confronts systems of patriarchy, race and class in traditional societies and ...
Hydrogen production through biocatalyzed electrolysis
Rozendal, R.A.
2007-01-01
cum laude graduation (with distinction) To replace fossil fuels, society is currently considering alternative clean fuels for transportation. Hydrogen could be such a fuel. In theory, large amounts of renewable hydrogen can be produced from organic contaminants in wastewater. During his PhD research
Predictive Models of Procedural Human Supervisory Control Behavior
2011-01-01
821708, Brest , France. Page 139 of 150 Boussemart, Y. and M. L. Cummings (2010). "Predicting Supervisory Control Behavior with Hidden Markov Models...Strategies for Strike Planning. COGIS 2006 - Cognitive Systems with Interactive Sensors, Paris . Burges, C. (1998). "A Tutorial on Support Vector Machines
Fostering argumentation-based computer-supported collaborative learning in higher education
Noroozi, O.
2013-01-01
cum laude graduation (with distinction). In collaborative settings, students of all ages need to learn to clearly explain their informed opinions and give reasons for the way in which they carry out tasks and solve problems. Engaging students in collaborative discussion and argumentation is an
Photon and spin dependence of the resonance line shape in the strong coupling regime
Miyashita, Seiji; Shirai, Tatsuhiko; Mori, Takashi; De Raedt, Hans; Bertaina, Sylvain; Chiorescu, Irinel
2012-01-01
We study the quantum dynamics of a spin ensemble coupled to cavity photons. Recently, related experimental results have been reported, showing the existence of the strong coupling regime in such systems. We study the eigenenergy distribution of the multi-spin system (following the Tavis-Cummings
Guo, Lei; Chen, Yi-Xi; Hu, Yu-Ting; Wu, Xue-Yan; He, Yang; Wu, Juan-Li; Huang, Man-Li; Mason, Matthew; Bao, Ai-Min
2018-05-21
Alterations in peripheral sex hormones may play an important role in sex differences in terms of stress responses and mood disorders. It is not yet known whether and how stress-related brain systems and brain sex steroid levels fluctuate in relation to changes in peripheral sex hormone levels, or whether the different sexes show different patterns. We aimed to investigate systematically, in male and female rats, the effect of decreased circulating sex hormone levels following gonadectomy on acute and chronic stress responses, manifested as changes in plasma and hypothalamic sex steroids and hypothalamic stress-related molecules. Experiment (Exp)-1: Rats (14 males, 14 females) were gonadectomized or sham-operated (intact); Exp-2: gonadectomized and intact rats (28 males, 28 females) were exposed to acute foot shock or no stressor; and Exp-3: gonadectomized and intact rats (32 males, 32 females) were exposed to chronic unpredictable mild stress (CUMS) or no stressor. For all rats, plasma and hypothalamic testosterone (T), estradiol (E2), and the expression of stress-related molecules were determined, including corticotropin-releasing hormone, vasopressin, oxytocin, aromatase, and the receptors for estrogens, androgens, glucocorticoids, and mineralocorticoids. Surprisingly, no significant correlation was observed in terms of plasma sex hormones, brain sex steroids, and hypothalamic stress-related molecule mRNAs (p > 0.113) in intact or gonadectomized, male or female, rats. Male and female rats, either intact or gonadectomized and exposed to acute or chronic stress, showed different patterns of stress-related molecule changes. Diminished peripheral sex hormone levels lead to different peripheral and central patterns of change in the stress response systems in male and female rats. This has implications for the choice of models for the study of the different types of mood disorders which also show sex differences. Copyright © 2018 Elsevier Ltd. All rights reserved.
Ecology and conservation status of canebrakes in Warangal District of Andhra Pradesh, India
Directory of Open Access Journals (Sweden)
S. Suthari
2012-12-01
Full Text Available The article describes cane-cum-bat roost site at Palampet (Warangal District, Andhra Pradesh, India. Although notified as a cane reserve by the state government, it is not spared off the usual habitat depletion and destruction. The functional pyramid formed of Calamus-Terminalia-Pteropus is reported here as first of its kind. This article also places on record seven more cane sites besides noting the importance of the ecology of Morancha Vagu and stressing the need for preserving its banks by planting Calamus rotang L. Ecological education to the local people about biodiversity value and conservation at all levels of its organization is called for.
Directory of Open Access Journals (Sweden)
Basavaraj
Full Text Available Eighteen four weeks’ old weaned Broiler rabbits of comparable body weights were allotted to three dietary treatment groups of six rabbits in each group namely T0 (basal control diet, T1 (basal diet added with Turmeric (Curcuma longa Rhizoid Powder, TRP, at the ratio of 150mg and T2 ( basal diet added with TRP at the ratio of 300mg/100g diet. Feeding cum growth trial and digestion trial were during summer months of April, May and June to study voluntary feed intake, growth rate and nutrient utilization by the experimental animals. TRP included in the diets of experimental groups consisting 6.72 % CP, 5.04% ether extract, 3.96% crude fibre, 7.85% total ash. Depression in voluntary feed intake due to summer stress did not alter due to the inclusion of turmeric powder. The weekly mean body weight gain, feed conversion efficiency and digestibility of nutrients did not show significant difference by the supplementation of turmeric rhizome powder in the diets of rabbit in present study. [Veterinary World 2010; 3(8.000: 369-372
Entanglement in the degenerate two-photon Tavis-Cummings model
Energy Technology Data Exchange (ETDEWEB)
Bashkirov, E K, E-mail: bash@ssu.samara.r [Departments of General and Theoretical Physics, Samara State University, PO Box 443011, 1 Academican Pavlov Str., Samara (Russian Federation)
2010-07-15
An exact solution of the problem of two two-level atoms with degenerate two-photon transitions interacting with a one-mode coherent radiation field is presented. Asymptotic solutions for system state vectors are obtained in the approximation of large initial coherent fields. The atom-field entanglement is investigated on the basis of reduced atomic entropy dynamics. The possibility of the system being initially in a pure disentangled state to revive into this state during the evolution process for the model considered is shown. The conditions and times of disentanglement are derived.
"Neem het dier serieus als individu"
Kleis, R.; Driessen, C.P.G.
2014-01-01
Ethiek op de boerderij komt het beste uit de verf door samen met dieren nieuwe technologie te ontwikkelen. Filosoof Clemens Driessen, de man van het varkensspel Pig Chase, promoveerde afgelopen week cum laude op Animal deliberation, the co-evolution of technology and ethics on the farm. Resource
Bascoe, Sonnette M.; Davies, Patrick T.; Sturge-Apple, Melissa L.; Cummings, E. Mark
2009-01-01
This study examined children's peer information processing as an explanatory mechanism underlying the association between their insecure representations of interparental and parent-child relationships and school adjustment in a sample of 210 first graders. Consistent with emotional security theory (P. T. Davies & E. M. Cummings, 1994), results…
African Journal of AIDS Research - Vol 11, No 4 (2012)
African Journals Online (AJOL)
Older people living with HIV in Uganda: understanding their experience and needs · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Monica O Kuteesa, Janet Seeley, Robert G Cumming, Joel Negin. http://dx.doi.org/10.2989/16085906.2012.754829 ...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. PAUL CUMMING. Articles written in Sadhana. Volume 42 Issue 5 May 2017 pp 641-653. Improving EEG signal peak detection using feature weight learning of a neural network with random weights for eye event-related applications · ASRUL ADAM ZUWAIRIE IBRAHIM NORRIMA MOKHTAR ...
Huntjens, P.
2011-01-01
This book is based on his PhD research (magna cum laude, 2010) in Complex System Sciences from the University of Osnabrück, Germany. Modern societies are confronted with persistent problems of great complexity and unpredictability. These problems lead to critical situations, such as water and
Collaborative Research to Optimize Warfighter Nutrition (CROWN)
2014-09-01
10.1002/oby.20075. PMID: 23592679 2. Margolis LM, Rood J, Champagne C, Young AJ, Castellani JW. Energy balance and body composition during US Army... Champagne , C., Carpentieri, D. M., Cummings, C. M., Young, A. J., Montain, S. J., & Scisco, J. L. (2014, November). Using an environmental
Guan, Su-Zhen; Ning, Li; Tao, Ning; Lian, Yu-Long; Liu, Ji-Wen; Ng, Tzi Bun
2016-09-01
The intrauterine environment has a significant long-term impact on individual's life, this study was designed to investigate the effect of stress during pregnancy on offspring's learning and memory abilities and analyze its mechanisms from the expression of BDNF and Arc in the hippocampus of the offspring. A rat model of maternal chronic stress during pregnancy was mating from 3rd day during been subjecting to chronic unpredictable mild stress (CUMS). The body weights and behavioral changes were recorded, and plasma corticosterone levels were determined by radioimmunoassay. The learning and memory abilities of the offspring were measured by Morris water maze testing from PND 42. The expression of hippocampal BDNF and Arc mRNA and protein were respectively measured using RT-PCR and Western blotting. Results indicated that an elevation was observed in the plasma corticosterone level of rat model of maternal chronic stress during pregnancy, a reduction in the crossing and rearing movement times and the preference for sucrose. The body weight of maternal stress's offspring was lower than the control group, and the plasma corticosterone level was increased. Chronic stress during pregnancy had a significant impact on the spatial learning and memory of the offspring. The expression of BDNF mRNA and protein, Arc protein in offspring of maternal stress during pregnancy was attenuated and some relationships existed between these parameters. Collectively, these findings disclose that long-time maternal stress during pregnancy could destroy spatial learning and memory abilities of the offspring, the mechanism of which is related to been improving maternal plasma corticosterone and reduced hippocampal BDNF, Arc of offspring rats. Copyright © 2016. Published by Elsevier B.V.
Analytical Solution for the Anisotropic Rabi Model: Effects of Counter-Rotating Terms
Zhang, Guofeng; Zhu, Hanjie
2015-03-01
The anisotropic Rabi model, which was proposed recently, differs from the original Rabi model: the rotating and counter-rotating terms are governed by two different coupling constants. This feature allows us to vary the counter-rotating interaction independently and explore the effects of it on some quantum properties. In this paper, we eliminate the counter-rotating terms approximately and obtain the analytical energy spectrums and wavefunctions. These analytical results agree well with the numerical calculations in a wide range of the parameters including the ultrastrong coupling regime. In the weak counter-rotating coupling limit we find out that the counter-rotating terms can be considered as the shifts to the parameters of the Jaynes-Cummings model. This modification shows the validness of the rotating-wave approximation on the assumption of near-resonance and relatively weak coupling. Moreover, the analytical expressions of several physics quantities are also derived, and the results show the break-down of the U(1)-symmetry and the deviation from the Jaynes-Cummings model.
Okano, Keisuke; Murakami, Yoshiaki; Nakagawa, Naoya; Uemura, Kenichiro; Sudo, Takeshi; Hashimoto, Yasushi; Kondo, Naru; Takahashi, Shinya; Sueda, Taijiro
2016-03-01
Pancreatectomy, including pancreatoduodenectomy and distal pancreatectomy, often causes postoperative pancreatic exocrine insufficiency (PEI). Our aim was to clarify a relationship between remnant pancreatic volume and postoperative PEI. A total of 227 patients who underwent pancreatoduodenectomy or distal pancreatectomy were enrolled in this study. All patients underwent a (13)C-labeled mixed triglyceride breath test to assess pancreatic exocrine function and abdominal dynamic computed tomography for assessing remnant pancreatic volume after pancreatectomy at a median of 7 months postoperatively. The percent (13)CO2 cumulative dose at 7 hours (% dose (13)C cum 7 h) pancreatectomy were performed in 174 (76.7%) and 53 (23.3%) patients, respectively. Of the 227 patients, 128 (56.3%) developed postoperative PEI. Postoperative % dose (13)C cum 7 h was strongly correlated with remnant pancreatic volume (r = .509, P pancreatectomy (P pancreatectomy. Remnant pancreatic volume may predict postoperative PEI in patients who undergo pancreatectomy. Copyright © 2016 Elsevier Inc. All rights reserved.
Institute of Scientific and Technical Information of China (English)
CHEN Chang-Yong
2006-01-01
A scheme for approximately and conditionally teleporting an unknown atomic state via two-photon interaction in cavity QED is proposed. It is the extension of the scheme of Ref. [11] [Phys. Rev. A 69 (2004) 064302], which is based on Jaynes-Cummings model in QED and where only a time point of system evolution and the corresponding fidelity implementing the teleportation are given. In our scheme, the two-photon interaction Jaynes-Cummings model is used to realize the approximate and conditional teleportation. Our scheme does not involve the Bell-state measurement and an additional atom, only requiring two atoms and one single-mode cavity. The fidelity of the scheme is higher than that of Ref. [11]. The scheme may be generalized to not only the teleportation of the state of a cavity mode to another mode by means of a single atom but also the teleportation of the state of a trapped ion.
Mutual preservation of entanglement
International Nuclear Information System (INIS)
Veitia, Andrzej; Jing, Jun; Yu, Ting; Wong, Chee Wei
2012-01-01
We study a generalized double Jaynes–Cummings (JC) model where two entangled pairs of two-level atoms interact indirectly. We show that there exist initial states of the qubit system so that two entangled pairs are available at all times. In particular, the minimum entanglement in the pairs as a function of the initial state is studied. Finally, we extend our findings to a model consisting of multi-mode atom–cavity interactions. We use a non-Markovian quantum state diffusion (QSD) equation to obtain the steady-state density matrix for the qubits. We show that the multi-mode model also displays dynamical preservation of entanglement. -- Highlights: ► Entanglement dynamics is studied in a generalized double Jaynes–Cummings model. ► We show that for certain initial states, the atoms remain entangled at all times. ► We extend the results to the case of multi-mode atom–cavity interactions. ► The model suggest that indirect interaction may help to preserve entanglement.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
A combined sol-gel-cum-hydrothermalmethod has been employed to synthesize novelmonometallic (Mn, Fe, Co) and bimetallic (Co-Fe, Mn-Co, Fe-Mn) nanoparticles loaded onto Al₂O₃−MCM-41. Powder XRD, N2 sorption, field emission scanning electron microscopy (FESEM) and high resolution transmission electron ...
C. de Bruin (Christiaan)
2009-01-01
textabstractHarvey Williams Cushing (1869-1939) was born as the 10th child of a well-educated, puritanical medical family in Cleveland (figure 1). He attended Yale University, graduated cum laude from Harvard Medical School and was trained as a general surgeon at Johns Hopkins under the famous
Kristi Salve kaitses doktoriväitekirja / Mall Hiiemäe
Hiiemäe, Mall, 1937-
2000-01-01
Kristi Salve kaitses 20. dets.̀1999 Tartu Ülikooli kirjanduse ja rahvaluule osakonnanõukogu ees väitekirja : Läänemeresoomlaste traditsiooniline vaimne kultuur : pärimusliikide vahelised seosed ja etnilised suhted / Kristi Salve. Tartu, 1999. 287 lk. Talle omistati doktorikraad folkloristika alal hinnanguga summa cum laude
Resolving the African Development Sclerosis: Two Strategies, No ...
African Journals Online (AJOL)
User
2011-05-20
May 20, 2011 ... Commission for Africa (ECA) and the Organization of African Unity (OAU) ... The Lagos Plan of Action for the Economic Development of Africa, .... change and committed itself to an essential continuation of the status quo in ..... monopoly capitalism than poor countries (Brown and Cummings, 1984: 124).
Cavity quantum electrodynamics with a Rydberg-blocked atomic ensemble
DEFF Research Database (Denmark)
Guerlin, Christine; Brion, Etienne; Esslinger, Tilman
2010-01-01
The realization of a Jaynes-Cummings model in the optical domain is proposed for an atomic ensemble. The scheme exploits the collective coupling of the atoms to a quantized cavity mode and the nonlinearity introduced by coupling to high-lying Rydberg states. A two-photon transition resonantly cou...
Process development for gelatinisation and enzymatic hydrolysis of starch at high concentrations
Baks, T.
2007-01-01
cum laude graduation (with distinction) Enzymatic hydrolysis of starch is encountered in day-to-day life for instance in the dishwasher during removal of stains with detergents or in our mouth during chewing of starch-based foods in the presence of saliva. The reaction is also important for the
African Journals Online (AJOL)
Ukagba, GU. Vol 7 (2010) - Articles Human Nature, Dirty Hands and Social Disorder: A Socio-Political Understanding of the Nigerian Society Abstract PDF · Vol 10 (2014) - Articles Feminism and human genetic engineering: A philosophical cum catholic perspective. Abstract PDF. ISSN: 1597-474X. AJOL African Journals ...
Kuipers, T.A.F.
In this article I give a naturalistic-cum-formal analysis of the relation between beauty, empirical success, and truth. The analysis is based on the one hand on a hypothetical variant of the so-called 'mere-exposure effect' which has been more or less established in experimental psychology regarding
The Iconography of Universities as Institutional Narratives
Drori, Gili S.; Delmestri, Giuseppe; Oberg, Achim
2016-01-01
The coming of "brand society" and the onset of mediatization spur universities to strategize their visual identity and pay particular attention to their icon. Resulting from branding initiatives, university icons are visual self-representations and material-cum-symbolic forms of organizational identity. In this work we ask: What identity…
the role of force in state formation: a comparative analysis
African Journals Online (AJOL)
plt
of globalisation. We now proceed to the organisational characteristics of the military ... discipline cum self-sacrifice and patriotism, which are identified with the soldier, make the ... frame of mind to government, military leaders conceive of society in roughly the ..... See also Huntington, S. Political order in changing societies.
Rana, Digvijay G; Galani, Varsha J
2014-01-01
The effects of antidepressant treatments have traditionally been discussed primarily in terms of effects on noradrenergic and serotonergic systems. Multiple lines of investigation have also explored the role of dopaminergic systems in mental depression. Seed of Mucuna pruriens Linn. (DC) (Leguminoseae) is well-known with dopaminergic action and has several therapeutic applications in folk medicine in curing or managing a wide range of diseases including Parkinsonism. To elucidate the anti-depressent profile and possible dopaminergic modulating action of M. pruriens seeds in various experimental models of depression. In the present study, antidepressant effect of the hydroalcoholic extract of the M. pruriens seeds (MPE) (100 and 200 mg/kg, p.o.) was investigated in the Forced Swimming Test (FST), Tail Suspension Test (TST), and Chronic Unpredictable Mild Stress (CUMS) test in mice. Further, dopaminergic interaction of same doses of MPE in the FST and TST were checked by the administration of a haloperidol (0.1 mg/kg, i.p.) and bromocriptine (2 mg/kg, i.p.) on the 7(th) day of MPE treatment. Effect of MPE on locomotor activity was also checked using actophotometer. MPE produced a significant reduction of the immobility time in the FST and TST. Further, antidepressant action of MPE was significantly inhibited by haloperidol and potentiated by bromocriptine in the FST and TST. 21 days of MPE treatment produced protection in CUMS as indicated by a significant increase of sucrose intake of stressed mice. Locomotor activities of mice were not significantly changed after 1 h and 7(th) day of the MPE treatment. The results of this study indicate that hydroalcoholic extract of MPE have antidepressant action, which may be mediated by an interaction with the dopaminergic system.
obstetric performance of elderly primigravida in jos university
African Journals Online (AJOL)
Administrator
30. Jos Journal of Medicine, Volume 9 No. 1. OBSTETRIC PERFORMANCE OF ... at time of delivery to that of nulliparous women aged 20-34 years old in Jos University ... prospective study was carried out on allprimigravid women with singleton ..... Total. 411. 100.0%. 100.0%. Pregnancy outcome. Frequency. Percent. Cum.
Alegre, Albert; Benson, Mark J.; Pérez-Escoda, Núria
2014-01-01
This study examines the relation between maternal warmth and the internalizing and externalizing problems of early adolescents, and the potential mediation of this relation by emotional insecurity. The hypotheses for the study derive from Cummings and Davies' theory of emotional security. The current study extends the theory to security processes…
Indian Academy of Sciences (India)
the students. There are tennis, badminton, volleyball, and basketball courts on campus, a cricket-cum-football ground nearby, plus indoor table-tennis for those interested in sports. Nearby sal forests, a small patch of scrub vegetation on campus, are the regular haunt of the campus ornithologists and naturalists. Besides this ...
Spin squeezing and Schrödinger cat generation in atomic samples with Rydberg blockade
DEFF Research Database (Denmark)
Opatrný, Tomáš; Mølmer, Klaus
2012-01-01
A scheme is proposed to prepare squeezed states and Schrödinger-cat-like states of the collective spin degrees of freedom associated with a pair of ground states in an atomic ensemble. The scheme uses an effective Jaynes-Cummings interaction which can be provided by excitation of the atoms...
research note the oestrous response and changes in plasma ...
African Journals Online (AJOL)
Refercnces. FAURE, A.S., 1975. Vroeii embrionale verlies weens wanvoeding by Meino skape. M. Sc. (Landbou) Tesis. Universiteit van Stellenbosch. FINDLAY, J.K. & CUMMING, J.A., 1976. lncrease in ovulation rate in sheep following administration of an LHRH analogue. Biol. Repr. 15, I15. HARESIGN, W., FOSTER, J.P., ...
ACHP | News | President Appoints Clement A. Price Vice Chairman of ACHP
appreciation of the nation's diverse cultural heritage will be greatly aided by Dr. Price's expertise." Jersey in 1999. In 2008 Price received the second annual Charles Cummings award from the Trustees of the contributions to the knowledge and appreciation of Newark history. Price will receive the oath of office and
Domain Endurants: An Analysis and Description Process Model
DEFF Research Database (Denmark)
Bjørner, Dines
2014-01-01
We present a summary, Sect. 2, of a structure of domain analysis and description concepts: techniques and tools. And we link, in Sect. 3, these concepts, embodied in domain analysis prompts and domain description prompts, in a model of how a diligent domain analyser cum describer would use them. We...
Decisionmaking in Operation Iraqi Freedom: Removing Saddam Hussein by Force
2010-02-01
have been to abandon diplomacy, but British Prime Minister Tony Blair warned that without a second resolution (or, at least, a serious effort to... Robbins and Jeanne Cummings, “New Doctrine: How Bush Decided That Iraq’s Hussein Must Be Ousted,” Wall Street Journal, June 14, 2002. 58. National
Thorne, Craig R.; DeBlassie, Richard R.
1985-01-01
Cummings (1979), citing evidence from the National Institute of Drug Abuse, reports that one of every eleven adult Americans suffers from a severe addictive problem. Drug addiction is epidemic among teenagers; one of every six teenagers suffers from a severe addictive problem. This paper focuses on adolescent drug/substance abuse. (Author)
Immiseration Capitalism, Activism and Education: Resistance, Revolt and Revenge
Hill, Dave
2012-01-01
This is a panoptic paper in five parts. In Part One, Immiseration Capitalism, I examine the current neoliberal cum neoconservative austerity capitalism and its "class war from above", in particular its resultant relative immiseration and its absolute immiseration, with particular reference to Greece, Ireland, Britain and the USA. In Part…
Oil shale energy and some alternatives in Estonia
International Nuclear Information System (INIS)
Oepik, I.
2002-01-01
An academic lecture delivered by prof. Ilmar Oepik at the Thermal Engineering Department of Tallinn Technical University in Dec. 2000 to mark the 120 semesters since the cum laude diploma of a mechanical engineer discusses about ineffective utilization of oil shale and developing renewable resources as an alternative to oil shale
Designing the Bayous: The Control of Water in the Atchafalaya Basin 1800-1995
1998-01-01
with the levee board and the doctrine of equitable estoppel 166 Designing the Bayous eliminated any requirement by the federal government to pay for...Homer S. Cummings to Secretary of War George H. Oem, Washington, D.C., 5 September 1933. The doctrine of equitable estoppel asserts that a party’s
Sexually Dimorphic Changes of Hypocretin (Orexin) in Depression.
Lu, Jing; Zhao, Juan; Balesar, Rawien; Fronczek, Rolf; Zhu, Qiong-Bin; Wu, Xue-Yan; Hu, Shao-Hua; Bao, Ai-Min; Swaab, Dick F
2017-04-01
Neurophysiological and behavioral processes regulated by hypocretin (orexin) are severely affected in depression. However, alterations in hypocretin have so far not been studied in the human brain. We explored the hypocretin system changes in the hypothalamus and cortex in depression from male and female subjects. We quantified the differences between depression patients and well-matched controls, in terms of hypothalamic hypocretin-1 immunoreactivity (ir) and hypocretin receptors (Hcrtr-receptors)-mRNA in the anterior cingulate cortex (ACC) and dorsolateral prefrontal cortex. In addition, we determined the alterations in the hypocretin system in a frequently used model for depression, the chronic unpredictable mild stress (CUMS) rat. i) Compared to control subjects, the amount of hypocretin-immunoreactivity (ir) was significantly increased in female but not in male depression patients; ii) hypothalamic hypocretin-ir showed a clear diurnal fluctuation, which was absent in depression; iii) male depressive patients who had committed suicide showed significantly increased ACC Hcrt-receptor-2-mRNA expression compared to male controls; and iv) female but not male CUMS rats showed a highly significant positive correlation between the mRNA levels of corticotropin-releasing hormone and prepro-hypocretin in the hypothalamus, and a significantly increased Hcrt-receptor-1-mRNA expression in the frontal cortex compared to female control rats. The clear sex-related change found in the hypothalamic hypocretin-1-ir in depression should be taken into account in the development of hypocretin-targeted therapeutic strategies. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.
2013-09-01
Virginia Cryan Essex Junction VT R-PCS-8187 David and Dale Piper Middlebury VT R-PCS-2224 Manuel Cueto Colchester VT R-PCS-5615 Dan Pipes Fairfield... Cruz South Burlington VT R-PCOY-0218 Mohet Cruz South Burlington VT R-PCOY-0180 Don Cummings South Burlington VT R-PCOY-0113 Rene Cusson South
Die uitbouing van die Bybelse kanon in antieke Judaïsme en die ...
African Journals Online (AJOL)
31 Jul 2015 ... die oer-Christelike boodskap tot by sy Ou Testamentiese wortels, die geskrifte van Israel wat cum grano salis die 'Bybel' van die oer-Christendom geword het en die blywende verwysingspunt van die Christelike boodskap is. Erkenning. Hierdie artikel is vertaal na Afrikaans deur Prof. Jan G. van der Watt.
Toward a Historical Archaeology of West African Borderlands ...
African Journals Online (AJOL)
Whereas, the ethnographic cum archival study of West African borderlands abounds in the literature, there is the dearth of the comparative analysis of these sources in tandem with the archaeological findings of material culture. Thus, this paper seeks to open up a new dialogue on the importance of borderlands studies in ...
Lim, Ee-Lon; Hew, Khe Foon
2014-01-01
E-books offer a range of benefits to both educators and students, including ease of accessibility and searching capabilities. However, the majority of current e-books are repository-cum-delivery platforms of textual information. Hitherto, there is a lack of empirical research that examines e-books with annotative and sharing capabilities. This…
Opportunities Green Roofs Can Offer Ghanaians and their Cities
African Journals Online (AJOL)
Lone Star College System
2015-08-17
Aug 17, 2015 ... rising faster than the daily maximum thereby decreasing the comfort index of city dwellers. Electricity ... also on the rise. Green roofs have ..... by 6%. In Central Florida in the U.S., Cummings et al. .... levels, provision of habitat for animals and plants and .... representation of the Mediterranean Sea. Bull.
Histopathological study on the effect of rice herbicides on grass carp ...
African Journals Online (AJOL)
user
2011-02-14
Feb 14, 2011 ... observe the impact of herbicides on the histopathology of the fish, the fingerlings were collected from the field trenches ... is almost non-existent in India; the reasons being that increasing ... intensive rice-cum-fish culture offered the opportunity for ..... Toxicity of herbicides to Malaysian rice field fish. In: Proc.
The imperative of a new social contract through the technology of mind
African Journals Online (AJOL)
The progress of neuro/computer science makes it clear that sometime during the 21st century, man as a technology-driven being will master the technologies of mind and of life. Man will build machines more intelligent than man and modify human brains and bodies to increase intelligence. This scientific cum ...
SOUTH AFRICA AND THE WAR AGAINST JAPAN 1941-1945
African Journals Online (AJOL)
Second World War contain few details of South . Africans who served in the Far East. Commander. H.R. Gordon-Cumming's unpublished Official His- tory of the SA Naval Forces in the Second World. War 1939-1945 includes narratives of the two South. African ships which served in the Far East, HMSAS. BARBRAKE.
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics. M M Golshan. Articles written in Pramana – Journal of Physics. Volume 80 Issue 5 May 2013 pp 785-796. Collapse revival behaviour of the entanglement between V-type three-level atoms and two-mode photons in nonlinear Jaynes–Cummings model · M Mohjoei M M ...
Ergonomic Based Design and Survey of Elementary School Furniture
Maheshwar; Jawalkar, Chandrashekhar S.
2014-01-01
This paper presents the ergonomic aspects in designing and prototyping of desks cum chairs used in elementary schools. The procedures adopted for the assessment included: the study of existing school furniture, design analysis and development of prototypes. The design approach proposed a series of adjustable desks and chairs developed in terms of…
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
We have exactly solved a model of equidistant cascade four-level system interacting with a single-mode radiation field both semiclassically and quantum mechanically by exploiting its similarity with Jaynes-Cummings model. For the classical field, it is shown that the Rabi oscillation of the system initially in the first level ...
Huang, Futao
2015-01-01
A review of recent literature suggests that, although academics in several countries (such as Japan, Korea and Germany) now allocate more of their time to research, service activities and administration than they had in the early 1990s (Teichler, Arimoto, and Cummings, 2013), the majority of university professors still spend the largest proportion…
Microscopic theory of photon-correlation spectroscopy in strong-coupling semiconductors
Energy Technology Data Exchange (ETDEWEB)
Schneebeli, Lukas
2009-11-27
While many quantum-optical phenomena are already well established in the atomic systems, like the photon antibunching, squeezing, Bose-Einstein condensation, teleportation, the quantum-optical investigations in semiconductors are still at their beginning. The fascinating results observed in the atomic systems inspire physicists to demonstrate similar quantum-optical effects also in the semiconductor systems. In contrast to quantum optics with dilute atomic gases, the semiconductors exhibit a complicated many-body problem which is dominated by the Coulomb interaction between the electrons and holes and by coupling with the semiconductor environment. This makes the experimental observation of similar quantum-optical effects in semiconductors demanding. However, there are already experiments which have verified nonclassical effects in semiconductors. In particular, experiments have demonstrated that semiconductor quantum dots (QDs) can exhibit the single-photon emission and generation of polarization-entangled photon pairs. In fact, both atom and QD systems, embedded within a microcavity, have become versatile platforms where one can perform systematic quantum-optics investigations as well as development work toward quantum-information applications. Another interesting field is the strong-coupling regime in which the light-matter coupling exceeds both the decoherence rate of the atom or QD and the cavity resulting in a reversible dynamics between light and matter excitations. In the strong-coupling regime, the Jaynes-Cummings ladder is predicted and shows a photon-number dependent splitting of the new dressed strong-coupling states which are the polariton states of the coupled light-matter system. Although the semiclassical effect of the vacuum Rabi splitting has already been observed in QDs, the verification of the quantum-mechanical Jaynes-Cummings splitting is still missing mainly due to the dephasing. Clearly, the observation of the Jaynes-Cummings ladder in QDs
Local hyperthermia of cervical N2/N3 lymph node metastases - a phase-I/II-study
International Nuclear Information System (INIS)
Stahl, H.; Wust, P.; Graf, R.; Loeffel, J.; Bier, J.; Riess, H.; Jahnke, V.; Felix, R.
1997-01-01
50 patients with primary advanced, recurrent or persistent N2/N3 lymph node metastases were treated with microwave hyperthermia in addition to their standard therapy (radiotherapy or radiochemotherapy). For the thermometry, closed-end catheters were implanted in the cervical lesions under CT monitoring. Temperature/time and temperature/position curves were analysed with regard to power density, effective perfusion, tissue depth, index temperatures T 90 , T 50 , T 20 , cum min T 60 ≥40.5 C, and equ min T 90 at 43 C. Radiation dose, total irradiation time and chemotherapy were also recorded as therapy parameters. Repeated CT scans for assessing response were taken for a subgroup of 32 patients following primary potentially curative radiotherapy (with and without chemotherapy) and local hyperthermia. All therapy parameters were subjected to a variance analysis with regard to response. At a tissue depth of 3 cm, relative and absolute power densities were on average of 50% less than at the surface. Therapeutic temperature increases of more than 4 C (i.e. more than 41 C) were not reached at tissue depths greater than 5 cm. The effective perfusion under local hyperthermia is significantly higher than under basal conditions. The mean T 90 was 39.9 C, and the mean T 20 value was 42.3 C. T 90 , cum min T 90 ≥40.5 C, equ min T 90 43 C, radiation dose and total irradiation time have a significant influence on response. The tumor volume correlates negatively with response, and this results in the thermal gradients correlating negatively with response and survival. The quality of the temperature distribution, represented by the value of cum min T 90 ≥40.5 C, showed a tendency to correlate positively with the survival in the subgroup of patients who underwent primary therapy. (orig./AJ) [de
The Application of Statistical Turbulence Theory to Convective Instabilities.
1986-11-01
WHITE SANDS MISSILE RANGE DEPARTMENT OF THE AIR FORCE ATTN: STEWS -TE-N K CUMMINGS AIR FORCE CTR FOR STUDIES & ANALYSIS DEPARTMENT OF THE NAVY ATTN...INC ATTN: R BUCKNER ATTN: J DEVORE " ATTN: J THOMPSON TOYON RESEARCH CORP ATTN: W SCHLUETER ATTN: J GARBARINO ATTN: J ISE R & D ASSOCIATES ATTN: B LAMB
Reaction and Transport Processes Controlling In Situ Chemical Oxidation of DNAPLs
2006-11-01
Contact Areas. Ground Water, 36(4):495-502. Atlas , R.M., and R. Bartha (1987). Microbial Ecology , Benjamin/Cummings Publishing Company, Menlo Park...relatively few species ( Atlas and Bartha 1987). If selection for bioremediation processes following oxidation does occur, competition for substrates...Experiments.....................................................................3-23 3.6.3. Microbial Culture Preparation for Evaluation of Coupling
African Journals Online (AJOL)
Cumming, DEA. Vol 13, No 2 (1996) - Articles Effect of management factors on tiller dynamics in tall fescue: numbers of tillers reaching reproductive maturity. Abstract · Vol 13, No 2 (1996) - Articles Effect of management factors on tiller dynamics in tall fescue: tiller initiation. Abstract · Vol 13, No 2 (1996) - Articles Effect of ...
A combination of electrical resistivity and cone penetration test ...
African Journals Online (AJOL)
The conductive unconsolidated clayey soil / peat with the resistivity values 0.9 – 10 Ωm cum CPT values 2 to 4 kg/cm2 experienced along noticeable depressed parts could have contributed to the cracking and differential settlement of the residential buildings in the study area. However, boring via percussion drilling should ...
Michael, Kurt D.
2006-01-01
Kurt Michael is an associate professor in the Department of Psychology at Appalachian State University (ASU) where he teaches history and systems of psychology, abnormal psychology, child psychopathology, and interventions for children and adolescents. He received his BA (cum laude) from the University of Colorado at Boulder and his MS and PhD in…
Computer aided cooling curve analysis for Al-5Si and Al-11Si alloys ...
African Journals Online (AJOL)
The effect of grain refiner, modifier, and combination of grain refiner cum modifier was studied on Al-5Si and Al-11Si alloys using computer aided cooling curve analysis. For combined grain refinement and modification effect, Al-Ti-B-Sr single master alloy was developed that acted as both grain refiner and modifier.
Evolution of Integrated Open Aquaculture Systems in Hungary: Results from a Case Study
Directory of Open Access Journals (Sweden)
József Popp
2018-01-01
Full Text Available This article presents the history of integrated farming in aquaculture through a Hungarian case study. The development of Hungarian integrated aquaculture is aligned with global trends. In the previous millennium, the utilization of the nutrients introduced into the system was the main aspect of the integration. In Hungary, technologies that integrated fish production with growing crops and animal husbandry appeared, including for example: large-scale fish-cum-rice production; fish-cum-duck production; and integrated pig-fish farming which were introduced in the second half of the 20th century. Today, the emphasis is on integrating the use of the kind of feed where the main goal is to minimize nutrient loads in the surrounding natural ecosystems and to maximize the utilization of the unit’s water resources. The various modern integrated freshwater aquaculture systems, such as intensive fish production combined with wetland, recirculation aquaculture system and multi-functional aquaculture, have proved their viability. However, the future opportunities for these systems have not always been properly recognized and acknowledged when the future of European aquaculture is discussed.
Linguistic research in the empirical paradigm as outlined by Mario Bunge.
Zielińska, Dorota
2016-01-01
In view of the critique of the methodology of the dominant interdisciplinary research involving language studies as the main component, in particular clinical linguistics, Cummings (Pragmatic disorders. Perspectives in pragmatics, philosophy and psychology, vol 3. Springer, Dordrecht, 2014) proposes that "It is perhaps appropriate at this point to move the debate onto non-empirical grounds." In Cummings (2014: 113) she starts such a debate on the grounds of the philosophy of language and pragmatics. In this article, I propose to expand that debate by including the input of the philosophy of science. I start the discussion by presenting the way one may carry out language research in the paradigm of empirical sciences from the perspective outlined in Bunge (Scientific research. Strategy and philosophy. Berlin, Springer, 1967; Method, model and matter (synthese library). D. Reidel Publishing Company, Dordrecht, 1973; Emergence and convergence: qualitative novelty and the unity of knowledge. University of Toronto Press, Toronto, 2003) and constrained by Altmann's (Towards a theory of language. Glottometrica 1:1-25, 1978) assumption about self-originating and self-regulatory nature of language.
International nurse recruitment in India.
Khadria, Binod
2007-06-01
This paper describes the practice of international recruitment of Indian nurses in the model of a "business process outsourcing" of comprehensive training-cum-recruitment-cum-placement for popular destinations like the United Kingdom and United States through an agency system that has acquired growing intensity in India. Despite the extremely low nurse to population ratio in India, hospital managers in India are not concerned about the growing exodus of nurses to other countries. In fact, they are actively joining forces with profitable commercial ventures that operate as both training and recruiting agencies. Most of this activity is concentrated in Delhi, Bangalore, and Kochi. Gaps in data on nursing education, employment, and migration, as well as nonstandardization of definitions of "registered nurse," impair the analysis of international migration of nurses from India, making it difficult to assess the impact of migration on vacancy rates. One thing is clear, however, the chain of commercial interests that facilitate nurse migration is increasingly well organized and profitable, making the future growth of this business a certainty.
Time-dependent nonlinear Jaynes-Cummings dynamics of a trapped ion
Krumm, F.; Vogel, W.
2018-04-01
In quantum interaction problems with explicitly time-dependent interaction Hamiltonians, the time ordering plays a crucial role for describing the quantum evolution of the system under consideration. In such complex scenarios, exact solutions of the dynamics are rarely available. Here we study the nonlinear vibronic dynamics of a trapped ion, driven in the resolved sideband regime with some small frequency mismatch. By describing the pump field in a quantized manner, we are able to derive exact solutions for the dynamics of the system. This eventually allows us to provide analytical solutions for various types of time-dependent quantities. In particular, we study in some detail the electronic and the motional quantum dynamics of the ion, as well as the time evolution of the nonclassicality of the motional quantum state.
Treatment of tributyl phosphate wastes by extraction cum pyrolysis process
International Nuclear Information System (INIS)
Deshingkar, D.S.; Ramaswamy, M.; Kartha, P.K.S.; Kutty, P.V.E.; Ramanujam, A.
1989-01-01
For the treatment of spent tri n-butyl phospate (TBP) wastes from Purex process, a method involving extraction of TBP with phosphoric acid followed by pyrolysis of TBP - phosphoric acid phase was investigated. The process was examined with respect to simulated waste, process solvent wastes and aged organic waste samples. These studies seem to offer a simple treatment method for the separation of bulk of diluent from spent solvent wastes. The diluent phase needs further purification for reuse in reprocessing plant; otherwise it can be incinerated. (author). 18 refs., 3 tabs., 6 figs
National seminar on non-destructive evaluation techniques: proceedings cum souvenir
International Nuclear Information System (INIS)
Dutta, N.G.; Kulkarni, P.G.; Purushotham, D.S.C.
1994-01-01
This volume contains selected papers presented at the National Seminar on Non-Destructive Evaluation Techniques held at Bhabha Atomic Research Centre, Mumbai during December 8-9, 1994. The papers covered a wide spectrum of non-destructive evaluation activities including that for quality assurance of various nuclear components and structures with the focal theme being computerization and robotics. The papers relevant to INIS are indexed separately
Cummings Memorial Lecture - 1975. The market basket: food for thought.
Deichman, W B
1975-06-01
The world food crisis is as critical today as when it was debated at the 1974 World Food Conference in Rome. Since the United States and Canada-and to a lesser extent, Australia and New Zealand-lead in the production of corn, wheat and soybeans, the North American "bread basket" has become the "market basket" of the world. For welfare, economic, and political reasons, our energies, resources, and deliberations must be expanded toward optimum production of wholesome food products. I do not recommend that we permit food additives in "questionably" safe or excessive concentrations in our agricultural products. I do recommend, however, that tolerance limits for food additives be established based on a comprehensive review of all contributing factors-the world food crisis and the rational interpretation of both positive and negative animal data as they relate to man. As Dr. Herbert Stokinger put it so aptly: "Avoid the establishment of unnecessarily severe standards." 2. Funds for research and teaching of food and nutrition should be greatly increased, so that all who can read and write may be made aware of the daily dietary requirements for the maintenance of good health. 3. Unsubstantiated scare tactics in publications of the scientific and lay press can only lead to well-intended but often emotionally-inspired restrictions, ordinances, and laws. Such decisions are likely to either under- or over-define the requirements and standards for food additives and other chemicals which are important to the well-being of the populace.
Employment-cum-Training Contracts in France: The 1975-85 Record.
Caspar, M.-L.
1988-01-01
The author evaluates a program whereby the French government subsidized employers to organize training for youth under employment contracts. Youth with above average employment opportunties benefited. Failure to serve the most disadvantaged youth is attributed to (1) individual youth choices, (2) screening by program administrators, and (3)…
Proceedings of the ISEAC international symposium cum workshop on electrochemistry
International Nuclear Information System (INIS)
Aggarwal, Suresh K.; Guin, Saurav K.; Kamat, Jayshree V.; Gupta, Ruma
2011-01-01
This symposium highlights the role of chemistry to find out the solution of some global problems. Among the leading branches of chemistry, the foot prints of electrochemistry can be seen in a variety of fields for both fundamental studies and methodological applications. Electrochemistry and allied science has already exhibited its potential to meet the world's need starting from health and medicine, environment, nanofabrication to alternate energy resources. Articles relevant to INIS are indexed separately
50 CFR 32.8 - Areas closed to hunting.
2010-10-01
... 16936. 2748 Oct. 1, 1947 Illinois Honshoe Lake, Alexander County 3 CFR, 1947 Supp. 12 FR 6521. Sept. 9... Wildlife Regudge 21 FR 6513. 2370 Oct. 16, 1939 Virginia Back Bay National Wildlife Refuge 3 CFR, Cum. Supp... .......do Back Bay National Wildlife Refuge 27 FR 104; 27 FR 858. Aug. 21, 1963 .......do Mackay Island...
Indian Academy of Sciences (India)
Thus 1746 m cum of water consisting of excess storage and excess inflows was used over and above the ... 1972 indicates that (i) the depletion period inflows are correlated to the filling period inflows and planning should be based on appropriate estimates of depletion period inflows; (ii) an RF of 0.85 or above can be ...
Normal D-Region Models for Weapon Effects Code
1985-09-18
ATTN: DNA REP) ATTN: DRSMI-YSO J GAMBLE ATTN: JLKS ATTN: JPTM US ARMY WHITE SANDS MISSILE RANGE ATTN: JPTP ATTN: STEWS -TE-N K CUMMINGS NATIONAL SECURITY... LAMB ATTN: G SMITH ATTN: F GILMORE ATTN: J VICKREY ATTN: M GANTSWEG ATTN: R LEADABRAND ATTN: W KARZAS ATTN: R TSUNODA ATTN: W CHESNUT a R & D ASSOCIATES
Information Management for an Automated Battlefield Command and Control System
1980-05-01
DD) I u FJ i EDITION OF" I NOV 65, IS OSSOLIETIES"-- iUnclassified1SECURITY CLASSIFICATION OF THIS PAGE (When Data Entered) t// II. Unclassified...DIRELIOk oý INSTIhJTIONAL RSCH I USA AIP DEFENSE SCHOUL ATTN: AISA -CU)-MS I iJSAADS-LIBRARY-OUCUMLNTS) I USA AIW DEFENSE ZL~N HDAU IN: fILLS
south african naval personnel seconded to the royal navy during
African Journals Online (AJOL)
Cdr H. R. Gordon-Cumming has written that in the early days of the Second World War large drafts of RNVR (SA) officers and ratings were taken by the few British Warships which called at. Simonstown and Durban to make up their war complements and that later on 'Union nationals took part in nearly every major naval ...
1993-12-01
the ability to pull up sharply to avoid hitting hills. To maintain the ability to pull up at the level desired by the Air Force (2.4 g’s, or...by whadmss. la& akon ?dmuenua;c Alniinal Fm’mmname. Small Rcducszms in Samlmlactima in Ssghcua DagUdam in as Taedaclm Goali Cum Impac Taclmncul
Ionization and excitation of some atomic targets and metal oxides by ...
Indian Academy of Sciences (India)
son et al [2] performed experimental-cum-model studies on the VUV excitation– emission processes. The measured .... is rather small in many cases so that a choice ∆ = Eth would make Vabs excessively large. Hence the ... For almost all the targets investigated by us [10–14] this choice of ∆ results in a general accord of our ...
Centrifuge experiments for removal of aluminium turbidity from Dhruva heavy water
International Nuclear Information System (INIS)
Shetiya, R.S.; Unny, V.K.P.; Nayak, A.P.
1989-01-01
Aluminium turbidity and associated radioactivity was observed in the moderator cum coolant system of Dhruva during initial power operation. Ion exchange resin beds of the purification system were not able to remove aluminium turbidity and radioactivity of system heavy water. Centrifuge technique was used as a convenient alternative method to remove the turbidity and radioactivity. (author)
Principals of Design for High Performing Organizations: A Suggested Research Program. Appendixes
1994-03-01
unit trust and organizational effectiveness (Cummings), biases in management perceptions of organization and environmental characteristics ( Starbuck ...including subcontracting, franchises , work-family issues (Bailyn), the hierarchy problem in organization design (Ettlie), linkages among HRM activities and...was the call for longitudinal studies. Bartunek called for longitudinal field studies and Starbuck noted the need for parallel case studies involving
Further X-Ray Observations of EXO 0748-676 in Quiescence: Evidence for a Cooling Neutron Star Crust
2010-07-01
the unambiguous determination of the orbital period of the binary (Parmar et al. 1986; Wolff et al. 2009). At the time of its discovery , EXO 0748–676...L41 Jonker P. G., 2008, in C. Bassa, Z. Wang, A. Cumming, & V. M. Kaspi eds, 40 Years of Pulsars : Millisecond Pulsars , Magnetars and More, AIP Conf
Design and Study of a Low-Cost Laboratory Model Digital Wind Power Meter
Radhakrishnan, Rugmini; Karthika, S.
2010-01-01
A vane-type low-cost laboratory model anemometer cum power meter is designed and constructed for measuring low wind energy created from accelerating fluids. The constructed anemometer is a device which records the electrical power obtained by the conversion of wind power using a wind sensor coupled to a DC motor. It is designed for its…
Dirac bi-spinor entanglement under local noise and its simulation by Jaynes-Cummings interactions
Bittencourt, Victor A. S. V.; Bernardini, Alex E.
2017-08-01
A description of the effects of the local noise on the quantum entanglement constraining the internal degrees of freedom of Dirac bi-spinor structures driven by arbitrary Poincaré invariant potentials is proposed. Given that the Dirac equation dynamics including external potentials can be simulated by a suitable four level trapped ion setup, quantum entanglement of two-qubit ionic states with quantum numbers related to the total angular momentum and to its projection onto the direction of the external magnetic field (used for lift the ions degeneracy), are recovered by means of a suitable ansatz. This formalism allows the inclusion of noise effects, which leads to disentanglement in the four level trapped ion quantum system. Our results indicate the role of interactions in bi-spinor entanglement, as well as the description of disentanglement in ionic states under local noises. For a state prepared initially in one of the ionic levels, local noise induces entanglement sudden death followed by sudden revivals driven by the noiseless dynamics of the state. Residual quantum correlations are observed in the intervals where such state is separable. Schrödinger cat and Werner states partially loose their initial entanglement content due to the interaction with the noisy environment but presenting entanglement oscillations without sudden death. Because Dirac equation describes low energy excitations of mono layer and bi-layer graphene, the formalism can also be applied to compute, for instance, electron-hole or electron/electron entanglement in various circumstances.
Hydroxyurea-Induced Replication Stress
Directory of Open Access Journals (Sweden)
Kenza Lahkim Bennani-Belhaj
2010-01-01
Full Text Available Bloom's syndrome (BS displays one of the strongest known correlations between chromosomal instability and a high risk of cancer at an early age. BS cells combine a reduced average fork velocity with constitutive endogenous replication stress. However, the response of BS cells to replication stress induced by hydroxyurea (HU, which strongly slows the progression of replication forks, remains unclear due to publication of conflicting results. Using two different cellular models of BS, we showed that BLM deficiency is not associated with sensitivity to HU, in terms of clonogenic survival, DSB generation, and SCE induction. We suggest that surviving BLM-deficient cells are selected on the basis of their ability to deal with an endogenous replication stress induced by replication fork slowing, resulting in insensitivity to HU-induced replication stress.
Use of Respirometry To Determine the Effect of Nutrient Enhancement on JP-8 Biodegradability.
1995-11-27
present, environmental conditions, and certainly indigenous microbial communities present ( Atlas and Bartha , 1993). In general, biodegradation can be...Richard Bartha . Microbial Ecology : Fundementals and Applications. Redwood City, CA: The Benjamin Cummings Publishing Company, Inc, 1993. Autry...products caused by microorganisms or their enzymes ( Atlas and Bartha , 1993). It is greatly influenced by the nature and amount of the target compound
Effects of Instant Messaging on Recall During Video-Mediated Briefings
2012-04-01
communication (e.g. email ) while maintaining the conversation will have a clear impact on the conversation. An example of intermediate...important information (e.g. most email ) (Song et al., 2007), which also applies to distracting tickertape displays. This is discouraged primarily... Multitasking Generation. In: Time 10 April, 46- 53 Cummings, M. L. and Guerlain, S. (2004) Human Performance, Situation Awareness and Automation
Stress-induced hyperthermia in translational stress research
Vinkers, C.H.; Penning, R.; Ebbens, M.M.; Helhammer, J.; Verster, J.C.; Kalkman, C.J.; Olivier, B.
2010-01-01
The stress-induced hyperthermia (SIH) response is the transient change in body temperature in response to acute stress. This body temperature response is part of the autonomic stress response which also results in tachycardia and an increased blood pressure. So far, a SIH response has been found in
A heavy ion pre-injector for the ICT-ion implanter
International Nuclear Information System (INIS)
Bhattacharya, P.K.; Gaonkar, S.; Wagh, A.G.; Hattangadi, V.A.; Sarma, N.
1976-01-01
A cheap and versatile hollow cathode electron bombardment ion source system including its ion extraction-cum-focussing assembly for obtaining intense heavy ion beams of solids and gases is described. The extractor region is designed to include more than 15deg total beam angle of extracted beam for producing focused ion current densities upto 60mA/cm 2 to serve as a pre-injector for the ICT(insulated core transformer) type ion implanter. The extraction-cum-focussing lens is a low aberration strong Einzel lens system of all araldite and metal construction with optical elements of proper quality and location to suit low voltage injection and subsequent ion analysis. The injection can be selected anywhere between 2 to 10 keV for singly charged ions with typical extraction currents of 500/μ, using a ring anode and a source aperture of 20 mil. Einzel lens focussing assembly allows continuous adjustment of the beam convergence to about 5deg and the beam size to approximately 5mm in diameter with about 10 KV central electrode potential. Test results of source characteristics for both the accelerating and decelerating model of beam formation have been made. (author)
Synthesis of graphene oxide-copper molybdate (GO-CuM) nanocomposites for photocatalytic application
Singh, Gajendar; Bhargava, V. Sai; Sharma, Manu
2018-05-01
Transition metal molybdates (TMBs) MMoO4 (M=Ni, Cu, Fe, Zn, Co, etc.) based nanocomposites have been considered as remarkable materials in the field of electronics, optics, catalysis, supercapicitors and energy storage devices. Nanocomposites of TMBs with graphene oxide have also been chosen as an effective material in photocatalytic application. GO-CuM nanocomposites were synthesized by ultra-sonication method at RT, followed by reflux route for preparation of CuM and GO by modified Hemmer's method. As prepared nanocomposites were characterized using analytical techniques such as PXRD, SEM, FT-IR and UV-Visible spectroscopy. The enhanced photocatalytic activity of Methylene blue (MB) dye was observed by GO-CuM nanocomposites as compared to pure copper molybdate. GO-CuM nanocomposites show high photodegradation rate (0.094 min-1) whereas CuM was degraded only 30 % with the rate of 0.0029 min-1. The high photocatalytic efficiency is due to the presence of graphene oxide that helps to delay the charge recombination in photocatalytic reaction The effect of the different amount of graphene oxide on the photocatalytic activity of as prepared photocatalyst has also been investigated.
Guan, Zhibo; Wang, Miao; Cai, Yi; Yang, Hongmei; Zhao, Min; Zhao, Chunjie
2018-06-01
Sijunzi decoction, a renowned Chinese prescription has long been utilized to treat gastrointestinal problems. In the context of this research work, the use of Ultra high performance liquid chromatography combined with Fourier transform ion cyclotron resonance mass spectrometry was made to separate and characterize the components of Sijunzi decoction. The performance of Liquid chromatography was carried out on a C8 column (150 mm × 2.1 mm, 1.8 μm); moreover, the mobile phase were consisted of 0.2% formic acid (A) and acetonitrile (B). In accordance with the findings, characterization of 120 chemical compounds was performed by liquid chromatography with mass spectrometry. The key constituents among them included ginsenosides (in Radix Ginseng), 16 triterpene carboxylic acids (in Poria), sesquiterpenes (in Rhizoma Atractylodis Macrocephalae), triterpenesaponins (in Glycyrrhizae Radix et Rhizoma Praeparata Cum Melle) as well as flavonoids (in Glycyrrhizae Radix et Rhizoma Praeparata Cum Melle) in Sijunzi decoction. This research developed the bases for prospective research associated with Sijunzi decoction, together with being expected to be useful to rapidly extract and characterize the constituents in other Traditional Chinese herbal formulations. Copyright © 2018 Elsevier B.V. All rights reserved.
Circuit QED lattices: Towards quantum simulation with superconducting circuits
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Sebastian [Institute for Theoretical Physics, ETH Zurich, 8093, Zurich (Switzerland); Koch, Jens [Department of Physics and Astronomy, Northwestern University, Evanston, IL, 60208 (United States)
2013-06-15
The Jaynes-Cummings model describes the coupling between photons and a single two-level atom in a simplified representation of light-matter interactions. In circuit QED, this model is implemented by combining microwave resonators and superconducting qubits on a microchip with unprecedented experimental control. Arranging qubits and resonators in the form of a lattice realizes a new kind of Hubbard model, the Jaynes-Cummings-Hubbard model, in which the elementary excitations are polariton quasi-particles. Due to the genuine openness of photonic systems, circuit QED lattices offer the possibility to study the intricate interplay of collective behavior, strong correlations and non-equilibrium physics. Thus, turning circuit QED into an architecture for quantum simulation, i.e., using a well-controlled system to mimic the intricate quantum behavior of another system too daunting for a theorist to tackle head-on, is an exciting idea which has served as theorists' playground for a while and is now also starting to catch on in experiments. This review gives a summary of the most recent theoretical proposals and experimental efforts. (copyright 2013 by WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
The Yeast Environmental Stress Response Regulates Mutagenesis Induced by Proteotoxic Stress
Shor, Erika; Fox, Catherine A.; Broach, James R.
2013-01-01
Conditions of chronic stress are associated with genetic instability in many organisms, but the roles of stress responses in mutagenesis have so far been elucidated only in bacteria. Here, we present data demonstrating that the environmental stress response (ESR) in yeast functions in mutagenesis induced by proteotoxic stress. We show that the drug canavanine causes proteotoxic stress, activates the ESR, and induces mutagenesis at several loci in an ESR-dependent manner. Canavanine-induced mutagenesis also involves translesion DNA polymerases Rev1 and Polζ and non-homologous end joining factor Ku. Furthermore, under conditions of chronic sub-lethal canavanine stress, deletions of Rev1, Polζ, and Ku-encoding genes exhibit genetic interactions with ESR mutants indicative of ESR regulating these mutagenic DNA repair processes. Analyses of mutagenesis induced by several different stresses showed that the ESR specifically modulates mutagenesis induced by proteotoxic stress. Together, these results document the first known example of an involvement of a eukaryotic stress response pathway in mutagenesis and have important implications for mechanisms of evolution, carcinogenesis, and emergence of drug-resistant pathogens and chemotherapy-resistant tumors. PMID:23935537
1995-12-01
1178-1180 (1991). Atlas , Ronald M. and Richard Bartha . Microbial Ecology : Fundamentals and Applications. 3d ed. Redwood City CA: The Benjamin/Cummings...technique called bioventing. In cold climates, in situ bioremediation is limited to the summer when soil temperatures are sufficient to support microbial ...actively warmed the soil -- warm water circulation and heat tape; the other passively warmed the plot with insulatory covers. Microbial respiration (02
Sorption of the Aircraft Deicing Fluid Component Methyl-Benzotriazole in Soil
1999-03-01
Atlas , Ronald M., Bartha , Richard, Microbial Ecology : Fundamentals and Applications. Benjamin Cummings: Redwood City, 1993. Ball, William P., Roberts...cell; transfer of substances from one medium to another [ Atlas and Bartha , 533; Fetter, 117]. (2) The process by which a compound in solution or...oxygen, low redox potential. [ Atlas and Bartha , 534; Schwarzenbach et al, 410] Aromatic compound - Carbon skeletons containing aromatic benzene ring and
The Impact of Automation Reliability and Operator Fatigue on Performance and Reliance
2016-09-23
Cummings et al., 2007). Automation designed to assist operators in overload situations may promote operator disengagement during periods of low...Calhoun et al., 2011). This testbed offers several tasks designed to emulate the cognitive demands that an operator managing multiple UAVs is likely...reliable (Cronbach’s α = 0.94) measure of affective and cognitive components of trust in automation. Items gauge confidence in an automation and
Identifying and Quantifying Emergent Behavior Through System of Systems Modeling and Simulation
2015-09-01
the similarities and differences between Agent Based Modeling ( ABM ) and Equation Based Modeling (EBM). Both modeling approaches “simulate a system by...entities. For the latter difference, EBM focuses on the system level observables, while ABM defines behaviors at the individual agent level and observes...EMERGENT BEHAVIOR THROUGH SYSTEM OF SYSTEMS MODELING AND SIMULATION by Mary Ann Cummings September 2015 Dissertation Supervisor: Man-Tak Shing
Cladding of Ni superalloy powders on AISI 4140 steel with concentrated solar energy
Energy Technology Data Exchange (ETDEWEB)
Fernandez, B.J.; Lopez, V.; Vazquez, A.J. [Centro Nacional de Investigaciones Metalurgicas, CENIM-CSIC, Madrid (Spain); Martinez, D. [Plataforma Solar de Almeria, Tabernas Almeria (Spain)
1998-05-12
The present work deals with Ni alloy cladding on AISI 4140 steel samples made with high power density concentrated solar beams. The quality of the cladding is high concerning the adherence, low dilution and high hardness of the coating. Some considerations are presented concerning the future of high power density beams related to SUrface Modification of Metallic mAterials with SOLar Energy (SUMMA cum SOLE)
The population and decay evolution of a qubit under the time-convolutionless master equation
International Nuclear Information System (INIS)
Huang Jiang; Fang Mao-Fa; Liu Xiang
2012-01-01
We consider the population and decay of a qubit under the electromagnetic environment. Employing the time-convolutionless master equation, we investigate the Markovian and non-Markovian behaviour of the corresponding perturbation expansion. The Jaynes-Cummings model on resonance is investigated. Some figures clearly show the different evolution behaviours. The reasons are interpreted in the paper. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
21st Century Military Operations in a Complex Electromagnetic Environment
2015-07-01
Natalie Crawford RAND Corporation RDML Jon P. Cryer, USN (ret) Northrop Grumman Mr. Stephen Cummings Raytheon Dr. Eric Evans MIT Lincoln...Heyer U.S. Navy Ms. Leslie Litton U.S. Army Dr. Charles Perkins National Reconnaissance Office Mr. Marvin Potts U.S. Air Force Dr. Stephen ...Neil Fox Virginia Tech Applied Research Corporation Ms. Hannah Freeman Strategic Analysis, Inc. Mr. Marcus Hawkins Strategic Analysis, Inc. Dr
Collision dynamics of the coherent Jaynes-Cumminings model
International Nuclear Information System (INIS)
Rabello, M.L.C.; Toledo Piza, A.F.R. de
1984-01-01
The anatomy of the dynamics of quantum correlations of two interacting subsystems described by the Jaynes-Cummings Model is studied, making use of a natural states decomposition, following an old suggestion by Schroedinger. The amplitude modulation of the fast Rabi oscillations which occur for a strong, coherent initial field is obtained from the spin intrinsic depolarization resulting from corrections to the mean field approximation. (Author) [pt
Energy Technology Data Exchange (ETDEWEB)
Wang, Xin; Xu, Mei; Frank, Jacqueline A. [Department of Pharmacology and Nutritional Sciences, University of Kentucky College of Medicine, Lexington, KY 40536 (United States); Ke, Zun-ji [Department of Biochemistry, Shanghai University of Traditional Chinese Medicine, Shanghai, China 201203 (China); Luo, Jia, E-mail: jialuo888@uky.edu [Department of Pharmacology and Nutritional Sciences, University of Kentucky College of Medicine, Lexington, KY 40536 (United States); Department of Biochemistry, Shanghai University of Traditional Chinese Medicine, Shanghai, China 201203 (China)
2017-04-01
Thiamine (vitamin B1) deficiency (TD) plays a major role in the etiology of Wernicke's encephalopathy (WE) which is a severe neurological disorder. TD induces selective neuronal cell death, neuroinflammation, endoplasmic reticulum (ER) stress and oxidative stress in the brain which are commonly observed in many aging-related neurodegenerative diseases, such as Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD) and progressive supranuclear palsy (PSP). However, the underlying cellular and molecular mechanisms remain unclear. The progress in this line of research is hindered due to the lack of appropriate in vitro models. The neurons derived for the human induced pluripotent stem cells (hiPSCs) provide a relevant and powerful tool for the research in pharmaceutical and environmental neurotoxicity. In this study, we for the first time used human induced pluripotent stem cells (hiPSCs)-derived neurons (iCell neurons) to investigate the mechanisms of TD-induced neurodegeneration. We showed that TD caused a concentration- and duration-dependent death of iCell neurons. TD induced ER stress which was evident by the increase in ER stress markers, such as GRP78, XBP-1, CHOP, ATF-6, phosphorylated eIF2α, and cleaved caspase-12. TD also triggered oxidative stress which was shown by the increase in the expression 2,4-dinitrophenyl (DNP) and 4-hydroxynonenal (HNE). ER stress inhibitors (STF-083010 and salubrinal) and antioxidant N-acetyl cysteine (NAC) were effective in alleviating TD-induced death of iCell neurons, supporting the involvement of ER stress and oxidative stress. It establishes that the iCell neurons are a novel tool to investigate cellular and molecular mechanisms for TD-induced neurodegeneration. - Highlights: • Thiamine deficiency (TD) causes death of human neurons in culture. • TD induces both endoplasmic reticulum (ER) stress and oxidative stress. • Alleviating ER stress and oxidative stress reduces TD-induced
International Nuclear Information System (INIS)
Wang, Xin; Xu, Mei; Frank, Jacqueline A.; Ke, Zun-ji; Luo, Jia
2017-01-01
Thiamine (vitamin B1) deficiency (TD) plays a major role in the etiology of Wernicke's encephalopathy (WE) which is a severe neurological disorder. TD induces selective neuronal cell death, neuroinflammation, endoplasmic reticulum (ER) stress and oxidative stress in the brain which are commonly observed in many aging-related neurodegenerative diseases, such as Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD) and progressive supranuclear palsy (PSP). However, the underlying cellular and molecular mechanisms remain unclear. The progress in this line of research is hindered due to the lack of appropriate in vitro models. The neurons derived for the human induced pluripotent stem cells (hiPSCs) provide a relevant and powerful tool for the research in pharmaceutical and environmental neurotoxicity. In this study, we for the first time used human induced pluripotent stem cells (hiPSCs)-derived neurons (iCell neurons) to investigate the mechanisms of TD-induced neurodegeneration. We showed that TD caused a concentration- and duration-dependent death of iCell neurons. TD induced ER stress which was evident by the increase in ER stress markers, such as GRP78, XBP-1, CHOP, ATF-6, phosphorylated eIF2α, and cleaved caspase-12. TD also triggered oxidative stress which was shown by the increase in the expression 2,4-dinitrophenyl (DNP) and 4-hydroxynonenal (HNE). ER stress inhibitors (STF-083010 and salubrinal) and antioxidant N-acetyl cysteine (NAC) were effective in alleviating TD-induced death of iCell neurons, supporting the involvement of ER stress and oxidative stress. It establishes that the iCell neurons are a novel tool to investigate cellular and molecular mechanisms for TD-induced neurodegeneration. - Highlights: • Thiamine deficiency (TD) causes death of human neurons in culture. • TD induces both endoplasmic reticulum (ER) stress and oxidative stress. • Alleviating ER stress and oxidative stress reduces TD-induced
Stress induced reorientation of vanadium hydride
International Nuclear Information System (INIS)
Beardsley, M.B.
1977-10-01
The critical stress for the reorientation of vanadium hydride was determined for the temperature range 180 0 to 280 0 K using flat tensile samples containing 50 to 500 ppM hydrogen by weight. The critical stress was observed to vary from a half to a third of the macroscopic yield stress of pure vanadium over the temperature range. The vanadium hydride could not be stress induced to precipitate above its stress-free precipitation temperature by uniaxial tensile stresses or triaxial tensile stresses induced by a notch
Cummings, Jonatahan
2011-01-01
Õige ja asjakohase oskusteabe leidmise keerukusest teadmistemahukate meeskonnaprojektide realiseerimisel. Projektvõrgustike analüüs. Skeemid: Mille poolest finaalijõudnud meeskonnad erinesid?, Kuidas projektvõrgustikud laiendavad meeskonna haaret?, Kuidas kasutada projektvõrgustikke?
Teste Albumasare cum Sibylla: astrology and the Sibyls in medieval Europe.
Smoller, Laura Ackerman
2010-06-01
In the 1480s Dominican humanist Filippo de' Barbieri published an illustration of a supposedly ancient female seer called the 'Sybilla Chimica', whose prophetic text repeated the words of the ninth-century astrologer Abu Ma'shar. In tracing the origins of Barbieri's astrological Sibyl, this article examines three sometimes interlocking traditions: the attribution of an ante-diluvian history to the science of the stars, the assertion of astrology's origins in divine revelation, and the belief in the ancient Sibyls' predictions of the birth of Christ and other Christian truths. Medieval authors from the twelfth century on began to cite these traditions together, thereby simultaneously authorizing the use of astrology to predict religious changes and blurring the categories of natural and supernatural as applied to human understanding. This blending of astrology and prophecy appears notably in works by such authors as John of Paris, John of Legnano, Johannes Lichtenberger, and Marsilio Ficino. Ultimately the trajectory that produced Barbieri's astrological Sibyl would lead to a wave of astrological apocalyptic predictions in the sixteenth and seventeenth centuries, as well as to the harnessing of astrology for the defense of the faith in the form of an astrological natural theology, sacralizing science as well as nature.
Tracks in the Sand: Hooke's Pendulum "Cum Grano Salis"
Babovic, Vukota; Babovic, Miloš
2014-01-01
The history of science remembers more than just formal facts about scientific discoveries. These side stories are often inspiring. One of them, the story of an unfulfilled death wish of Jacob Bernoulli regarding spirals, inspired us to look around ourselves. And we saw natural spirals around us, which led to the creation of a Hooke's…
Study on a waste heat-driven adsorption cooling cum desalination cycle
Ng, Kim Choon; Thu, Kyaw; Saha, Bidyut Baran; Chakraborty, Anutosh
2012-01-01
This article presents the performance analysis of a waste heat-driven adsorption cycle. With the implementation of adsorption-desorption phenomena, the cycle simultaneously produces cooling energy and high-grade potable water. A mathematical model
Study on a waste heat-driven adsorption cooling cum desalination cycle
Ng, Kim Choon
2012-05-01
This article presents the performance analysis of a waste heat-driven adsorption cycle. With the implementation of adsorption-desorption phenomena, the cycle simultaneously produces cooling energy and high-grade potable water. A mathematical model is developed using isotherm characteristics of the adsorbent/adsorbate pair (silica gel and water), energy and mass balances for the each component of the cycle. The cycle is analyzed using key performance parameters namely (i) specific cooling power (SCP), (ii) specific daily water production (SDWP), (iii) the coefficient of performance (COP) and (iv) the overall conversion ratio (OCR). The numerical results of the adsorption cycle are validated using experimental data. The parametric analysis using different hot and chilled water temperatures are reported. At 85°C hot water inlet temperature, the cycle generates 3.6 m 3 of potable water and 23 Rton of cooling at the produced chilled water temperature of 10°C. © 2012 Elsevier Ltd and IIR. All rights reserved.
Directory of Open Access Journals (Sweden)
F. Serinaldi
2010-12-01
Full Text Available Discrete multiplicative random cascade (MRC models were extensively studied and applied to disaggregate rainfall data, thanks to their formal simplicity and the small number of involved parameters. Focusing on temporal disaggregation, the rationale of these models is based on multiplying the value assumed by a physical attribute (e.g., rainfall intensity at a given time scale L, by a suitable number b of random weights, to obtain b attribute values corresponding to statistically plausible observations at a smaller L/b time resolution. In the original formulation of the MRC models, the random weights were assumed to be independent and identically distributed. However, for several studies this hypothesis did not appear to be realistic for the observed rainfall series as the distribution of the weights was shown to depend on the space-time scale and rainfall intensity. Since these findings contrast with the scale invariance assumption behind the MRC models and impact on the applicability of these models, it is worth studying their nature. This study explores the possible presence of dependence of the parameters of two discrete MRC models on rainfall intensity and time scale, by analyzing point rainfall series with 5-min time resolution. Taking into account a discrete microcanonical (MC model based on beta distribution and a discrete canonical beta-logstable (BLS, the analysis points out that the relations between the parameters and rainfall intensity across the time scales are detectable and can be modeled by a set of simple functions accounting for the parameter-rainfall intensity relationship, and another set describing the link between the parameters and the time scale. Therefore, MC and BLS models were modified to explicitly account for these relationships and compared with the continuous in scale universal multifractal (CUM model, which is used as a physically based benchmark model. Monte Carlo simulations point out
Skrypnyk, T.
2017-08-01
We study the problem of separation of variables for classical integrable Hamiltonian systems governed by non-skew-symmetric non-dynamical so(3)\\otimes so(3) -valued elliptic r-matrices with spectral parameters. We consider several examples of such models, and perform separation of variables for classical anisotropic one- and two-spin Gaudin-type models in an external magnetic field, and for Jaynes-Cummings-Dicke-type models without the rotating wave approximation.
Evaluation of Cement, Lime, and Asphalt Amended Municipal Solid Waste Incinerator Residues
1989-09-01
the lime column over time ( Atlas & Bartha , 1987). Certainly, a more extensive evaluation of the lime amended residue’s microbial activity is required...4.02 ASTM D 1559 (1988) Annual Book of ASTM Standards: Road & Paving Materials; Traveled Surface Characteristics, Sec 4, Vol 4.03 Atlas , R. & R. Bartha ...1987) Microbial Ecology : Fundamentals & Applications, Benjamin-Cummings, Menlo, CA Barrow N., J. Bowden, A. Posner, & J. Quirk (1981) Describing the
Military Retention and Retirement. Reciprocal Family/Organization Effects,
1981-06-30
the Chief of Naval Operations, 1978. Derr, C.B. Managing marriage/ family issues across career stages: the case of the U.S. Naval officers. Unpublished...Jeffers-, Davis Highway University of Maryland Arlingtcn VA , #02 College of Business and Management and Department of Psychology Dr. Larry Cummings...Institution 801 N. Pitt Street, Suite 120 Alexandria VA 22314 Dr. Richard Steers Graduate School of Management and Business University of Oregon Eugene
Molecular Modeling of Interfacial Behaviors of Nanomaterials
2007-05-01
potential was originally designed for the modeling of mixed covalent- ionic bonding and was successfully used to describe oxides in crystalline, glassy, and...is separates from the bulk liquid polymer, i.e., the structure of this layer, as influenced by that of the meatal surface, is significantly more...Striolo, J. Kieffer, and P. Cummings, ’Evaluation of Force- fields for molecular simulation of polyhedral oligomeric silsesquioxanes,’ J. Phys. Chem
Schneebeli, L.; Kira, M.; Koch, S. W.
2008-08-01
It is shown that spectrally resolved photon-statistics measurements of the resonance fluorescence from realistic semiconductor quantum-dot systems allow for high contrast identification of the two-photon strong-coupling states. Using a microscopic theory, the second-rung resonance of Jaynes-Cummings ladder is analyzed and optimum excitation conditions are determined. The computed photon-statistics spectrum displays gigantic, experimentally robust resonances at the energetic positions of the second-rung emission.
Positive and Negative Effects of Parental Conflicts on Children’s Condition and Behaviour
Joëlle Barthassat
2014-01-01
Previous research focused on the negative consequences of parental conflict behaviours. In contrast, this review is about the positive and negative effects that constructive and destructive parental conflict behaviours have on a child’s condition and behaviour. It employs the cognitive-contextual framework of Grych and Fincham (1990) and the emotional security hypothesis of Davies and Cummings (1994). Parental conflicts are represented as a continuum from very destructive to very constructive...
50 years of optics research [Invited].
Schwider, Johannes
2013-01-01
The 50-year life span of Applied Optics covers also approximately the time I have been engaged in optics. I started in 1962 [1] with the Institute for Optics and Spectroscopy, which was one of several Academy Institutes (mission statement: "theoria cum praxi," G. Leibniz) located in Berlin-Adlershof on the area of the first airfield in Berlin dating back to the beginning of the 20th century.
Pre-cold stress increases acid stress resistance and induces amino ...
African Journals Online (AJOL)
Pre-cold stress increases acid stress resistance and induces amino acid homeostasis in Lactococcus lactis NZ9000. ... Purpose: To investigate the effects of pre-cold stress treatments on subsequent acid stress resistance ... from 32 Countries:.
Induced surface stress at crystal surfaces
International Nuclear Information System (INIS)
Dahmen, K.
2002-05-01
Changes of the surfaces stress Δτ (s) can be studied by observing the bending of thin crystalline plates. With this cantilever method one can gain the induced change of surface stress Δτ (s) from the bending of plates with the help of elasticity theory. For elastic isotropic substrates the relevant relations are known. Here the relations are generalized to elastic anisotropic crystals with a C 2v - Symmetry. The equilibrium shapes of crystalline plates oriented along the (100)-, (110)-, or (111)-direction which are clamped along one edge are calculated with a numeric method under the load of a homogeneous but pure isotropic or anisotropic surface stress. The results can be displayed with the dimensionality, so that the effect of clamping can be described in a systematic way. With these tabulated values one can evaluate cantilever experiments exactly. These results are generalized to cantilever methods for determining magnetoelastic constants. It is shown which magnetoelastic constants are measured in domains of thin films with ordered structures. The eigenshape and the eigenfrequency of plates constraint through a clamping at one side are calculated. These results give a deeper understanding of the elastic anisotropy. The induced surface stress of oxygen on the (110)-surface of molybdenum is measured along the principle directions Δτ [001] and Δτ [ anti 110] . The anisotropy of the surface stress is found for the p(2 x 2)-reconstruction. Lithium induces a tensile surface stress on the Molybdenum (110)-surface up to a coverage of Θ = 0, 3 monolayer. For a higher coverage the induced stress drops and reaches a level of less than -1, 2 N/m at one monolayer. It is shown, that cobalt induces a linear increasing stress with respect to the coverage on the (100)-surface of copper with a value of 2, 4GPa. The copper (100)-surface is bombarded with accelerated ions in the range between 800-2200 eV. The resulting induced compressive stress (Δτ (s) < 0) of the order
Wang, Xin; Xu, Mei; Frank, Jacqueline A; Ke, Zun-Ji; Luo, Jia
2017-04-01
Thiamine (vitamin B1) deficiency (TD) plays a major role in the etiology of Wernicke's encephalopathy (WE) which is a severe neurological disorder. TD induces selective neuronal cell death, neuroinflammation, endoplasmic reticulum (ER) stress and oxidative stress in the brain which are commonly observed in many aging-related neurodegenerative diseases, such as Alzheimer's disease (AD), Parkinson's disease (PD), Huntington's disease (HD) and progressive supranuclear palsy (PSP). However, the underlying cellular and molecular mechanisms remain unclear. The progress in this line of research is hindered due to the lack of appropriate in vitro models. The neurons derived for the human induced pluripotent stem cells (hiPSCs) provide a relevant and powerful tool for the research in pharmaceutical and environmental neurotoxicity. In this study, we for the first time used human induced pluripotent stem cells (hiPSCs)-derived neurons (iCell neurons) to investigate the mechanisms of TD-induced neurodegeneration. We showed that TD caused a concentration- and duration-dependent death of iCell neurons. TD induced ER stress which was evident by the increase in ER stress markers, such as GRP78, XBP-1, CHOP, ATF-6, phosphorylated eIF2α, and cleaved caspase-12. TD also triggered oxidative stress which was shown by the increase in the expression 2,4-dinitrophenyl (DNP) and 4-hydroxynonenal (HNE). ER stress inhibitors (STF-083010 and salubrinal) and antioxidant N-acetyl cysteine (NAC) were effective in alleviating TD-induced death of iCell neurons, supporting the involvement of ER stress and oxidative stress. It establishes that the iCell neurons are a novel tool to investigate cellular and molecular mechanisms for TD-induced neurodegeneration. Copyright © 2017 Elsevier Inc. All rights reserved.
Interplay of uniaxial and cubic anisotropy in epitaxial Fe thin films on MgO (001 substrate
Directory of Open Access Journals (Sweden)
Srijani Mallik
2014-09-01
Full Text Available Epitaxial Fe thin films were grown on annealed MgO(001 substrates at oblique incidence by DC magnetron sputtering. Due to the oblique growth configuration, uniaxial anisotropy was found to be superimposed on the expected four-fold cubic anisotropy. A detailed study of in-plane magnetic hysteresis for Fe on MgO thin films has been performed by Magneto Optic Kerr Effect (MOKE magnetometer. Both single step and double step loops have been observed depending on the angle between the applied field and easy axis i.e. along ⟨100⟩ direction. Domain images during magnetization reversal were captured by Kerr microscope. Domain images clearly evidence two successive and separate 90° domain wall (DW nucleation and motion along cubic easy cum uniaxial easy axis and cubic easy cum uniaxial hard axis, respectively. However, along cubic hard axis two 180° domain wall motion dominate the magnetization reversal process. In spite of having four-fold anisotropy it is essential to explain magnetization reversal mechanism in 0°< ϕ < 90° span as uniaxial anisotropy plays a major role in this system. Also it is shown that substrate rotation can suppress the effect of uniaxial anisotropy superimposed on four-fold anisotropy.
An Automated Approach to Syntax-based Analysis of Classical Latin
Directory of Open Access Journals (Sweden)
Anjalie Field
2016-12-01
Full Text Available The goal of this study is to present an automated method for analyzing the style of Latin authors. Many of the common automated methods in stylistic analysis are based on lexical measures, which do not work well with Latin because of the language’s high degree of inflection and free word order. In contrast, this study focuses on analysis at a syntax level by examining two constructions, the ablative absolute and the cum clause. These constructions are often interchangeable, which suggests an author’s choice of construction is typically more stylistic than functional. We first identified these constructions in hand-annotated texts. Next we developed a method for identifying the constructions in unannotated texts, using probabilistic morphological tagging. Our methods identified constructions with enough accuracy to distinguish among different genres and different authors. In particular, we were able to determine which book of Caesar’s Commentarii de Bello Gallico was not written by Caesar. Furthermore, the usage of ablative absolutes and cum clauses observed in this study is consistent with the usage scholars have observed when analyzing these texts by hand. The proposed methods for an automatic syntax-based analysis are shown to be valuable for the study of classical literature.
Directory of Open Access Journals (Sweden)
Yee Meng Chong
2018-04-01
Full Text Available The quorum sensing (QS system has been used by many opportunistic pathogenic bacteria to coordinate their virulence determinants in relation to cell-population density. As antibiotic-resistant bacteria are on the rise, interference with QS has been regarded as a novel way to control bacterial infections. As such, many plant-based natural products have been widely explored for their therapeutic roles. These natural products may contain anti-QS compounds that could block QS signals generation or transmission to combat QS pathogens. In this study, we report the anti-QS activities of four different Chinese herbal plant extracts: Poria cum Radix pini, Angelica dahurica, Rhizoma cibotii and Schizonepeta tenuifolia, on Pseudomonas aeruginosa PAO1. All the plants extracted using hexane, chloroform and methanol were tested and found to impair swarming motility and pyocyanin production in P. aeruginosa PAO1, particularly by Poria cum Radix pini. In addition, all the plant extracts also inhibited violacein production in C. violaceum CV026 up to 50% while bioluminescence activities were reduced in lux-based E. coli biosensors, pSB401 and pSB1075, up to about 57%. These anti-QS properties of the four medicinal plants are the first documentation that demonstrates a potential approach to attenuate pathogens’ virulence determinants.
[Stress-induced cellular adaptive mutagenesis].
Zhu, Linjiang; Li, Qi
2014-04-01
The adaptive mutations exist widely in the evolution of cells, such as antibiotic resistance mutations of pathogenic bacteria, adaptive evolution of industrial strains, and cancerization of human somatic cells. However, how these adaptive mutations are generated is still controversial. Based on the mutational analysis models under the nonlethal selection conditions, stress-induced cellular adaptive mutagenesis is proposed as a new evolutionary viewpoint. The hypothetic pathway of stress-induced mutagenesis involves several intracellular physiological responses, including DNA damages caused by accumulation of intracellular toxic chemicals, limitation of DNA MMR (mismatch repair) activity, upregulation of general stress response and activation of SOS response. These responses directly affect the accuracy of DNA replication from a high-fidelity manner to an error-prone one. The state changes of cell physiology significantly increase intracellular mutation rate and recombination activity. In addition, gene transcription under stress condition increases the instability of genome in response to DNA damage, resulting in transcription-associated DNA mutagenesis. In this review, we summarize these two molecular mechanisms of stress-induced mutagenesis and transcription-associated DNA mutagenesis to help better understand the mechanisms of adaptive mutagenesis.
Relationships among Work Life, Mental Health Status and Organisation-based Self-esteem
Devin Hassan Fahim; Farbod Davood
2016-01-01
Quality of Work Life (QWL) is a multi-dimensional concept that covers employees’ feelings about various dimensions of work. The current study focused on QWL that can contribute to the mental health status and Organisation-Based Self-Esteem (OBSE) of employees in context of sport organisation in Iran. In this descriptive–correlative study, data was collected using three standard questionnaires: Goldberg’s (1978) General Health Questionnaire (GHQ-12), Pierce, Gardner, Cummings and Dunham's (198...
Régime alimentaire de Pomadasys jubelini (Pisces, Haemulidae ...
African Journals Online (AJOL)
Administrateur
cæcums pyloriques également très développés sont présents au niveau du pylore. L'intestin, relativement court, est plié en 3. La figure 3 présente la relation entre la longueur de l'intestin et la longueur standard des poissons. Cette figure montre une relation linéaire d'équation y = 1,17x -12,99 entre les variables étudiées.
Curves from Motion, Motion from Curves
2000-01-01
De linearum curvarum cum lineis rectis comparatione dissertatio geometrica - an appendix to a treatise by de Lalouv~re (this was the only publication... correct solution to the problem of motion in the gravity of a permeable rotating Earth, considered by Torricelli (see §3). If the Earth is a homogeneous...in 1686, which contains the correct solution as part of a remarkably comprehensive theory of orbital motions under centripetal forces. It is a
1995-05-01
possibly subadults, were traveling in pairs, and almost half of the recorded sounds were stereotyped doublets, unlike the sounds recorded by Cummings and...purpose and unique stereotyped click sequence "codas" have been recorded from individual whales over periods lasting several hours (Watldns and Schevill...Beaked whales of the genus Mesoplodon. pp 349-430. In: S.H. Ridgway and R. Harrison (eds.), Handbook of marine mammals, Vol. 4. Academic Press Ltd. Meller
Variational Data Assimilation for the Global Ocean
2013-01-01
ocean includes the Geoid (a fixed gravity equipotential surface ) as well as the MDT, which is not known accurately enough relative to the centimeter...scales, including processes that control the surface mixed layer, the formation of ocean eddies, meandering ocean J.A. Cummings (E3) nography Division...variables. Examples of this in the ocean are integral quantities, such as acous^B travel time and altimeter measures of sea surface height, and direct
Carda, Ana P P; Marchi, Katia C; Rizzi, Elen; Mecawi, André S; Antunes-Rodrigues, José; Padovan, Claudia M; Tirapelli, Carlos R
2015-01-01
We hypothesized that acute stress would induce endothelial dysfunction. Male Wistar rats were restrained for 2 h within wire mesh. Functional and biochemical analyses were conducted 24 h after the 2-h period of restraint. Stressed rats showed decreased exploration on the open arms of an elevated-plus maze (EPM) and increased plasma corticosterone concentration. Acute restraint stress did not alter systolic blood pressure, whereas it increased the in vitro contractile response to phenylephrine and serotonin in endothelium-intact rat aortas. NG-nitro-l-arginine methyl ester (l-NAME; nitric oxide synthase, NOS, inhibitor) did not alter the contraction induced by phenylephrine in aortic rings from stressed rats. Tiron, indomethacin and SQ29548 reversed the increase in the contractile response to phenylephrine induced by restraint stress. Increased systemic and vascular oxidative stress was evident in stressed rats. Restraint stress decreased plasma and vascular nitrate/nitrite (NOx) concentration and increased aortic expression of inducible (i) NOS, but not endothelial (e) NOS. Reduced expression of cyclooxygenase (COX)-1, but not COX-2, was observed in aortas from stressed rats. Restraint stress increased thromboxane (TX)B(2) (stable TXA(2) metabolite) concentration but did not affect prostaglandin (PG)F2α concentration in the aorta. Restraint reduced superoxide dismutase (SOD) activity, whereas concentrations of hydrogen peroxide (H(2)O(2)) and reduced glutathione (GSH) were not affected. The major new finding of our study is that restraint stress increases vascular contraction by an endothelium-dependent mechanism that involves increased oxidative stress and the generation of COX-derived vasoconstrictor prostanoids. Such stress-induced endothelial dysfunction could predispose to the development of cardiovascular diseases.
International Nuclear Information System (INIS)
Kumar, A.; Abdou, M.A.; Kosako, K.; Oyama, Y.; Nakamura, T.; Maekawa, H.
1995-01-01
The D-T neutron-induced radioactivity constitutes one of the foremost issues in fusion reactor design. The validation of activation cross-sections and decay data libraries is one of the important requirements for validating ITER design from safety and waste disposal viewpoints. An elaborate, experimental program was initiated in 1988, under USDOE-JAERI collaborative program, to validate the radioactivity codes/libraries. The measurements of decay-γ spectra from irradiated, high purity samples of Al, Si, Ti, V, Cr, Mn-Cu alloy, Fe, Co, Ni, Cu, stainless steel 316 (AISI 316), Zn, Zr, Nb, Mo, In, Sn, Ta, W, and Pb, among others, were conducted under D-T neutron fluences varying from 1.6 x 10 10 ncm -2 to 6.1 x 10 13 ncm -2 . As many as 14 neutron energy spectra were covered for a number of materials. The analysis of isotopic activities of the irradiated materials using activation cross-section libraries of four leading radioactivity codes, i.e. ACT4/THIDA-2, REAC-3, DKR-ICF, and RACC, has shown large discrepancies among the calculations, on the one hand, and between the calculations and the measurements, on the other. A discussion is also presented on definition and obtention of safety cum quality factors for various activation libraries. (orig.)
Laparohysteroscopy in female infertility: A diagnostic cum therapeutic tool in Indian setting.
Puri, Suman; Jain, Dinesh; Puri, Sandeep; Kaushal, Sandeep; Deol, Satjeet Kaur
2015-01-01
To evaluate the role of laparohysteroscopy in female infertility andto study the effect of therapeutic procedures in achieving fertility. Patients with female infertility presenting to outpatient Department of Obstetrics and Gynecology were evaluated over a period of 18 months. Fifty consenting subjects excluding male factor infertility with normal hormonal profile and no contraindication to laparoscopy were subject to diagnostic laparoscopy and hysteroscopy. T-test. We studied 50 patients comprising of 24 (48%) cases of primary infertility and 26 (52%) patients of secondary infertility. The average age of active married life for 50 patients was between 8 and 9 years. In our study, the most commonly found pathologies were PCOD, endometroisis and tubal blockage. 11 (28.2) patients conceived after laparohysteroscopy followed by artificial reproductive techniques. This study demonstrates the benefit of laparohysteroscopy for diagnosis and as a therapeutic tool in patients with primary and secondary infertility. We were able to achieve a higher conception rate of 28.2%.
Quantum phase fluctuations in the Jaynes-cummings model: effects of cavity damping
International Nuclear Information System (INIS)
Ho Trung Dung; Shumovskij, A.S.
1992-01-01
Phase properties of a coherent field interacting with a two-level atom in a cavity with very high but finite Q are studied. It is shown that due to the cavity damping the field phase is randomized more quickly than in the ideal-losslesscavity case. The Hermitian phase distribution and the phase distributions associated with the Q function and the Wigner function are compared. The similarities between them have clear interpretation in terms of the area-of-overlap in phase space. 29 refs.; 3 figs
Academic stratospheres-cum-underworlds: When highs and lows of publication cultures meet
Czech Academy of Sciences Publication Activity Database
Stöckelová, Tereza; Vostal, Filip
2017-01-01
Roč. 69, č. 5 (2017), s. 516-528 ISSN 2050-3806 R&D Projects: GA ČR GA15-16452S; GA ČR(CZ) GJ16-18371Y Institutional support: RVO:68378025 ; RVO:67985955 Keywords : predatory publishing * publication cultures * Web of Science * Elsevier * publishing oligopoly Subject RIV: AO - Sociology, Demography; AO - Sociology, Demography (FLU-F) OBOR OECD: Sociology; Sociology (FLU-F) Impact factor: 1.514, year: 2016
Cum latranti/fraganti nomine: a possible reading of Plautus Casina 31-34
Directory of Open Access Journals (Sweden)
Analía Sapere
2008-06-01
Full Text Available The title of the comedy transmitted as Casina has been discussed by the main Plautine critics, especially because of the enigmatic verses 31-34, which offer an alternative translation of the original Greek title (Sortientes and, moreover, describe as “barking” (latranti a name that, from its etymology, recalls a spice and seems to have no connection with dogs. Our paper aims to contribute to the discussion, holding the view that the name Casina may be explained as an anagram of the words casia and canis, which remit to the semantic fields of scents and animals, and are related all over the comedy with two female characters: the elusive and ideal Casina, and the too concrete and real Cleostrata. Assuming the authenticity of the transmitted title, we suggest reading this passage of the prologue as a clue of the central subject of the comedy: the substitution of the matrona for the pleasing lover, with the resulting mockery and punishment of the senex.
Serotonergic involvement in stress-induced vasopressin and oxytocin secretion
DEFF Research Database (Denmark)
Jørgensen, Henrik; Knigge, Ulrich; Kjaer, Andreas
2002-01-01
OBJECTIVE: To investigate the involvement of serotonin (5-hydroxytryptamine - 5-HT) receptors in mediation of stress-induced arginine vasopressin (AVP) and oxytocin (OT) secretion in male rats. DESIGN: Experiments on laboratory rats with control groups. METHODS: Different stress paradigms were...... the swim stress-induced OT response. CONCLUSION: 5-HT(2A), 5-HT(2C) and possibly 5-HT(3) and 5-HT(4) receptors, but not 5-HT(1A) receptors, are involved in the restraint stress-induced AVP secretion. 5-HT does not seem to be involved in the dehydration- or hemorrhage-induced AVP response. The restraint...... stress-induced OT response seems to be mediated via 5-HT(1A), 5-HT(2A) and 5-HT(2C) receptors. The dehydration and hemorrhage-induced OT responses are at least mediated by the 5-HT(2A) and 5-HT(2C) receptors. The 5-HT(3) and 5-HT(4) receptors are not involved in stress-induced OT secretion....
Henckens, Marloes J A G; Klumpers, Floris; Everaerd, Daphne; Kooijman, Sabine C; van Wingen, Guido A; Fernández, Guillén
2016-04-01
Stress exposure is known to precipitate psychological disorders. However, large differences exist in how individuals respond to stressful situations. A major marker for stress sensitivity is hypothalamus-pituitary-adrenal (HPA)-axis function. Here, we studied how interindividual variance in both basal cortisol levels and stress-induced cortisol responses predicts differences in neural vigilance processing during stress exposure. Implementing a randomized, counterbalanced, crossover design, 120 healthy male participants were exposed to a stress-induction and control procedure, followed by an emotional perception task (viewing fearful and happy faces) during fMRI scanning. Stress sensitivity was assessed using physiological (salivary cortisol levels) and psychological measures (trait questionnaires). High stress-induced cortisol responses were associated with increased stress sensitivity as assessed by psychological questionnaires, a stronger stress-induced increase in medial temporal activity and greater differential amygdala responses to fearful as opposed to happy faces under control conditions. In contrast, high basal cortisol levels were related to relative stress resilience as reflected by higher extraversion scores, a lower stress-induced increase in amygdala activity and enhanced differential processing of fearful compared with happy faces under stress. These findings seem to reflect a critical role for HPA-axis signaling in stress coping; higher basal levels indicate stress resilience, whereas higher cortisol responsivity to stress might facilitate recovery in those individuals prone to react sensitively to stress. © The Author (2015). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.
Aaron Temkin Beck (born July 18, 1921-) Biography
K. Fatih Yavuz; M. Hakan Türkçapar
2012-01-01
Aaron Beck was born in Providence, Rhode Island, USA, the youngest child of four siblings. Beck attended Brown University, graduating magna cum laude in 1942. Then he attended Yale Medical School, graduating with an M.D. in 1946. After his graduation, he served a rotating internship, followed by a residency in pathology at the Rhode Island Hospital. Although initially not interested in psychiatry, a residency in neurology at the Cushing Veterans Administration Hospital in Framingham, MA, requ...
Ackerman, Stacey J; Polly, David W; Knight, Tyler; Schneider, Karen; Holt, Tim; Cummings, John
2014-01-01
Stacey J Ackerman,1 David W Polly Jr,2 Tyler Knight,3 Karen Schneider,4 Tim Holt,5 John Cummings Jr6 1Covance Market Access Services Inc., San Diego, CA, USA; 2University of Minnesota, Orthopaedic Surgery, Minneapolis, MN, USA; 3Covance Market Access Services Inc., Gaithersburg, MD, USA; 4Covance Market Access Services Inc., Sydney, Australia; 5Montgomery Spine Center, Orthopedic Surgery, Montgomery, AL, USA; 6Community Health Network, Neurosurgery, Indianapolis, IN, USA Introduction: Low ba...
Ackerman SJ; Polly Jr DW; Knight T; Schneider K; Holt T; Cummings J
2013-01-01
Stacey J Ackerman1, David W Polly Jr2, Tyler Knight3, Karen Schneider4, Tim Holt5, John Cummings61Covance Market Access Services Inc, San Diego, CA, USA; 2University of Minnesota, Orthopaedic Surgery, Minneapolis, MN, USA; 3Covance Market Access Services Inc, Gaithersburg, MD, USA; 4Covance Market Access Services Inc, Sydney, NSW, Australia; 5Montgomery Spine Center, Orthopaedic Surgery, Montgomery, AL, USA; 6Community Health Network, Neurosurgery, Indianapolis, IN, USAIntroduction: The econo...
Acute and Chronic Effects of Tributyltin on the Mysid Acanthomysis sculpta (Crustacea, Mysidacea).
1986-05-01
juveniles . . . 19 12. Summary of chronic values in pg/L TBT . . . 26 viii INTRODUCTION Tributyltin ( TBT ) is commonly used as an antifouling toxicant in...juveniles was determined at 0 42-jig L TBT . Reproductive effects were the most sensitive sublethal indicator of TBT toxicity . A chronic value of 0.14-pgL...SI[CUmITV CLAShIFICATION OF THIS PASU M DAI &W- A comparison of TBT toxicity was performed using a TBT solution leached from painted panels
Family Roles in Transition. In a Changing Military.
1981-06-18
and Management and Department of Psychology Dr. Larry Cummings College Park MD 20742 University of Wisconsin-Madison Graduate School of Business Dr. D...Graduate School of Management and Business University of Oregon Eugene OR 97403 Dr. James R. Terborg University of Houston Department of Psychology Houston...AD-A107 348 UNdITED STATES INTERNATIONAL UNIV SAN DIEGO CA FAMILY --ETC PIG 5/1l FAMILY ROLES IN TRANSITION IN A CHANGING MILITARY (U) JUN 81 E J
Ngotran, Duong
2016-01-01
We develop a dynamic model with two types of electronic money: reserves for transactions between bankers and zero-maturity deposits for transactions in the non-bank private sector. Using this model, we assess the efficacy of unconventional monetary policy since the Great Recession. After quantitative easing, keeping the interest on reserves at zero too long will create deflation. The central bank can safely get out of the ``low rate-cum-deflation'' trap by ``raising rate and raising money sup...
VizieR Online Data Catalog: Chemical analysis of CH stars. II. (Karinkuzhi+, 2015)
Karinkuzhi, D.; Goswami, A.
2017-10-01
Low-resolution spectra of these objects obtained from 2m Himalayan Chandra Telescope at the Indian Astronomical Observatory, Hanle using HFOSC clearly show strong features due to carbon. HFOSC is an optical imager cum spectrograph for conducting low- and medium-resolution grism spectroscopy (http://www.iiap.res.in/iao/hfosc.html). High-resolution spectra necessary for abundance analyses of the programme stars are taken from the ELODIE archive (Moultaka et al. 2004PASP..116..693M). (7 data files).
Susmita Lahiri Ganguly; Dipanwita Sarkar Paria; B. B. Jana
2015-01-01
Using ecological signature of biological integrity as a measure of performance, the reclamation efficiency of waste stabilization ponds was evaluated over a period of four years in a tropical sewage treatment plant – cum fish culture consisting of two anaerobic, two facultative and four maturation ponds located serially across the sewage effluent gradient. The four maturation ponds were used for batch culture of fish. Samples of surface and bottom water as well as surface sediment were collec...
Improved diode performance of Ag nanoparticle dispersed Er doped In2O3 film
Ghosh, Anupam; Dwivedi, Shyam Murli Manohar Dhar; Chakrabartty, Shubhro; Mondal, Aniruddha
2018-04-01
Ag nanoparticle(NP) dispersedEr doped In2O3 film was prepared by sol-gel method followed by thermal evaporation cum glancing angle deposition technique. The Schottky contact based devicecontaining Ag NPs shows ideality factor of ˜180 at 10 K and ˜5 at 300 K, which is lesser as compared to the device that does not contain Ag NPs. The lower ideality factor value all over the temperature range makes the diode more reliable.
Groundwater quality in the Southern Sierra Nevada, California
Fram, Miranda S.; Belitz, Kenneth
2012-01-01
Groundwater provides more than 40 percent of California's drinking water. To protect this vital resource, the State of California created the Groundwater Ambient Monitoring and Assessment (GAMA) Program. The Priority Basin Project of the GAMA Program provides a comprehensive assessment of the State's groundwater quality and increases public access to groundwater-quality information. The Tehachapi-Cummings Valley and Kern River Valley basins and surrounding watersheds in the Southern Sierra Nevada constitute one of the study units being evaluated.
Dancing in the Dark: Competition over the "Meaning of Competition"
Metcalfe John Stanley
2009-01-01
Competing concepts of competition provide a sharp divide between theories of economic order and theories of economic transformation. The shift from competition as a state of affairs and competition as a creative process provides the divergence of perspective that is the topic of this paper. We link the Smith Marshall approach of rivalry and open competition to the more modern evolutionary view based on variation cum selection perspectives on innovation and the adaptive role of market processe...
Syed Ejaz Husain Rizvi; Jaj P. Gupta; Manoj Bhargava
2007-01-01
The problem of optimum stratification on an auxiliary variable when the units from different strata are selected with probability proportional to the value of auxiliary variable (PPSWR) was considered by Singh (1975) for univariate case. In this paper we have extended the same problem, for proportional allocation, when two variates are under study. A cum. 3 R3(x) rule for obtaining approximately optimum strata boundaries has been provided. It has been shown theoretically as well as empiricall...
Stress-induced magnetic anisotropy in nanocrystalline alloys
International Nuclear Information System (INIS)
Varga, L.K.; Gercsi, Zs.; Kovacs, Gy.; Kakay, A.; Mazaleyrat, F.
2003-01-01
Stress-annealing experiments were extended to both nanocrystalline alloy families, Finemet and Nanoperm (Hitperm), and, for comparison, to amorphous Fe 62 Nb 8 B 30 alloy. For both Finemet and bulk amorphous, stress-annealing results in a strong induced transversal anisotropy (flattening of hysteresis loop) but yields longitudinal induced anisotropy (square hysteresis loop) in Nanoperm and Hitperm. These results are interpreted in terms of back-stress theory
Fernández, Macarena Soledad; Fabio, María Carolina; Miranda-Morales, Roberto Sebastián; Virgolini, Miriam B; De Giovanni, Laura N; Hansen, Cristian; Wille-Bille, Aranza; Nizhnikov, Michael E; Spear, Linda P; Pautassi, Ricardo Marcos
2016-03-01
Adolescents are sensitive to the anxiolytic effect of ethanol, and evidence suggests that they may be more sensitive to stress than adults. Relatively little is known, however, about age-related differences in stress modulation of ethanol drinking or stress modulation of ethanol-induced sedation and hypnosis. We observed that chronic restraint stress transiently exacerbated free-choice ethanol drinking in adolescent, but not in adult, rats. Restraint stress altered exploration patterns of a light-dark box apparatus in adolescents and adults. Stressed animals spent significantly more time in the white area of the maze and made significantly more transfers between compartments than their non-stressed peers. Behavioral response to acute stress, on the other hand, was modulated by prior restraint stress only in adults. Adolescents, unlike adults, exhibited ethanol-induced motor stimulation in an open field. Stress increased the duration of loss of the righting reflex after a high ethanol dose, yet this effect was similar at both ages. Ethanol-induced sleep time was much higher in adult than in adolescent rats, yet stress diminished ethanol-induced sleep time only in adults. The study indicates age-related differences that may increase the risk for initiation and escalation in alcohol drinking. Copyright © 2016 Elsevier Inc. All rights reserved.
A study on anti-stress property of Nardostachys jatamamsi on stress induced Drosophila melanogaster
Directory of Open Access Journals (Sweden)
Shilpashree R.
2011-09-01
Full Text Available Stress is a feeling that’s created when we react to particular events. It s the body’s way of rising to a challenge and preparing to meet a tough situation with focus, strength, stamina, and heightened alertness. As a result of the stress immune system can be suppressed by chronic stress opening to increased infections and increasing the risk of autoimmune diseases. So one has to learn away to overcome stress. Here is an attempt made to overcome the stress induced in Drosophila melanogaster a model organism, in this study. Methotrexate is used to induce the stress at different concentration taking different group of flies and a Nardostachys jatamamsi plant extract having antistress property is used to relieve the stress induced. This stress relieve measured by the various stress related enzymes like catalase and Superoxide dismutase by this antistress property of the plant Nardostachys jatamamsi was shown.
Ion beam induced stress formation and relaxation in germanium
Energy Technology Data Exchange (ETDEWEB)
Steinbach, T., E-mail: Tobias.Steinbach@uni-jena.de [Institut für Festkörperphysik, Friedrich-Schiller-Universität Jena, Max-Wien-Platz 1, D-07743 Jena (Germany); Reupert, A.; Schmidt, E.; Wesch, W. [Institut für Festkörperphysik, Friedrich-Schiller-Universität Jena, Max-Wien-Platz 1, D-07743 Jena (Germany)
2013-07-15
Ion irradiation of crystalline solids leads not only to defect formation and amorphization but also to mechanical stress. In the past, many investigations in various materials were performed focusing on the ion beam induced damage formation but only several experiments were done to investigate the ion beam induced stress evolution. Especially in microelectronic devices, mechanical stress leads to several unwanted effects like cracking and peeling of surface layers as well as changing physical properties and anomalous diffusion of dopants. To study the stress formation and relaxation process in semiconductors, crystalline and amorphous germanium samples were irradiated with 3 MeV iodine ions at different ion fluence rates. The irradiation induced stress evolution was measured in situ with a laser reflection technique as a function of ion fluence, whereas the damage formation was investigated by means of Rutherford backscattering spectrometry. The investigations show that mechanical stress builds up at low ion fluences as a direct consequence of ion beam induced point defect formation. However, further ion irradiation causes a stress relaxation which is attributed to the accumulation of point defects and therefore the creation of amorphous regions. A constant stress state is reached at high ion fluences if a homogeneous amorphous surface layer was formed and no further ion beam induced phase transition took place. Based on the results, we can conclude that the ion beam induced stress evolution seems to be mainly dominated by the creation and accumulation of irradiation induced structural modification.
Laser-induced stresses versus mechanical stress power measurements during laser ablation of solids
International Nuclear Information System (INIS)
Shannon, M.A.; Russo, R.E.
1995-01-01
Laser-induced stresses resulting from high-power laser-material interactions have been studied extensively. However, the rate of change in mechanical energy, or stress power, due to laser-induced stresses has only recently been investigated. An unanswered question for monitoring laser-material interactions in the far-field is whether stress power differs from stresses measured, particularly with respect to laser-energy coupling to a solid target. This letter shows experimental acoustic data which demonstrate that stress power measured in the far field of the target shows changes in laser-energy coupling, whereas the stresses measured do not. For the ambient medium above the target, stress power and stress together reflect changes in laser-energy coupling. copyright 1995 American Institute of Physics
Directory of Open Access Journals (Sweden)
Alexandre Garcia-Mas
2011-01-01
Full Text Available En este estudio se analizan las relaciones existentes entre la ansiedad competitiva (en sus facetas cognitiva y somática y el clima motivacional percibido (de ego y de maestría en una población de 54 jóvenes futbolistas de competición de edad media de 9,45 años, respecto de la percepción de sus habilidades y rendimiento deportivos por parte de sus 4 entrenadores, que también participaron en el estudio. Para ello se les administró las versiones españolas del SAS-2 (Sport Anxiety Scale-2, Smith, Smoll, Cumming y Grossbard, 2006 y el MCSYS (Motivational Climate Scale for Youth Sports, Smith, Cumming y Smoll, 2008, así como dos escalas ad hoc para evaluar la percepción de su habilidad y rendimiento. Los resultados muestran, por una parte, que los jóvenes futbolistas perciben y discriminan claramente los climas motivacionales, que se distribuyen casi al 50% entre ego y maestría, por otra, que aparece ansiedad competitiva, aunque más cognitiva que somática, y que no existe relación significativa con las percepciones de habilidad y rendimiento por parte de los entrenadores. Finalmente, estos resultados se discuten y se comparan con otros similares en poblaciones preadolescentes.
Finite element calculation of stress induced heating of superconductors
International Nuclear Information System (INIS)
Akin, J.E.; Moazed, A.
1976-01-01
This research is concerned with the calculation of the amount of heat generated due to the development of mechanical stresses in superconducting composites. An emperical equation is used to define the amount of stress-induced heat generation per unit volume. The equation relates the maximum applied stress and the experimental measured hysteresis loop of the composite stress-strain diagram. It is utilized in a finite element program to calculate the total stress-induced heat generation for the superconductor. An example analysis of a solenoid indicates that the stress-induced heating can be of the same order of magnitude as eddy current effects
Universal Scaling and Critical Exponents of the Anisotropic Quantum Rabi Model
Liu, Maoxin; Chesi, Stefano; Ying, Zu-Jian; Chen, Xiaosong; Luo, Hong-Gang; Lin, Hai-Qing
2017-12-01
We investigate the quantum phase transition of the anisotropic quantum Rabi model, in which the rotating and counterrotating terms are allowed to have different coupling strengths. The model interpolates between two known limits with distinct universal properties. Through a combination of analytic and numerical approaches, we extract the phase diagram, scaling functions, and critical exponents, which determine the universality class at finite anisotropy (identical to the isotropic limit). We also reveal other interesting features, including a superradiance-induced freezing of the effective mass and discontinuous scaling functions in the Jaynes-Cummings limit. Our findings are extended to the few-body quantum phase transitions with N >1 spins, where we expose the same effective parameters, scaling properties, and phase diagram. Thus, a stronger form of universality is established, valid from N =1 up to the thermodynamic limit.
Frank, Matthew G; Watkins, Linda R; Maier, Steven F
2011-06-01
Stress and stress-induced glucocorticoids (GCs) sensitize drug abuse behavior as well as the neuroinflammatory response to a subsequent pro-inflammatory challenge. Stress also predisposes or sensitizes individuals to develop substance abuse. There is an emerging evidence that glia and glia-derived neuroinflammatory mediators play key roles in the development of drug abuse. Drugs of abuse such as opioids, psychostimulants, and alcohol induce neuroinflammatory mediators such as pro-inflammatory cytokines (e.g. interleukin (IL)-1β), which modulate drug reward, dependence, and tolerance as well as analgesic properties. Drugs of abuse may directly activate microglial and astroglial cells via ligation of Toll-like receptors (TLRs), which mediate the innate immune response to pathogens as well as xenobiotic agents (e.g. drugs of abuse). The present review focuses on understanding the immunologic mechanism(s) whereby stress primes or sensitizes the neuroinflammatory response to drugs of abuse and explores whether stress- and GC-induced sensitization of neuroimmune processes predisposes individuals to drug abuse liability and the role of neuroinflammatory mediators in the development of drug addiction. Copyright © 2011 Elsevier Inc. All rights reserved.
Altered Gravity Induces Oxidative Stress in Drosophila Melanogaster
Bhattacharya, Sharmila; Hosamani, Ravikumar
2015-01-01
Altered gravity environments can induce increased oxidative stress in biological systems. Microarray data from our previous spaceflight experiment (FIT experiment on STS-121) indicated significant changes in the expression of oxidative stress genes in adult fruit flies after spaceflight. Currently, our lab is focused on elucidating the role of hypergravity-induced oxidative stress and its impact on the nervous system in Drosophila melanogaster. Biochemical, molecular, and genetic approaches were combined to study this effect on the ground. Adult flies (2-3 days old) exposed to acute hypergravity (3g, for 1 hour and 2 hours) showed significantly elevated levels of Reactive Oxygen Species (ROS) in fly brains compared to control samples. This data was supported by significant changes in mRNA expression of specific oxidative stress and antioxidant defense related genes. As anticipated, a stress-resistant mutant line, Indy302, was less vulnerable to hypergravity-induced oxidative stress compared to wild-type flies. Survival curves were generated to study the combined effect of hypergravity and pro-oxidant treatment. Interestingly, many of the oxidative stress changes that were measured in flies showed sex specific differences. Collectively, our data demonstrate that altered gravity significantly induces oxidative stress in Drosophila, and that one of the organs where this effect is evident is the brain.
STRESS INDUCED OBESITY: LESSONS FROM RODENT MODELS OF STRESS
Directory of Open Access Journals (Sweden)
Zachary Robert Patterson
2013-07-01
Full Text Available Stress is defined as the behavioral and physiological responses generated in the face of, or in anticipation of, a perceived threat. The stress response involves activation of the sympathetic nervous system and recruitment of the hypothalamic-pituitary-adrenal (HPA axis. When an organism encounters a stressor (social, physical, etc., these endogenous stress systems are stimulated in order to generate a fight-or-flight response, and manage the stressful situation. As such, an organism is forced to liberate energy resources in attempt to meet the energetic demands posed by the stressor. A change in the energy homeostatic balance is thus required to exploit an appropriate resource and deliver useable energy to the target muscles and tissues involved in the stress response. Acutely, this change in energy homeostasis and the liberation of energy is considered advantageous, as it is required for the survival of the organism. However, when an organism is subjected to a prolonged stressor, as is the case during chronic stress, a continuous irregularity in energy homeostasis is considered detrimental and may lead to the development of metabolic disturbances such as cardiovascular disease, type II diabetes mellitus and obesity. This concept has been studied extensively using animal models, and the neurobiological underpinnings of stress induced metabolic disorders are beginning to surface. However, different animal models of stress continue to produce divergent metabolic phenotypes wherein some animals become anorexic and loose body mass while others increase food intake and body mass and become vulnerable to the development of metabolic disturbances. It remains unclear exactly what factors associated with stress models can be used to predict the metabolic outcome of the organism. This review will explore a variety of rodent stress models and discuss the elements that influence the metabolic outcome in order to further our understanding of stress-induced
New Insights into Mutual Funds: Performance and Family Strategies
Huij, Joop
2007-01-01
textabstractJoop Huij was born in Amsterdam on August 11, 1979. He attended the Marnix Gymnasium in Rotterdam, at which he obtained a Gymnasium diploma (Dutch classical pre-university education) in 1997. From 1997 to 2002 Joop studied at Erasmus University Rotterdam. In 2002 he received his Master's degree in Informatics & Economics with appellation cum laude. In November 2002 he joined the Department of Financial Management of RSM Erasmus University as a PhD Candidate. His PhD trajectory was...
The Shock and Vibration Digest. Volume 17. Number 6
1985-06-01
examined during the Rotational Ratio Response Analysis of development of a vacuum pump with flow Flexible Rotor Vibrating System rate 630 cum/ hr . A...College Universiti Teknologi Malaysia , Jalan Gur- Station, TX, May 28-30, 1984, NASA Conf. ney, Juala Lumpur, Malaysia 56 . .**. .. C- i- "’ 2 k t.t "? 2...Spring Support and a Lumped Dcll’Assoc. Ital. Per P’Anal. Delle Solleci- Mass) tazioni, Cosenza, Italy, pp 22-25 (Sept Y. Sugiyama 1982), N84-27731 (In
Liquid Crystal Airborne Display
1977-08-01
Cum.nings, J. P., et al., Properties and Limitations oe Liquid Crystals for Aircraft Displays, Honeywell Corporate Researc ."I Center, Final Report HR-72...basic module could be used to build displays for both the commercial and military! 157- marhecs, and so would establi sh a broad and sizable market ... market for the display becomes a reality; therein lies, f TABLE 16 THE COURSE OF FUTURE DISPLAY DEVELOPMENT Today 1976-77 1980 1985 Display Size 2" 1 3.2
International Nuclear Information System (INIS)
Krishnan, Narayani; Rekha, A.K.; Anilkumar, S.; Sharma, D.N.
2011-01-01
The absolute activity measurement is often necessary to assess the impact of radioactivity contamination due to various incidents. Commercially available portable spectrometer cum dose rate meter is used for the identification of radionuclides involved and associated dose rates. In this paper the authors discusses the study carried out on the applicability of portable spectrometer for absolute radioactivity measurements in water and soil matrices. The portable spectrometer and the methodology developed for activity estimation has been used in many insitu applications. (author)
Process development for gelatinisation and enzymatic hydrolysis of starch at high concentrations
Baks, T.
2007-01-01
cum laude graduation (with distinction) Enzymatic hydrolysis of starch is encountered in day-to-day life for instance in the dishwasher during removal of stains with detergents or in our mouth during chewing of starch-based foods in the presence of saliva. The reaction is also important for the (food) industry, for example for the production of beer or bio-ethanol. In industry, it is usually preceded by gelatinisation to make the starch molecules available for the enzymes. Both gelatinisation...
Territorial Affairs: Turning Battlefields into Marketplaces in Postwar Laos
Dwyer, Michael Benjamin
2011-01-01
As agricultural land has become an increasing target of large-scale, export-oriented bilateral investment-cum-development projects, many have speculated that a neo-colonial "land grab" is underway. Spurred in large part by the food and financial crises of 2007-08, the proliferation of transnational land deals emerged as a topic of scholarly and civil society concern in 2008 and 2009, although details have proven difficult to gather due to the sensitive nature of many land deals, and the specu...
Factors Affecting the Nutritional Status of Pregnant Women
1989-01-01
1988). Circumferences. In T. G. Lohman, A. F. Roche & R. Mortorell [Eds.], 8uth cumLn_ u jQn Reference Manual [pp.39-5q]. Illinois: Human Kinetics Books...Roche, A. F. & Seefeldt, U. D. 188). Circumferences. In T. G. Lohman, A. F. Roche & R. Mortorell [Eds.], eDbhPoics _odad io Reference Manual [pp.39-5q3...respiration and circulation immediately after birth as shown by low Apgar scores, hypoglycemia, hWpothermia and infection. They are more prone to suffer
The dynamics of coupled atom and field assisted by continuous external pumping
International Nuclear Information System (INIS)
Burlak, G.; Hernandez, J.A.; Starostenko, O.
2006-01-01
The dynamics of a coupled system comprising a two-level atom and cavity field assisted by a continuous external classical field (driving Jaynes-Cummings model) is studied. When the initial field is prepared in a coherent state, the dynamics strongly depends on the algebraic sum of both fields. If this sum is zero (the compensative case) in the system, only the vacuum Rabi oscillations occur. The results with dissipation and external field detuning from the cavity field are also discussed. (Author)
The dynamics of coupled atom and field assisted by continuous external pumping
Energy Technology Data Exchange (ETDEWEB)
Burlak, G.; Hernandez, J.A. [Centro de Investigacion en Ingenieria y Ciencias Aplicadas, Universidad Autonoma de Morelos, Cuernavaca, Morelos (Mexico); Starostenko, O. [Departamento de Fisica, Electronica, Sistemas y Mecatronica, Universidad de las Americas, 72820 Puebla (Mexico)
2006-07-01
The dynamics of a coupled system comprising a two-level atom and cavity field assisted by a continuous external classical field (driving Jaynes-Cummings model) is studied. When the initial field is prepared in a coherent state, the dynamics strongly depends on the algebraic sum of both fields. If this sum is zero (the compensative case) in the system, only the vacuum Rabi oscillations occur. The results with dissipation and external field detuning from the cavity field are also discussed. (Author)
Biological effects of laser-induced stress waves
International Nuclear Information System (INIS)
Doukas, A.; Lee, S.; McAuliffe, D.
1995-01-01
Laser-induced stress waves can be generated by one of the following mechanisms: Optical breakdown, ablation or rapid heating of an absorbing medium. These three modes of laser interaction with matter allow the investigation of cellular and tissue responses to stress waves with different characteristics and under different conditions. The most widely studied phenomena are those of the collateral damage seen in photodisruption in the eye and in 193 run ablation of cornea and skin. On the other hand, the therapeutic application of laser-induced stress waves has been limited to the disruption of noncellular material such as renal stones, atheromatous plaque and vitreous strands. The effects of stress waves to cells and tissues can be quite disparate. Stress waves can fracture tissue, damage cells, and increase the permeability of the plasma membrane. The viability of cell cultures exposed to stress waves increases with the peak stress and the number of pulses applied. The rise time of the stress wave also influences the degree of cell injury. In fact, cell viability, as measured by thymidine incorporation, correlates better with the stress gradient than peak stress. Recent studies have also established that stress waves induce a transient increase of the permeability of the plasma membrane in vitro. In addition, if the stress gradient is below the damage threshhold, the cells remain viable. Thus, stress waves can be useful as a means of drug delivery, increasing the intracellular drug concentration and allowing the use of drugs which are impermeable to the cell membrane. The present studies show that it is important to create controllable stress waves. The wavelength tunability and the micropulse structure of the free electron laser is ideal for generating stress waves with independently adjustable parameters, such as rise time, duration and peak stress
Functional role of CCCTC binding factor (CTCF) in stress-induced apoptosis
International Nuclear Information System (INIS)
Li Tie; Lu Luo
2007-01-01
CTCF, a nuclear transcriptional factor, is a multifunctional protein and involves regulation of growth factor- and cytokine-induced cell proliferation/differentiation. In the present study, we investigated the role of CTCF in protecting stress-induced apoptosis in various human cell types. We found that UV irradiation and hyper-osmotic stress induced human corneal epithelial (HCE) and hematopoietic myeloid cell apoptosis detected by significantly increased caspase 3 activity and decreased cell viability. The stress-induced apoptotic response in these cells requires down-regulation of CTCF at both mRNA and protein levels, suggesting that CTCF may play an important role in downstream events of stress-induced signaling pathways. Inhibition of NFκB activity prevented stress-induced down-regulation of CTCF and increased cell viability against stress-induced apoptosis. The anti-apoptotic effect of CTCF was further studied by manipulating CTCF activities in HCE and hematopoietic cells. Transient transfection of cDNAs encoding full-length human CTCF markedly suppressed stress-induced apoptosis in these cells. In contrast, knocking down of CTCF mRNA using siRNA specific to CTCF significantly promoted stress-induced apoptosis. Thus, our results reveal that CTCF is a down stream target of stress-induced signaling cascades and it plays a significant anti-apoptotic role in regulation of stress-induced cellular responses in HCE and hematopoietic myeloid cells
HCV-Induced Oxidative Stress: Battlefield-Winning Strategy
Directory of Open Access Journals (Sweden)
Khadija Rebbani
2016-01-01
Full Text Available About 150 million people worldwide are chronically infected with hepatitis C virus (HCV. The persistence of the infection is controlled by several mechanisms including the induction of oxidative stress. HCV relies on this strategy to redirect lipid metabolism machinery and escape immune response. The 3β-hydroxysterol Δ24-reductase (DHCR24 is one of the newly discovered host markers of oxidative stress. This protein, as HCV-induced oxidative stress responsive protein, may play a critical role in the pathogenesis of HCV chronic infection and associated liver diseases, when aberrantly expressed. The sustained expression of DHCR24 in response to HCV-induced oxidative stress results in suppression of nuclear p53 activity by blocking its acetylation and increasing its interaction with MDM2 in the cytoplasm leading to its degradation, which may induce hepatocarcinogenesis.
Effects of induced stress on seismic forward modelling and inversion
Tromp, Jeroen; Trampert, Jeannot
2018-05-01
We demonstrate how effects of induced stress may be incorporated in seismic modelling and inversion. Our approach is motivated by the accommodation of pre-stress in global seismology. Induced stress modifies both the equation of motion and the constitutive relationship. The theory predicts that induced pressure linearly affects the unstressed isotropic moduli with a slope determined by their adiabatic pressure derivatives. The induced deviatoric stress produces anisotropic compressional and shear wave speeds; the latter result in shear wave splitting. For forward modelling purposes, we determine the weak form of the equation of motion under induced stress. In the context of the inverse problem, we determine induced stress sensitivity kernels, which may be used for adjoint tomography. The theory is illustrated by considering 2-D propagation of SH waves and related Fréchet derivatives based on a spectral-element method.
Pre-cold stress increases acid stress resistance and induces amino ...
African Journals Online (AJOL)
pre-adapted to cold stress revealed induction of amino acid homeostasis and energy ... substrate, thereby reducing yeast and mould ..... spontaneous mutation of llmg_1816 (gdpp) induced by .... species to UV-B-induced damage in bacteria. J.
Central mechanisms of stress-induced headache.
Cathcart, S; Petkov, J; Winefield, A H; Lushington, K; Rolan, P
2010-03-01
Stress is the most commonly reported trigger of an episode of chronic tension-type headache (CTTH); however, the causal significance has not been experimentally demonstrated to date. Stress may trigger CTTH through hyperalgesic effects on already sensitized pain pathways in CTTH sufferers. This hypothesis could be partially tested by examining pain sensitivity in an experimental model of stress-induced headache in CTTH sufferers. Such examinations have not been reported to date. We measured pericranial muscle tenderness and pain thresholds at the finger, head and shoulder in 23 CTTH sufferers (CTH-S) and 25 healthy control subjects (CNT) exposed to an hour-long stressful mental task, and in 23 CTTH sufferers exposed to an hour-long neutral condition (CTH-N). Headache developed in 91% of CTH-S, 4% of CNT, and 17% of CTH-N subjects. Headache sufferers had increased muscle tenderness and reduced pain thresholds compared with healthy controls. During the task, muscle tenderness increased and pain thresholds decreased in the CTH-S group compared with CTH-N and CNT groups. Pre-task muscle tenderness and reduction in pain threshold during task were predictive of the development and intensity of headache following task. The main findings are that stress induced a headache in CTTH sufferers, and this was associated with pre-task muscle tenderness and stress-induced reduction in pain thresholds. The results support the hypothesis that stress triggers CTTH through hyperalgesic effects on already increased pain sensitivity in CTTH sufferers, reducing the threshold to noxious input from pericranial structures.
Diabetic Cardiovascular Disease Induced by Oxidative Stress
Directory of Open Access Journals (Sweden)
Yosuke Kayama
2015-10-01
Full Text Available Cardiovascular disease (CVD is the leading cause of morbidity and mortality among patients with diabetes mellitus (DM. DM can lead to multiple cardiovascular complications, including coronary artery disease (CAD, cardiac hypertrophy, and heart failure (HF. HF represents one of the most common causes of death in patients with DM and results from DM-induced CAD and diabetic cardiomyopathy. Oxidative stress is closely associated with the pathogenesis of DM and results from overproduction of reactive oxygen species (ROS. ROS overproduction is associated with hyperglycemia and metabolic disorders, such as impaired antioxidant function in conjunction with impaired antioxidant activity. Long-term exposure to oxidative stress in DM induces chronic inflammation and fibrosis in a range of tissues, leading to formation and progression of disease states in these tissues. Indeed, markers for oxidative stress are overexpressed in patients with DM, suggesting that increased ROS may be primarily responsible for the development of diabetic complications. Therefore, an understanding of the pathophysiological mechanisms mediated by oxidative stress is crucial to the prevention and treatment of diabetes-induced CVD. The current review focuses on the relationship between diabetes-induced CVD and oxidative stress, while highlighting the latest insights into this relationship from findings on diabetic heart and vascular disease.
International Nuclear Information System (INIS)
Rau, B.; Wust, P.; Tilly, W.; Gellermann, J.; Harder, C.; Riess, H.; Budach, V.; Felix, R.; Schlag, P.M.
2000-01-01
performed, not only of the variance of thermal parameters with respect to clinical criteria such as toxicity, response, and survival but also its dependency on tumor characteristics. Results: The rate of resectability (89%) and response (59%) were high for the PRC group, and a clear positive correlation existed between index temperatures (T 90 ) and thermal doses (cum min T 90 ≥ 40.5 deg. C). Even though the overall 5-year survival was encouraging (60%) and significantly associated with response, there was no statistically significant relationship between temperature parameters and long-term survival for this limited number of patients. However, nonresectable tumors with higher thermal parameters (especially cum min T 90 ≥ 40.5 deg. C) had a tendency for better overall survival. We found even higher temperatures in patients with recurrences (T 90 = 40.7 deg. C versus T 90 = 40.2 deg. C). However, these conditions for easier heating did not involve a favorable clinical outcome, since surgical resectability (22%) and response rate (28%) for the RRC group were low. We did not notice any other dependency of thermal parameters to a specific tumor or patient characteristics. Finally, neither acute toxicity (hot spots) induced by hyperthermia or RCT nor perioperative morbidity were correlated with temperature-derived parameters. Only a higher probability for the occurrence of hot spots was found during treatment with elevated power levels. Conclusion: In this study with two subgroups, i.e., patients with PRC (n = 37) and RRC (n = 18), there exists a positive interrelationship between thermal parameters (such as T 90 , cum min T 90 ≥ 40,5 deg. C) and clinical parameters concerning effectiveness. Additional hyperthermia treatment does not seem to enhance toxicity or subacute morbidity. Procedures to measure temperatures and to derive thermal parameters, as well as the hyperthermia technique itself appear adequate enough to classify heat treatments in sessions as more or less
Ghrelin mediates stress-induced food-reward behavior in mice.
Chuang, Jen-Chieh; Perello, Mario; Sakata, Ichiro; Osborne-Lawrence, Sherri; Savitt, Joseph M; Lutter, Michael; Zigman, Jeffrey M
2011-07-01
The popular media and personal anecdotes are rich with examples of stress-induced eating of calorically dense "comfort foods." Such behavioral reactions likely contribute to the increased prevalence of obesity in humans experiencing chronic stress or atypical depression. However, the molecular substrates and neurocircuits controlling the complex behaviors responsible for stress-based eating remain mostly unknown, and few animal models have been described for probing the mechanisms orchestrating this response. Here, we describe a system in which food-reward behavior, assessed using a conditioned place preference (CPP) task, is monitored in mice after exposure to chronic social defeat stress (CSDS), a model of prolonged psychosocial stress, featuring aspects of major depression and posttraumatic stress disorder. Under this regime, CSDS increased both CPP for and intake of high-fat diet, and stress-induced food-reward behavior was dependent on signaling by the peptide hormone ghrelin. Also, signaling specifically in catecholaminergic neurons mediated not only ghrelin's orexigenic, antidepressant-like, and food-reward behavioral effects, but also was sufficient to mediate stress-induced food-reward behavior. Thus, this mouse model has allowed us to ascribe a role for ghrelin-engaged catecholaminergic neurons in stress-induced eating.
Impact of mechanical stress induced in silica vacuum windows on laser-induced damage.
Gingreau, Clémence; Lanternier, Thomas; Lamaignère, Laurent; Donval, Thierry; Courchinoux, Roger; Leymarie, Christophe; Néauport, Jérôme
2018-04-15
At the interface between vacuum and air, optical windows must keep their optical properties, despite being subjected to mechanical stress. In this Letter, we investigate the impact of such stress on the laser-induced damage of fused silica windows at the wavelength of 351 nm in the nanosecond regime. Different stress values, from 1 to 30 MPa, both tensile and compressive, were applied. No effect of the stress on the laser-induced damage was evidenced.
Stress-Induced Chronic Visceral Pain of Gastrointestinal Origin
Directory of Open Access Journals (Sweden)
Beverley Greenwood-Van Meerveld
2017-11-01
Full Text Available Visceral pain is generally poorly localized and characterized by hypersensitivity to a stimulus such as organ distension. In concert with chronic visceral pain, there is a high comorbidity with stress-related psychiatric disorders including anxiety and depression. The mechanisms linking visceral pain with these overlapping comorbidities remain to be elucidated. Evidence suggests that long term stress facilitates pain perception and sensitizes pain pathways, leading to a feed-forward cycle promoting chronic visceral pain disorders such as irritable bowel syndrome (IBS. Early life stress (ELS is a risk-factor for the development of IBS, however the mechanisms responsible for the persistent effects of ELS on visceral perception in adulthood remain incompletely understood. In rodent models, stress in adult animals induced by restraint and water avoidance has been employed to investigate the mechanisms of stress-induce pain. ELS models such as maternal separation, limited nesting, or odor-shock conditioning, which attempt to model early childhood experiences such as neglect, poverty, or an abusive caregiver, can produce chronic, sexually dimorphic increases in visceral sensitivity in adulthood. Chronic visceral pain is a classic example of gene × environment interaction which results from maladaptive changes in neuronal circuitry leading to neuroplasticity and aberrant neuronal activity-induced signaling. One potential mechanism underlying the persistent effects of stress on visceral sensitivity could be epigenetic modulation of gene expression. While there are relatively few studies examining epigenetically mediated mechanisms involved in visceral nociception, stress-induced visceral pain has been linked to alterations in DNA methylation and histone acetylation patterns within the brain, leading to increased expression of pro-nociceptive neurotransmitters. This review will discuss the potential neuronal pathways and mechanisms responsible for
Stress-Induced Chronic Visceral Pain of Gastrointestinal Origin
Greenwood-Van Meerveld, Beverley; Johnson, Anthony C.
2017-01-01
Visceral pain is generally poorly localized and characterized by hypersensitivity to a stimulus such as organ distension. In concert with chronic visceral pain, there is a high comorbidity with stress-related psychiatric disorders including anxiety and depression. The mechanisms linking visceral pain with these overlapping comorbidities remain to be elucidated. Evidence suggests that long term stress facilitates pain perception and sensitizes pain pathways, leading to a feed-forward cycle promoting chronic visceral pain disorders such as irritable bowel syndrome (IBS). Early life stress (ELS) is a risk-factor for the development of IBS, however the mechanisms responsible for the persistent effects of ELS on visceral perception in adulthood remain incompletely understood. In rodent models, stress in adult animals induced by restraint and water avoidance has been employed to investigate the mechanisms of stress-induce pain. ELS models such as maternal separation, limited nesting, or odor-shock conditioning, which attempt to model early childhood experiences such as neglect, poverty, or an abusive caregiver, can produce chronic, sexually dimorphic increases in visceral sensitivity in adulthood. Chronic visceral pain is a classic example of gene × environment interaction which results from maladaptive changes in neuronal circuitry leading to neuroplasticity and aberrant neuronal activity-induced signaling. One potential mechanism underlying the persistent effects of stress on visceral sensitivity could be epigenetic modulation of gene expression. While there are relatively few studies examining epigenetically mediated mechanisms involved in visceral nociception, stress-induced visceral pain has been linked to alterations in DNA methylation and histone acetylation patterns within the brain, leading to increased expression of pro-nociceptive neurotransmitters. This review will discuss the potential neuronal pathways and mechanisms responsible for stress-induced
Structure-dependent behavior of stress-induced voiding in Cu interconnects
International Nuclear Information System (INIS)
Wu Zhenyu; Yang Yintang; Chai Changchun; Li Yuejin; Wang Jiayou; Li Bin; Liu Jing
2010-01-01
Stress modeling and cross-section failure analysis by focused-ion-beam have been used to investigate stress-induced voiding phenomena in Cu interconnects. The voiding mechanism and the effect of the interconnect structure on the stress migration have been studied. The results show that the most concentrated tensile stress appears and voids form at corners of vias on top surfaces of Cu M1 lines. A simple model of stress induced voiding in which vacancies arise due to the increase of the chemical potential under tensile stress and diffuse under the force of stress gradient along the main diffusing path indicates that stress gradient rather than stress itself determines the voiding rate. Cu interconnects with larger vias show less resistance to stress-induced voiding due to larger stress gradient at corners of vias.
Stress-induced variation in evolution: from behavioural plasticity to genetic assimilation.
Badyaev, Alexander V
2005-05-07
Extreme environments are closely associated with phenotypic evolution, yet the mechanisms behind this relationship are poorly understood. Several themes and approaches in recent studies significantly further our understanding of the importance that stress-induced variation plays in evolution. First, stressful environments modify (and often reduce) the integration of neuroendocrinological, morphological and behavioural regulatory systems. Second, such reduced integration and subsequent accommodation of stress-induced variation by developmental systems enables organismal 'memory' of a stressful event as well as phenotypic and genetic assimilation of the response to a stressor. Third, in complex functional systems, a stress-induced increase in phenotypic and genetic variance is often directional, channelled by existing ontogenetic pathways. This accounts for similarity among individuals in stress-induced changes and thus significantly facilitates the rate of adaptive evolution. Fourth, accumulation of phenotypically neutral genetic variation might be a common property of locally adapted and complex organismal systems, and extreme environments facilitate the phenotypic expression of this variance. Finally, stress-induced effects and stress-resistance strategies often persist for several generations through maternal, ecological and cultural inheritance. These transgenerational effects, along with both the complexity of developmental systems and stressor recurrence, might facilitate genetic assimilation of stress-induced effects. Accumulation of phenotypically neutral genetic variance by developmental systems and phenotypic accommodation of stress-induced effects, together with the inheritance of stress-induced modifications, ensure the evolutionary persistence of stress-response strategies and provide a link between individual adaptability and evolutionary adaptation.
Irradiation-induced stress relaxation of Eurofer97 steel
International Nuclear Information System (INIS)
Luzginova, N.V.; Jong, M.; Rensman, J.W.; Hegeman, J.B.J.; Laan, J.G. van der
2011-01-01
The irradiation-induced stress relaxation behavior of Eurofer97 at 300 deg. C up to 3.4 dpa and under pre-stress loads typical for the ITER applications is investigated. The bolt specimens are pre-loaded from 30% to 90% of the yield strength. To verify the results obtained with the pre-stressed bolts, bent strips were investigated as well. The strips are bent into a pre-defined radius in order to achieve similar pre-stress levels. The irradiation-induced stress relaxation is found to be independent of the pre-stress level. 10-12% of the stress relaxation in Eurofer97 may be reached after a dose of 0.1 dpa, and after an irradiation dose of 2.7 dpa 42-47% of the original pre-stress is retained.
FMRFamide signaling promotes stress-induced sleep in Drosophila.
Lenz, Olivia; Xiong, Jianmei; Nelson, Matthew D; Raizen, David M; Williams, Julie A
2015-07-01
Enhanced sleep in response to cellular stress is a conserved adaptive behavior across multiple species, but the mechanism of this process is poorly understood. Drosophila melanogaster increases sleep following exposure to septic or aseptic injury, and Caenorhabditis elegans displays sleep-like quiescence following exposure to high temperatures that stress cells. We show here that, similar to C. elegans, Drosophila responds to heat stress with an increase in sleep. In contrast to Drosophila infection-induced sleep, heat-induced sleep is not sensitive to the time-of-day of the heat pulse. Moreover, the sleep response to heat stress does not require Relish, the NFκB transcription factor that is necessary for infection-induced sleep, indicating that sleep is induced by multiple mechanisms from different stress modalities. We identify a sleep-regulating role for a signaling pathway involving FMRFamide neuropeptides and their receptor FR. Animals mutant for either FMRFamide or for the FMRFamide receptor (FR) have a reduced recovery sleep in response to heat stress. FR mutants, in addition, show reduced sleep responses following infection with Serratia marcescens, and succumb to infection at a faster rate than wild-type controls. Together, these findings support the hypothesis that FMRFamide and its receptor promote an adaptive increase in sleep following stress. Because an FMRFamide-like neuropeptide plays a similar role in C. elegans, we propose that FRMFamide neuropeptide signaling is an ancient regulator of recovery sleep which occurs in response to cellular stress. Copyright © 2015 Elsevier Inc. All rights reserved.
Salubrious effects of oxytocin on social stress-induced deficits
Smith, Adam S.; Wang, Zuoxin
2012-01-01
Social relationships are a fundamental aspect of life, affecting social, psychological, physiological, and behavioral functions. While social interactions can attenuate stress and promote health, disruption, confrontations, isolation, or neglect in the social environment can each be major stressors. Social stress can impair the basal function and stress-induced activation of the hypothalamic-pituitary-adrenal (HPA) axis, impairing function of multiple biological systems and posing a risk to mental and physical health. In contrast, social support can ameliorate stress-induced physiological and immunological deficits, reducing the risk of subsequent psychological distress and improving an individual's overall well-being. For better clinical treatment of these physiological and mental pathologies, it is necessary to understand the regulatory mechanisms of stress-induced pathologies as well as determine the underlying biological mechanisms that regulate social buffering of the stress system. A number of ethologically relevant animal models of social stress and species that form strong adult social bonds have been utilized to study the etiology, treatment, and prevention of stress-related disorders. While undoubtedly a number of biological pathways contribute to the social buffering of the stress response, the convergence of evidence denotes the regulatory effects of oxytocin in facilitating social bond-promoting behaviors and their effect on the stress response. Thus, oxytocin may be perceived as a common regulatory element of the social environment, stress response, and stress-induced risks on mental and physical health. PMID:22178036
Subsurface Assessment at McMurdo Station, Antarctica
2017-02-01
surface albedo of the bare ground . Figure 2. Soil temperature with depth collected from 1994 to 1996 by Tumeo and Cummings (1996). Campbell et...example photo- graphs in Figures 5–9 of the entire pit with segregated ice at Site 1, mas- sive ice at Site 2 and Site 4, man-made fill at Site 3, and...excavation was approxi- mately from the surface down to 0.3 m; and ice lenses (mainly segregated ice) were found just below 0.3 m ( Figure 10). The
Integrable Time-Dependent Quantum Hamiltonians
Sinitsyn, Nikolai A.; Yuzbashyan, Emil A.; Chernyak, Vladimir Y.; Patra, Aniket; Sun, Chen
2018-05-01
We formulate a set of conditions under which the nonstationary Schrödinger equation with a time-dependent Hamiltonian is exactly solvable analytically. The main requirement is the existence of a non-Abelian gauge field with zero curvature in the space of system parameters. Known solvable multistate Landau-Zener models satisfy these conditions. Our method provides a strategy to incorporate time dependence into various quantum integrable models while maintaining their integrability. We also validate some prior conjectures, including the solution of the driven generalized Tavis-Cummings model.
IOLOGICAL IMPORTANCE AND TOXICITY OF HEAVY METALS FOR BIOTA OF FRESHWATER BODIES (REVIEW)
I. Hrytsyniak; N. Kolesnyk
2014-01-01
Purpose. To investigate the sources of scientific information on biological functions of heavy metals (Fe, Zn, Mn, Cu, Ni, Co, Pb, Cd) and their negative effect on biota of fresh water bodies. Findings. A review of works of a variety of scientists showed that the majority of the studied heavy metals (Fe, Zn, Mn, Cum and Co) played an important role in vital functions of freshwater organisms. The significance of other studied heavy metals (Ni, Pb, and Cd) is probable or unknown. Besides bi...
Infección urinaria en niños: evaluación imagenológica
Bernadá, Mercedes; Pereda, Macarena; Fernández, Ana; Russomano, Flor; Alonso, Bernardo; Álvarez, Luciano; Varacchi, Claudio; Lechini, Rosana; Mariño, Silvana; Traversa, Mercedes; Otero, Andrea; Patiño, Sisina; Perdomo, Virginia
2005-01-01
La infección del tracto urinario (ITU) es frecuente en pediatría y es considerada un marcador biológico de enfermedad anatómica o funcional del aparato urinario en niños. Se realizó un estudio prospectivo en cuatro hospitales públicos de Uruguay cuyos objetivos fueron: conocer la prevalencia de enfermedad nefrourinaria asociada; comparar resultados de la cistouretrografía miccional (CUM) realizada en dos oportunidades distintas; analizar en menores de 2 años los hallazgos centellográficos en ...
CSIR Research Space (South Africa)
Cummings, F
2009-11-01
Full Text Available Cummings Energy and Processes Materials Science and Manufacturing Council for Scientific and Industrial Research P.O. Box 395 Pretoria 0001, South Africa 27 November 2009 CONTENT head2rightBackground head2rightCSIR Dye Solar Cell Research head2... rightCollaborations and Links © CSIR 2007 www.csir.co.za head2rightAcknowledgements BACKGROUND head2rightSA is dry: Annual rainfall average of 450 mm compared with a world average of 860 mm head2rightOn upside, we have some...
Schuklenk, Udo
This paper makes an affirmative ethical case in favour of the decriminalization of assisted dying in Canada. It then proceeds to defending the affirmative case against various slippery-slope arguments that are typically deployed by opponents of assisted dying. Finally, a recent case of questionable professional conduct by anti-euthanasia campaigners cum academics is flagged as a warning to all of us not to permit the quality of the professional debate to deteriorate unacceptably, despite the personal emotional investments involved on all sides of the debate.
HIV Risk Reduction Among Young Adult Chronic Psychiatric Patients
1990-08-28
emotional language to convey information on risk reduction. Common myths concerning transmission are presented and the audience is specifically told that...current study include: ’Can contact with semen (cum) from the penis result In AIDS?’,’ Can a person get AIDS from vaginal fluids in a woman’s vagina ? Can...hands. It doesn’t like being exposed to sunlight or air. Female: The AIDS virus lives inside the human body, in the blood, in a woman’s vagina and
Optimal control of a qubit in an optical cavity
International Nuclear Information System (INIS)
Deffner, Sebastian
2014-01-01
We study quantum information processing by means of optimal control theory. To this end, we analyze the damped Jaynes–Cummings model, and derive optimal control protocols that minimize the heating or energy dispersion rates, and controls that drive the system at the quantum speed limit. Special emphasis is put on analyzing the subtleties of optimal control theory for our system. In particular, it is shown how two fundamentally different approaches to the quantum speed limit can be reconciled by carefully formulating the problem. (paper)
Rabi oscillations a quantum dot exposed to quantum light
International Nuclear Information System (INIS)
Magyarov, A.; Slepyan, G.Ya.; Maksimenko, S.A.; Hoffmann, A.
2007-01-01
The influence of the local field on the excitonic Rabi oscillations in an isolated quantum dot driven by the coherent state of light has been theoretically investigated. Local field is predicted to entail the appearance of two oscillatory regimes in the Rabi effect separated by the bifurcation. In the first regime Rabi oscillations are periodic and do not reveal collapse-revivals phenomenon, while in the second one collapse and revivals appear, showing significant difference as compared to those predicted by the standard Jaynes-Cummings model
Shadows of the Plantation? A Social History of Suriname’s Bauxite Town Moengo
Directory of Open Access Journals (Sweden)
Anouk de Koning
2011-12-01
Full Text Available This article explores the social history of Suriname’s first bauxite town, Moengo, founded in the late 1910s. It recounts the rise of a new industry that drew workers away from the plantations and urban artisanal occupations to work in a massive, highly organized and orchestrated organization-cum-social community. Using oral narratives about life in Moengo, as well as census and other statistical data, this contribution asks whether everyday life in the mining enclave echoed features of the plantation.
End user programming with personally meaningful objects
CSIR Research Space (South Africa)
Smith, Andrew C
2016-09-01
Full Text Available (Kimchi et al., 2003). Perceptual organisation is a neuro-cognitive process that dictates how we perceive objects in physical space and how we interpret some objects as being distinct from others and yet other objects as part of a whole (Helm, 2014... called the designer-cum-user. Using this approach, the user creates a personally meaningful artefact that represents the target product. Although not confirmed, we anticipate that this approach reduces the initial cognitive load on the user when he uses...
Directory of Open Access Journals (Sweden)
Zhanqiang Ma
2013-01-01
Full Text Available The aim of this study was to establish an experimental model for metabonomic profiles of the rat’s brain and then to investigate the antidepressant effect of Banxia Houpu decoction (BHD and its possible mechanisms. Behavioral research and metabonomics method based on UPLC-MS were used to assess the efficacy of different fractions of BHD on chronic unpredictable mild stress (CUMS model of depression. There was a significant difference between the BHD group and the model group. Eight endogenous metabolites, which are contributing to the separation of the model group and control group, were detected, while BHD group regulated the perturbed metabolites showing that there is a tendency of recovery compared to control group. Therefore, we think that those potential metabolite biomarkers have some relationship with BHD’s antidepression effect. This work appraised the antidepressant effect of Banxia Houpu decoction as well as revealing a metabonomics method, a valuable parameter in the TCM research.
Impact of work-induced stress on perceived workers' productivity in ...
African Journals Online (AJOL)
Impact of work-induced stress on perceived workers' productivity in banking ... The study investigated the relationship among work-induced stress, job performance, ... tend to reduce effects of work-related stress on workers' health and welfare.
Telang, A.; Gnäupel-Herold, T.; Gill, A.; Vasudevan, V. K.
2018-04-01
In this study, the effects of applied tensile stress and temperature on laser shock peening (LSP) and cavitation shotless peening (CSP)-induced compressive residual stresses were investigated using neutron and x-ray diffraction. Residual stresses on the surface, measured in situ, were lower than the applied stress in LSP- and CSP-treated Alloy 600 samples (2 mm thick). The residual stress averaged over the volume was similar to the applied stress. Compressive residual stresses on the surface and balancing tensile stresses in the interior relax differently due to hardening induced by LSP. Ex situ residual stress measurements, using XRD, show that residual stresses relaxed as the applied stress exceeded the yield strength of the LSP- and CSP-treated Alloy 600. Compressive residual stresses induced by CSP and LSP decreased by 15-25% in magnitude, respectively, on exposure to 250-450 °C for more than 500 h with 10-11% of relaxation occurring in the first few hours. Further, 80% of the compressive residual stresses induced by LSP and CSP treatments in Alloy 600 were retained even after long-term aging at 350 °C for 2400 h.
Social factors modulate restraint stress induced hyperthermia in mice.
Watanabe, Shigeru
2015-10-22
Stress-induced hyperthermia (SIH) was examined in three different social conditions in mice by thermographic measurement of the body surface temperature. Placing animals in cylindrical holders induced restraint stress. I examined the effect of the social factors in SIH using the thermograph (body surface temperature). Mice restrained in the holders alone showed SIH. Mice restrained in the holders at the same time as other similarly restrained cage mates (social equality condition) showed less hyperthermia. Interestingly, restrained mice with free moving cage mates (social inequality condition) showed the highest hyperthermia. These results are consistent with a previous experiment measuring the memory-enhancing effects of stress and the stress-induced elevation of corticosterone, and suggest that social inequality enhances stress. Copyright © 2015 Elsevier B.V. All rights reserved.
Sol-gel-cum-hydrothermal synthesis of mesoporous Co-Fe@Al2O3 ...
Indian Academy of Sciences (India)
Oxides; sol-gel; adsorption; surface properties; composite materials. 1. Introduction. Industrial dyes ... acid green 25, Congo red, N719), phenolic compounds. (bromophenol blue .... microscopy (TEM) images were obtained using Philips CM.
Sucevița – l’iconographie du premier synode œcuménique
Directory of Open Access Journals (Sweden)
Ecaterina Cincheza Buculei
2015-12-01
Full Text Available The very special manner in which the First Ecumenical Council was reproduced at Suceviţa – the presence of Empress Elena next to Constantine and their association with the cross between them, The Vision of St. Peter from Alexandria, the moment when Arius was spanked by St. Nicholas who holds his beard and the unique episode of Arius’death in a public latrine as a result of his unbelief – reflects on one hand, the connection of the Council with the Liturgy and with the Trinity dogma and, on the other hand, they emphasize the victory of the true faith defended at Nicaea. It was the confession of this faith that brought the sacrifice of the Saints from the Menology, an amply painted theme on all walls of the narthex.
Pseudo-invariant Eigen-Operator Method for Solving Field-Intensity-Dependent Jaynes-Cummings Model
International Nuclear Information System (INIS)
Yu Taxi; Fan Hongyi
2010-01-01
By using the pseudo invariant eigen-operator method we analyze the field-intensity-dependent Jaynes-Gumming (JC) model. The pseudo-invariant eigen-operator is found in terms of the supersymmetric generators. The energy-level gap of this JC Hamiltonian is derived. This approach seems concise. (general)
Cum se construiește profilul strategic al unei comunități
Directory of Open Access Journals (Sweden)
Călin Emilian HINȚEA
2015-12-01
Full Text Available The article presents a particular methodology of strategic planning: building a strategic profile of the community. This model is the result of years of research and applied planning in local communities and tries to help all interested parties to understand and use the strategy.
International Nuclear Information System (INIS)
Cabanilla, Liborio S.; Corro, Rudy Jr.; Andog, Gerard
2015-01-01
A 40MW Geothermal power plant will soon rise in Naujan, Oriental Mindoro. To be managed by the Emerging Power, Inc. (EPI), it covers the political jurisdiction of three villages where 4,219 individuals or 1,021 households reside. Agriculture and fishing are the predominant sources of income of local residents with average daily per capita income of Php50. This is almost 20 percent below the poverty thresholds. Agriculture is coconut-based, intercropped predominantly with banana, and a few fruit trees (e.g. Coffee, cacao). Farming is primarily mountain eco-system and ecologically fragile, as cultivation has now encroached in areas serving sources of potable water for the communities. Sustainability of agricultural production is in jeopardy in view of the need to expand economic opportunities among residents. It is critical that new value-adding activities consistent with the resource endowments of the locality to be developed. The introduction of agri-based social enterprises could pave the way for weaving together the economic requirements of residents and environmental stability. This study provides an analysis of the feasibility of undertaking non-power applications in agriculture and fishery, of geothermal resources in Naujan, Oriental Mindoro. It identifies agribusiness enterprises that will address socio-economic demands of the communities covered by the Geothermal project, at the same time promoting agriculture sustainability. Using both secondary and primary data, it employs simple economic analysis in assessing the effects of directly using geothermal resources in the agribusiness enterprises. Based on available information there is evidence that there are substantial economic benefits from non-power application of geothermal resources in the project site. Copra drying using geothermal heat in place of the traditional “tapahan” system ensures higher product quality and more favorable farm gate prices. New value-adding activities from agro-processing using geothermal heat will enhance economic opportunities of local residents. (author)
Entanglement Evolution of Jaynes-Cummings Model in Resonance Case and Non-resonance Case
Cheng, Jing; Chen, Xi; Shan, Chuan-Jia
2018-03-01
We investigate the entanglement evolution of a two-level atom and a quantized single model electromagnetic filed in the resonance and non-resonance cases. The effects of the initial state, detuning degree, photon number on the entanglement are shown in detail. The results show that the atom-cavity entanglement state appears with periodicity. The increasing of the photon number can make the period of quantum entanglement be shorter. In the non-resonant case, if we choose the suitable initial state the entanglement of atom-cavity can be 1.0
International Nuclear Information System (INIS)
Guo, X.Z.; Gao, K.W.; Chu, W.Y.; Qiao, L.J.
2003-01-01
The flow stress of a specimen of α-Ti before unloading is different with the yield stress of the same specimen after unloading and forming a passive film through immersing in a methanol solution at various constant potentials. The difference is the passive film-induced stress. The film-induced stress and susceptibility to stress corrosion cracking (SCC) in the methanol solution at various potentials were measured. At the stable open-circuit potential and under anodic polarization, both film-induced tensile stress σ p and susceptibility to SCC had a maximum value. The film-induced stress and SCC susceptibility, however, decreased steeply with a decrease in potential under cathodic polarization. When the potential V≤-280 mV SCE , the film-induced stress became compressive; correspondingly, susceptibility to SCC was zero. Therefore, the variation of film-induced stress with potential was consistent with that of susceptibility to SCC. A large film-induced tensile stress is the necessary condition for SCC of α-Ti in the methanol solution. The symbol and amount of the film-induced stress were related to the compositions of the passive film, which have been analyzed using the X-ray photoelectron spectrum (XPS)
Clonidine blocks stress-induced craving in cocaine users.
Jobes, Michelle L; Ghitza, Udi E; Epstein, David H; Phillips, Karran A; Heishman, Stephen J; Preston, Kenzie L
2011-11-01
Reactivity to stressors and environmental cues, a putative cause of relapse in addiction, may be a useful target for relapse-prevention medication. In rodents, alpha-2 adrenergic agonists such as clonidine block stress-induced reinstatement of drug seeking, but not drug cue-induced reinstatement. The objective of this study is to test the effect of clonidine on stress- and cue-induced craving in human cocaine users. Healthy, non-treatment-seeking cocaine users (n = 59) were randomly assigned to three groups receiving clonidine 0, 0.1, or 0.2 mg orally under double-blind conditions. In a single test session, each participant received clonidine or placebo followed 3 h later by exposure to two pairs of standardized auditory-imagery scripts (neutral/stress and neutral/drug). Subjective measures of craving were collected. Subjective responsivity ("crave cocaine" Visual Analog Scale) to stress scripts was significantly attenuated in the 0.1- and 0.2-mg clonidine groups; for drug-cue scripts, this attenuation occurred only in the 0.2-mg group. Other subjective measures of craving showed similar patterns of effects but Dose × Script interactions were not significant. Clonidine was effective in reducing stress-induced (and, at a higher dose, cue-induced) craving in a pattern consistent with preclinical findings, although this was significant on only one of several measures. Our results, though modest and preliminary, converge with other evidence to suggest that alpha-2 adrenergic agonists may help prevent relapse in drug abusers experiencing stress or situations that remind them of drug use.
International Nuclear Information System (INIS)
Densmore, Jeffery D.; Larsen, Edward W.
2004-01-01
The equations of nonlinear, time-dependent radiative transfer are known to yield the equilibrium diffusion equation as the leading-order solution of an asymptotic analysis when the mean-free path and mean-free time of a photon become small. We apply this same analysis to the Fleck-Cummings, Carter-Forest, and N'kaoua Monte Carlo approximations for grey (frequency-independent) radiative transfer. Although Monte Carlo simulation usually does not require the discretizations found in deterministic transport techniques, Monte Carlo methods for radiative transfer require a time discretization due to the nonlinearities of the problem. If an asymptotic analysis of the equations used by a particular Monte Carlo method yields an accurate time-discretized version of the equilibrium diffusion equation, the method should generate accurate solutions if a time discretization is chosen that resolves temperature changes, even if the time steps are much larger than the mean-free time of a photon. This analysis is of interest because in many radiative transfer problems, it is a practical necessity to use time steps that are large compared to a mean-free time. Our asymptotic analysis shows that: (i) the N'kaoua method has the equilibrium diffusion limit, (ii) the Carter-Forest method has the equilibrium diffusion limit if the material temperature change during a time step is small, and (iii) the Fleck-Cummings method does not have the equilibrium diffusion limit. We include numerical results that verify our theoretical predictions
International Nuclear Information System (INIS)
Yohe, G.W.; Carnegie Mellon University, Pittsburgh, PA
2001-01-01
This note employs the economics paradigm to sort through the complications of relying simultaneously on biomass fuels, carbon capture with active sequestration and passive carbon sequestration to meet Kyoto-style carbon emission limits. It does so by exploiting the structure of a tax cum repurchase scheme for carbon. Under such a scheme, the carbon content of fossil fuel should be taxed at the point of purchase at a price that matches the shadow price of the carbon emission limit, but carbon embedded in biomass fuel should go un-taxed. The price of biomass fuel would, though, have to reflect the marginal cost of any externalities it might cause and the opportunity cost of its land-use requirements. Captured carbon could be repurchased at a price equal to the shadow price of carbon, net of the cost of active sequestration, itself the sum of private and social marginal costs. Finally, the price of the passive sequestration of carbon should equal the shadow price of carbon, net of the opportunity cost of setting those resources aside. Since a marketable permit system would support direct estimates of the requisite shadow price of carbon, such a system would also provide direct information about base prices for the tax cum repurchase scheme. To support long-term investment in biomass supply and sequestration, though, changes over time in emission limits must be accomplished in a smooth and predictable manner. (author)
Modelos determinísticos de inventarios para demanda independiente. Un estudio en Venezuela
Directory of Open Access Journals (Sweden)
Carlos Enrique Bustos Flores
2012-01-01
Full Text Available El objetivo de este trabajo es analizar los siguientes modelos determinísticos de inventarios para demanda independiente: un solo lote, lote por lote, cantidad económica de pedido (EOQ, algoritmo Silver-Meal (SM, costo unitario mínimo (CUM, balanceo de periodo fragmentado (BPF y algoritmo de Wagner-Whitin (WW. Estos modelos surgen del supuesto clave de que la demanda conocida con cierto grado de certidumbre de un artículo que se lleva en inventario es independiente de la demanda de cualquier otro artículo que también se lleve en dicho inventario. Con la intención de lograr el objetivo planteado, los modelos mencionados son aplicados para el cálculo de los tamaños de lotes óptimos de resmas de papel carta y oficio de acuerdo con los registros de demanda real e independiente suministrados por el departamento de Publicaciones de la Facultad de Ciencias Económicas y Sociales (FACES en la Universidad de Los Andes (ULA, en Mérida, Venezuela. La principal conclusión que se deriva de los resultados obtenidos es que el método de un solo lote, utilizado por la administración de la FACES, comparado con los modelos de lote por lote, EOQ, SM, CUM, BPF y WW, es el más costoso y, en consecuencia, el menos indicado.
Ramajo, L
2016-05-17
Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.
Ramajo, L; Prado, L; Rodriguez-Navarro, AB; Lardies, MA; Duarte, Carlos M.; Lagos, NA
2016-01-01
Environmental gradients play an important role in shaping geographic variability in coastal marine populations. Thus, the ability of organisms to cope with these changes will depend on their potential to acclimatize, or adapt, to these new environmental conditions. We investigated the spatial variability in biological responses shown by Perumytilus purpuratus mussels collected from 2 intertidal areas experiencing contrasting freshwater input influences (river-influenced vs. marine conditions). To highlight the role of plasticity and adaptive potential in biological responses, we performed a reciprocal-Transplant experiment and measured relevant phenotypic traits including mortality, growth, calcification, metabolism, and chemical composition of the shell periostra-cum. We determined that mussels exposed to river-influenced conditions had increased metabolic rates and reduced growth rates, as compared to mussels experiencing marine conditions (p > 0.05). While the energy investment strategies of the 2 local populations resulted in similar net calcification rates, these rates decreased significantly when mussels were transplanted to the river-influenced site. Stressful conditions at the river-influenced site were evidenced by decreased survivorship across treatments. Freshwater inputs modify the organic composition of the shell periostracum through a significant reduction in polysaccharides. Although our field experiment did not identify specific environmental factors underlying these contrasting phenotypic changes, the results imply that plasticity plays a strong role when P. purpuratus is exposed to some combination of natural (e.g. salinity) and anthropogenic influences (e.g. pollution), and that the lack of exposure to freshwater may promote less tolerant mussels with greater potential for local adaptation. © The authors 2016.
Geranylgeranylacetone prevents stress-induced decline of leptin secretion in mice.
Itai, Miki; Kuwano, Yuki; Nishikawa, Tatsuya; Rokutan, Kazuhito; Kensei, Nishida
2018-01-01
Geranylgeranylacetone (GGA) is a chaperon inducer that protects various types of cell and tissue against stress. We examined whether GGA modulated energy intake and expenditure under stressful conditions. After mice were untreated or treated orally with GGA (0.16 g per kg body weight per day) for 10 days, they were subjected to 2-h restraint stress once or once a day for 5 consecutive days. GGA administration did not affect corticosterone response to the stress. Restraint stress rapidly decreased plasma leptin levels in control mice. GGA significantly increased circulating leptin levels without changing food intake and prevented the stress-induced decline of circulating leptin. However GGA-treated mice significantly reduced food intake during the repeated stress, compared with control mice. GGA prevented the stress-induced decline of leptin mRNA and its protein levels in epidydimal adipose tissues. We also found that GGA decreased ghrelin mRNA expression in gastric mucosa before the stress, whereas GGA-treated mice recovered the ghrelin mRNA expression to the baseline level after the repeated stress. Leptin and ghrelin are now recognized as regulators of anxiety and depressive mood. Our results suggest that GGA may regulate food intake and relief stress-induced mood disturbance through regulating leptin and ghrelin secretions. J. Med. Invest. 65:103-109, February, 2018.
Effects of Active Mastication on Chronic Stress-Induced Bone Loss in Mice.
Azuma, Kagaku; Furuzawa, Manabu; Fujiwara, Shu; Yamada, Kumiko; Kubo, Kin-ya
2015-01-01
Chronic psychologic stress increases corticosterone levels, which decreases bone density. Active mastication or chewing attenuates stress-induced increases in corticosterone. We evaluated whether active mastication attenuates chronic stress-induced bone loss in mice. Male C57BL/6 (B6) mice were randomly divided into control, stress, and stress/chewing groups. Stress was induced by placing mice in a ventilated restraint tube (60 min, 2x/day, 4 weeks). The stress/chewing group was given a wooden stick to chew during the experimental period. Quantitative micro-computed tomography, histologic analysis, and biochemical markers were used to evaluate the bone response. The stress/chewing group exhibited significantly attenuated stress-induced increases in serum corticosterone levels, suppressed bone formation, enhanced bone resorption, and decreased trabecular bone mass in the vertebrae and distal femurs, compared with mice in the stress group. Active mastication during exposure to chronic stress alleviated chronic stress-induced bone density loss in B6 mice. Active mastication during chronic psychologic stress may thus be an effective strategy to prevent and/or treat chronic stress-related osteopenia.
Hydrogen-peroxide-induced oxidative stress responses in Desulfovibrio vulgaris Hildenborough
Energy Technology Data Exchange (ETDEWEB)
Zhou, A.; He, Z.; Redding-Johanson, A.M.; Mukhopadhyay, A.; Hemme, C.L.; Joachimiak, M.P.; Bender, K.S.; Keasling, J.D.; Stahl, D.A.; Fields, M.W.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Zhou, J.; Luo, F.; Deng, Y.; He, Q.
2010-07-01
To understand how sulphate-reducing bacteria respond to oxidative stresses, the responses of Desulfovibrio vulgaris Hildenborough to H{sub 2}O{sub 2}-induced stresses were investigated with transcriptomic, proteomic and genetic approaches. H{sub 2}O{sub 2} and induced chemical species (e.g. polysulfide, ROS) and redox potential shift increased the expressions of the genes involved in detoxification, thioredoxin-dependent reduction system, protein and DNA repair, and decreased those involved in sulfate reduction, lactate oxidation and protein synthesis. A gene coexpression network analysis revealed complicated network interactions among differentially expressed genes, and suggested possible importance of several hypothetical genes in H{sub 2}O{sub 2} stress. Also, most of the genes in PerR and Fur regulons were highly induced, and the abundance of a Fur regulon protein increased. Mutant analysis suggested that PerR and Fur are functionally overlapped in response to stresses induced by H{sub 2}O{sub 2} and reaction products, and the upregulation of thioredoxin-dependent reduction genes was independent of PerR or Fur. It appears that induction of those stress response genes could contribute to the increased resistance of deletion mutants to H{sub 2}O{sub 2}-induced stresses. In addition, a conceptual cellular model of D. vulgaris responses to H{sub 2}O{sub 2} stress was constructed to illustrate that this bacterium may employ a complicated molecular mechanism to defend against the H{sub 2}O{sub 2}-induced stresses.
Few-Photon Model of the Optical Emission of Semiconductor Quantum Dots
Richter, Marten; Carmele, Alexander; Sitek, Anna; Knorr, Andreas
2009-08-01
The Jaynes-Cummings model provides a well established theoretical framework for single electron two level systems in a radiation field. Similar exactly solvable models for semiconductor light emitters such as quantum dots dominated by many particle interactions are not known. We access these systems by a generalized cluster expansion, the photon-probability cluster expansion: a reliable approach for few-photon dynamics in many body electron systems. As a first application, we discuss vacuum Rabi oscillations and show that their amplitude determines the number of electrons in the quantum dot.
Mejoramiento de Vivienda como Estrategia de Control de la Enfermedad de Chagas.
Victor Manuel Ángulo; F. Michaels; N. Aguilar
2000-01-01
El Proceso en Colombia.
La Constitución Política de 1991 en el artículo 51 estableció que todos los colombianos tienen derecho a una vivienda digna. Para dar cum-plimiento a este mandato se instituyó la ley 3 de 1991 que creó el subsidio de vivienda y el sistema SISBEN. El desarrollo estatutario de esta ley dejó en manos de la Red de Solidaridad Social (RSS) y la Caja Agraria (CA) la metodología para que las comunidades de los diferentes...
International Nuclear Information System (INIS)
Ramamoorthy, N.
2016-01-01
Nuclear and radiation applications play a significant role in aiding industrial process management, food security and safety, health care practices, manufacturing and value-addition to certain materials, treating pollutants/waste, etc. Most of these applications have contributed to improving the quality of life and industrial efficiency. India is among the large-scale producers cum users of radioisotope products and radiation technology applications over the past nearly five decades, thanks to the Department of Atomic Energy (DAE) and its various units pioneering the development and deployment of the above-mentioned applications in our country
Evolution of entanglement under echo dynamics
International Nuclear Information System (INIS)
Prosen, Tomaz; Znidaric, Marko; Seligman, Thomas H.
2003-01-01
Echo dynamics and fidelity are often used to discuss stability in quantum-information processing and quantum chaos. Yet fidelity yields no information about entanglement, the characteristic property of quantum mechanics. We study the evolution of entanglement in echo dynamics. We find qualitatively different behavior between integrable and chaotic systems on one hand and between random and coherent initial states for integrable systems on the other. For the latter the evolution of entanglement is given by a classical time scale. Analytic results are illustrated numerically in a Jaynes-Cummings model
International Nuclear Information System (INIS)
Winkler, R.; Hoetzl, H.
1983-01-01
The immission measurement of alpha rays as an environmental monitoring programme is necessary for the production and processing of fuel elements and the WAA. Keeping within the dose limits according to Strl Sch V can only be achieved, if the important radio nuclides are detected with a detection limit, which corresponds to 1130 of the dose limits. For Pu 239/240, this is 3.7 x 10 -6 Bg/m 3 (0.1 f Cu/m 3 ). These detection limits can be achieved by analysis of individual nuclides. (DG) [de
Approximate discrete time analysis of the hybrid Token-CDMA MAC system
CSIR Research Space (South Africa)
Liu, YS
2007-09-01
Full Text Available Force (I.E.T.F.), July 1999 Principal Author: Mr. Yi-Sheng Liu attained his BScEng degree in March 2001 and MScEng degree with Cum Laude in December 2003 in the School of Electrical, Electronic and Computer Engineering at the University of Natal... of the Centre for Radio Access Technology (CRAT) at the same university. He holds a BScEng with first class honours in Electrical Engineering from Manchester University and a PhD degree from Cambridge, United Kingdom. His research interests are in the general...
How to solve the tragedy of the commons? Social entrepreneurs and global public goods
DEFF Research Database (Denmark)
Ueda, Yoshifumi; Svendsen, Gert Tinggaard
2002-01-01
and efficacy of financing a global public good on a local scale is analyzed in a "selective incentive-cum-global public good" model. Because local networks can play a significant role in preserving the global commons, this finding has important policy implications for global public good provisions......We show that when a star type network is formed by an entrepreneur, a non-profit organization run by a social entrepreneur is more reconcilable with the social objective of providing the global public good than a profit organization run by a business entrepreneur. This network formation...
Directory of Open Access Journals (Sweden)
Eneko Osaba
2016-12-01
Full Text Available This paper aims to give a presentation of the PhD defended by Eneko Osaba on November 16th, 2015, at the University of Deusto. The thesis can be placed in the field of artificial intelligence. Specifically, it is related with multi- population meta-heuristics for solving vehicle routing problems. The dissertation was held in the main auditorium of the University, in a publicly open presentation. After the presentation, Eneko was awarded with the highest grade (cum laude. Additionally, Eneko obtained the PhD obtaining award granted by the Basque Government through.
Role of Mitochondrial Inheritance on Prostate Cancer Outcome in African American Men. Addendum
2016-11-01
RK, Tan DJ. Comprehensive scanning of the entire mitochondrial genome for mutations. Clin Chem. 2002; 48:1901-12. 3. Zhang W, Cui H, Wong L-J...Yang J, Price R, Nicolas A, Nalls M, Tranah G, Franceschini N, Xu Z, Schulte C, Alonso A, Cummings S, Fornage M, Zaykin D, Li L, Huang X, Kritchevsky S...L, Liu X, Liu L, Xu P, Han B, Bai C, Zhao Y, Zhang H, Yan Y, Amos CI, Chen F, Tan W, Jin L, Wu T, Lin D, Shen H. Association analyses identify
調理行動に伴い蓄積する油汚れの実態調査 : キッチンプランや調理時の行動が油汚れの蓄積状況に与える影響
萬羽, 郁子; 五十嵐, 由利子; Banba, Ikuko; Igarashi, Yuriko
2008-01-01
The oil mist or kitchen exhaust diffuses into various parts of a house as well as the kitchen itself, the mist is responsible for the formation of oil stains on the surface of respective rooms, i.e., the surface of the ceiling and walls. With an open type kitchen, a range of the oil mist diffusion tends to expand, and the authors believe that the condition of the living-cum-dining room might be deteriorated as a result. Twelve residences in Niigata City were chosen to clarify the extent of th...
Digital behavioral and psychological principles
Hausman, Angela
2014-01-01
The chapters in this e-book lie firmly within Web 2.0 and deal with human aspects of interactions between consumers and between consumers and brands in digital space. The first chapter, Consumer Behavior in the Online Context, by Cummings, Peltier, Schibrowsky and Nill, provides an excellent introduction to this ebook by reviewing literature related to the consumer behavior and social network theory as they apply to the Internet, literature covering the period from 1993-2012, spanning over 900 articles across more than 85 marketing journals. The second chapter, by Kabadayi and Price, investiga
Husserl on Collective Intentionality
DEFF Research Database (Denmark)
Szanto, Thomas
2016-01-01
, respectively. On this background, I will concentrate on Husserl’s alternative construal and demonstrate how it entails a robust anti-individualism regarding both the form and the subject of we-intentions. I will suggest that, contrary to appearances, Husserl does not fall prey to committing a content/vehicle...... type of fallacy, by inferring from the jointness of the contents of collective intentionality that there is one joint vehicle or, worse, some collectively conscious bearer of such. Rather, the Husserlian alternative yields a robust formal-cum-subject anti-individualism and undercuts the need...
Silver nanoparticles induce endoplasmatic reticulum stress response in zebrafish
Energy Technology Data Exchange (ETDEWEB)
Christen, Verena [University of Applied Sciences and Arts Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Capelle, Martinus [Crucell, P.O. Box 2048, NL-2301 Leiden (Netherlands); Fent, Karl, E-mail: karl.fent@fhnw.ch [University of Applied Sciences and Arts Northwestern Switzerland, School of Life Sciences, Gründenstrasse 40, CH-4132 Muttenz (Switzerland); Swiss Federal Institute of Technology Zürich, Department of Environmental Systems Science, CH-8092 Zürich (Switzerland)
2013-10-15
Silver nanoparticles (AgNPs) find increasing applications, and therefore humans and the environment are increasingly exposed to them. However, potential toxicological implications are not sufficiently known. Here we investigate effects of AgNPs (average size 120 nm) on zebrafish in vitro and in vivo, and compare them to human hepatoma cells (Huh7). AgNPs are incorporated in zebrafish liver cells (ZFL) and Huh7, and in zebrafish embryos. In ZFL cells AgNPs lead to induction of reactive oxygen species (ROS), endoplasmatic reticulum (ER) stress response, and TNF-α. Transcriptional alterations also occur in pro-apoptotic genes p53 and Bax. The transcriptional profile differed in ZFL and Huh7 cells. In ZFL cells, the ER stress marker BiP is induced, concomitant with the ER stress marker ATF-6 and spliced XBP-1 after 6 h and 24 h exposure to 0.5 g/L and 0.05 g/L AgNPs, respectively. This indicates the induction of different pathways of the ER stress response. Moreover, AgNPs induce TNF-α. In zebrafish embryos exposed to 0.01, 0.1, 1 and 5 mg/L AgNPs hatching was affected and morphological defects occurred at high concentrations. ER stress related gene transcripts BiP and Synv are significantly up-regulated after 24 h at 0.1 and 5 mg/L AgNPs. Furthermore, transcriptional alterations occurred in the pro-apoptotic genes Noxa and p21. The ER stress response was strong in ZFL cells and occurred in zebrafish embryos as well. Our data demonstrate for the first time that AgNPs lead to induction of ER stress in zebrafish. The induction of ER stress can have several consequences including the activation of apoptotic and inflammatory pathways. - Highlights: • Effects of silver nanoparticles (120 nm AgNPs) are investigated in zebrafish. • AgNPs induce all ER stress reponses in vitro in zebrafish liver cells. • AgNPs induce weak ER stress in zebrafish embryos. • AgNPs induce oxidative stress and transcripts of pro-apoptosis genes.
Silver nanoparticles induce endoplasmatic reticulum stress response in zebrafish
International Nuclear Information System (INIS)
Christen, Verena; Capelle, Martinus; Fent, Karl
2013-01-01
Silver nanoparticles (AgNPs) find increasing applications, and therefore humans and the environment are increasingly exposed to them. However, potential toxicological implications are not sufficiently known. Here we investigate effects of AgNPs (average size 120 nm) on zebrafish in vitro and in vivo, and compare them to human hepatoma cells (Huh7). AgNPs are incorporated in zebrafish liver cells (ZFL) and Huh7, and in zebrafish embryos. In ZFL cells AgNPs lead to induction of reactive oxygen species (ROS), endoplasmatic reticulum (ER) stress response, and TNF-α. Transcriptional alterations also occur in pro-apoptotic genes p53 and Bax. The transcriptional profile differed in ZFL and Huh7 cells. In ZFL cells, the ER stress marker BiP is induced, concomitant with the ER stress marker ATF-6 and spliced XBP-1 after 6 h and 24 h exposure to 0.5 g/L and 0.05 g/L AgNPs, respectively. This indicates the induction of different pathways of the ER stress response. Moreover, AgNPs induce TNF-α. In zebrafish embryos exposed to 0.01, 0.1, 1 and 5 mg/L AgNPs hatching was affected and morphological defects occurred at high concentrations. ER stress related gene transcripts BiP and Synv are significantly up-regulated after 24 h at 0.1 and 5 mg/L AgNPs. Furthermore, transcriptional alterations occurred in the pro-apoptotic genes Noxa and p21. The ER stress response was strong in ZFL cells and occurred in zebrafish embryos as well. Our data demonstrate for the first time that AgNPs lead to induction of ER stress in zebrafish. The induction of ER stress can have several consequences including the activation of apoptotic and inflammatory pathways. - Highlights: • Effects of silver nanoparticles (120 nm AgNPs) are investigated in zebrafish. • AgNPs induce all ER stress reponses in vitro in zebrafish liver cells. • AgNPs induce weak ER stress in zebrafish embryos. • AgNPs induce oxidative stress and transcripts of pro-apoptosis genes
Chemical Detection Based on Adsorption-Induced and Photo-Induced Stresses in MEMS Devices
Energy Technology Data Exchange (ETDEWEB)
Datskos, P.G.
1999-04-05
Recently there has been an increasing demand to perform real-time in-situ chemical detection of hazardous materials, contraband chemicals, and explosive chemicals. Currently, real-time chemical detection requires rather large analytical instrumentation that are expensive and complicated to use. The advent of inexpensive mass produced MEMS (micro-electromechanical systems) devices opened-up new possibilities for chemical detection. For example, microcantilevers were found to respond to chemical stimuli by undergoing changes in their bending and resonance frequency even when a small number of molecules adsorb on their surface. In our present studies, we extended this concept by studying changes in both the adsorption-induced stress and photo-induced stress as target chemicals adsorb on the surface of microcantilevers. For example, microcantilevers that have adsorbed molecules will undergo photo-induced bending that depends on the number of absorbed molecules on the surface. However, microcantilevers that have undergone photo-induced bending will adsorb molecules on their surfaces in a distinctly different way. Depending on the photon wavelength and microcantilever material, the microcantilever can be made to bend by expanding or contracting the irradiated surface. This is important in cases where the photo-induced stresses can be used to counter any adsorption-induced stresses and increase the dynamic range. Coating the surface of the microstructure with a different material can provide chemical specificity for the target chemicals. However, by selecting appropriate photon wavelengths we can change the chemical selectivity due to the introduction of new surface states in the MEMS device. We will present and discuss our results on the use of adsorption-induced and photo-induced bending of microcantilevers for chemical detection.
Implication of snail in metabolic stress-induced necrosis.
Directory of Open Access Journals (Sweden)
Cho Hee Kim
2011-03-01
Full Text Available Necrosis, a type of cell death accompanied by the rupture of the plasma membrane, promotes tumor progression and aggressiveness by releasing the pro-inflammatory and angiogenic cytokine high mobility group box 1. It is commonly found in the core region of solid tumors due to hypoxia and glucose depletion (GD resulting from insufficient vascularization. Thus, metabolic stress-induced necrosis has important clinical implications for tumor development; however, its regulatory mechanisms have been poorly investigated.Here, we show that the transcription factor Snail, a key regulator of epithelial-mesenchymal transition, is induced in a reactive oxygen species (ROS-dependent manner in both two-dimensional culture of cancer cells, including A549, HepG2, and MDA-MB-231, in response to GD and the inner regions of a multicellular tumor spheroid system, an in vitro model of solid tumors and of human tumors. Snail short hairpin (sh RNA inhibited metabolic stress-induced necrosis in two-dimensional cell culture and in multicellular tumor spheroid system. Snail shRNA-mediated necrosis inhibition appeared to be linked to its ability to suppress metabolic stress-induced mitochondrial ROS production, loss of mitochondrial membrane potential, and mitochondrial permeability transition, which are the primary events that trigger necrosis.Taken together, our findings demonstrate that Snail is implicated in metabolic stress-induced necrosis, providing a new function for Snail in tumor progression.
Oxidative stress-induced autophagy: Role in pulmonary toxicity
International Nuclear Information System (INIS)
Malaviya, Rama; Laskin, Jeffrey D.; Laskin, Debra L.
2014-01-01
Autophagy is an evolutionarily conserved catabolic process important in regulating the turnover of essential proteins and in elimination of damaged organelles and protein aggregates. Autophagy is observed in the lung in response to oxidative stress generated as a consequence of exposure to environmental toxicants. Whether autophagy plays role in promoting cell survival or cytotoxicity is unclear. In this article recent findings on oxidative stress-induced autophagy in the lung are reviewed; potential mechanisms initiating autophagy are also discussed. A better understanding of autophagy and its role in pulmonary toxicity may lead to the development of new strategies to treat lung injury associated with oxidative stress. - Highlights: • Exposure to pulmonary toxicants is associated with oxidative stress. • Oxidative stress is known to induce autophagy. • Autophagy is upregulated in the lung following exposure to pulmonary toxicants. • Autophagy may be protective or pathogenic
Oxidative stress-induced autophagy: Role in pulmonary toxicity
Energy Technology Data Exchange (ETDEWEB)
Malaviya, Rama [Department of Pharmacology and Toxicology, Ernest Mario School of Pharmacy, Rutgers University, Piscataway, NJ 08854 (United States); Laskin, Jeffrey D. [Department of Environmental and Occupational Medicine, Robert Wood Johnson Medical School, Rutgers University, Piscataway, NJ 08854 (United States); Laskin, Debra L., E-mail: laskin@eohsi.rutgers.edu [Department of Pharmacology and Toxicology, Ernest Mario School of Pharmacy, Rutgers University, Piscataway, NJ 08854 (United States)
2014-03-01
Autophagy is an evolutionarily conserved catabolic process important in regulating the turnover of essential proteins and in elimination of damaged organelles and protein aggregates. Autophagy is observed in the lung in response to oxidative stress generated as a consequence of exposure to environmental toxicants. Whether autophagy plays role in promoting cell survival or cytotoxicity is unclear. In this article recent findings on oxidative stress-induced autophagy in the lung are reviewed; potential mechanisms initiating autophagy are also discussed. A better understanding of autophagy and its role in pulmonary toxicity may lead to the development of new strategies to treat lung injury associated with oxidative stress. - Highlights: • Exposure to pulmonary toxicants is associated with oxidative stress. • Oxidative stress is known to induce autophagy. • Autophagy is upregulated in the lung following exposure to pulmonary toxicants. • Autophagy may be protective or pathogenic.
Acute stress may induce ovulation in women
Directory of Open Access Journals (Sweden)
Cano Antonio
2010-05-01
Full Text Available Abstract Background This study aims to gather information either supporting or rejecting the hypothesis that acute stress may induce ovulation in women. The formulation of this hypothesis is based on 2 facts: 1 estrogen-primed postmenopausal or ovariectomized women display an adrenal-progesterone-induced ovulatory-like luteinizing hormone (LH surge in response to exogenous adrenocorticotropic hormone (ACTH administration; and 2 women display multiple follicular waves during an interovulatory interval, and likely during pregnancy and lactation. Thus, acute stress may induce ovulation in women displaying appropriate serum levels of estradiol and one or more follicles large enough to respond to a non-midcycle LH surge. Methods A literature search using the PubMed database was performed to identify articles up to January 2010 focusing mainly on women as well as on rats and rhesus monkeys as animal models of interaction between the hypothalamic-pituitary-adrenal (HPA and hypothalamic-pituitary-gonadal (HPG axes. Results Whereas the HPA axis exhibits positive responses in practically all phases of the ovarian cycle, acute-stress-induced release of LH is found under relatively high plasma levels of estradiol. However, there are studies suggesting that several types of acute stress may exert different effects on pituitary LH release and the steroid environment may modulate in a different way (inhibiting or stimulating the pattern of response of the HPG axis elicited by acute stressors. Conclusion Women may be induced to ovulate at any point of the menstrual cycle or even during periods of amenorrhea associated with pregnancy and lactation if exposed to an appropriate acute stressor under a right estradiol environment.
Oxidative stress induces mitochondrial fragmentation in frataxin-deficient cells
Energy Technology Data Exchange (ETDEWEB)
Lefevre, Sophie [Mitochondria, Metals and Oxidative Stress Laboratory, Institut Jacques Monod, CNRS-Universite Paris-Diderot, Sorbonne Paris Cite, 15 rue Helene Brion, 75205 Paris cedex 13 (France); ED515 UPMC, 4 place Jussieu 75005 Paris (France); Sliwa, Dominika [Mitochondria, Metals and Oxidative Stress Laboratory, Institut Jacques Monod, CNRS-Universite Paris-Diderot, Sorbonne Paris Cite, 15 rue Helene Brion, 75205 Paris cedex 13 (France); Rustin, Pierre [Inserm, U676, Physiopathology and Therapy of Mitochondrial Disease Laboratory, 75019 Paris (France); Universite Paris-Diderot, Faculte de Medecine Denis Diderot, IFR02 Paris (France); Camadro, Jean-Michel [Mitochondria, Metals and Oxidative Stress Laboratory, Institut Jacques Monod, CNRS-Universite Paris-Diderot, Sorbonne Paris Cite, 15 rue Helene Brion, 75205 Paris cedex 13 (France); Santos, Renata, E-mail: santos.renata@ijm.univ-paris-diderot.fr [Mitochondria, Metals and Oxidative Stress Laboratory, Institut Jacques Monod, CNRS-Universite Paris-Diderot, Sorbonne Paris Cite, 15 rue Helene Brion, 75205 Paris cedex 13 (France)
2012-02-10
Highlights: Black-Right-Pointing-Pointer Yeast frataxin-deficiency leads to increased proportion of fragmented mitochondria. Black-Right-Pointing-Pointer Oxidative stress induces complete mitochondrial fragmentation in {Delta}yfh1 cells. Black-Right-Pointing-Pointer Oxidative stress increases mitochondrial fragmentation in patient fibroblasts. Black-Right-Pointing-Pointer Inhibition of mitochondrial fission in {Delta}yfh1 induces oxidative stress resistance. -- Abstract: Friedreich ataxia (FA) is the most common recessive neurodegenerative disease. It is caused by deficiency in mitochondrial frataxin, which participates in iron-sulfur cluster assembly. Yeast cells lacking frataxin ({Delta}yfh1 mutant) showed an increased proportion of fragmented mitochondria compared to wild-type. In addition, oxidative stress induced complete fragmentation of mitochondria in {Delta}yfh1 cells. Genetically controlled inhibition of mitochondrial fission in these cells led to increased resistance to oxidative stress. Here we present evidence that in yeast frataxin-deficiency interferes with mitochondrial dynamics, which might therefore be relevant for the pathophysiology of FA.
Environmental stress induces trinucleotide repeat mutagenesis in human cells.
Chatterjee, Nimrat; Lin, Yunfu; Santillan, Beatriz A; Yotnda, Patricia; Wilson, John H
2015-03-24
The dynamic mutability of microsatellite repeats is implicated in the modification of gene function and disease phenotype. Studies of the enhanced instability of long trinucleotide repeats (TNRs)-the cause of multiple human diseases-have revealed a remarkable complexity of mutagenic mechanisms. Here, we show that cold, heat, hypoxic, and oxidative stresses induce mutagenesis of a long CAG repeat tract in human cells. We show that stress-response factors mediate the stress-induced mutagenesis (SIM) of CAG repeats. We show further that SIM of CAG repeats does not involve mismatch repair, nucleotide excision repair, or transcription, processes that are known to promote TNR mutagenesis in other pathways of instability. Instead, we find that these stresses stimulate DNA rereplication, increasing the proportion of cells with >4 C-value (C) DNA content. Knockdown of the replication origin-licensing factor CDT1 eliminates both stress-induced rereplication and CAG repeat mutagenesis. In addition, direct induction of rereplication in the absence of stress also increases the proportion of cells with >4C DNA content and promotes repeat mutagenesis. Thus, environmental stress triggers a unique pathway for TNR mutagenesis that likely is mediated by DNA rereplication. This pathway may impact normal cells as they encounter stresses in their environment or during development or abnormal cells as they evolve metastatic potential.
Pavlovsky, A A; Boehning, D; Li, D; Zhang, Y; Fan, X; Green, T A
2013-08-29
Our prior research has shown that the transcription of endoplasmic reticulum (ER) stress transcription factors activating transcription factor 3 (ATF3) and ATF4 are induced by amphetamine and restraint stress in rat striatum. However, presently the full extent of ER stress responses to psychological stress or cocaine, and which of the three ER stress pathways is activated is unknown. The current study examines transcriptional responses of key ER stress target genes subsequent to psychological stress or cocaine. Rats were subjected to acute or repeated restraint stress or cocaine treatment and mRNA was isolated from dorsal striatum, medial prefrontal cortex and nucleus accumbens brain tissue. ER stress gene mRNA expression was measured using quantitative polymerase chain reaction (PCR) and RNA sequencing. Restraint stress and cocaine-induced transcription of the classic ER stress-induced genes (BIP, CHOP, ATF3 and GADD34) and of two other ER stress components x-box binding protein 1 (XBP1) and ATF6. In addition, rats living in an enriched environment (large group cage with novel toys changed daily) exhibited rapid induction of GADD34 and ATF3 after 30 min of exploring novel toys, suggesting these genes are also involved in normal non-pathological signaling. However, environmental enrichment, a paradigm that produces protective addiction and depression phenotypes in rats, attenuated the rapid induction of ATF3 and GADD34 after restraint stress. These experiments provide a sensitive measure of ER stress and, more importantly, these results offer good evidence of the activation of ER stress mechanisms from psychological stress, cocaine and natural reward. Thus, ER stress genes may be targets for novel therapeutic targets for depression and addiction. Copyright © 2013 IBRO. Published by Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Mayer, Jakob
2010-01-01
It was the aim of this thesis to improve the existing positron annihilation induced Auger spectrometer at the highly intense positron source NEPOMUC (NEutron induced POsitron source MUniCh) in several ways: Firstly, the measurement time for a single spectrum should be reduced from typically 12 h to roughly 1 h or even less. Secondly, the energy resolution, which amounted to ΔE/E∼10%, should be increased by at least one order of magnitude in order to make high resolution positron annihilation induced Auger spectroscopy (PAES)-measurements of Auger transitions possible and thus deliver more information about the nature of the Auger process. In order to achieve these objectives, the PAES spectrometer was equipped with a new electron energy analyzer. For its ideal operation all other components of the Auger analysis chamber had to be adapted. Particularly the sample manipulation and the positron beam guidance had to be renewed. Simulations with SIMION registered ensured the optimal positron lens parameters. After the adjustment of the new analyzer and its components, first measurements illustrated the improved performance of the PAES setup: Firstly, the measurement time for short overview measurements was reduced from 3 h to 420 s. The measurement time for more detailed Auger spectra was shortened from 12 h to 80 min. Secondly, even with the reduced measurement time, the signal to noise ratio was also enhanced by one order of magnitude. Finally, the energy resolution was improved to ΔE/E 2,3 VV-transition with PAES. Thus, within this thesis two objectives were achieved: Firstly, the PAES spectrometer was renewed and improved by at least one order of magnitude with respect to the signal to noise ratio, the measurement time and the energy resolution. Secondly, several measurements have been carried out, demonstrating the high performance of the spectrometer. Amongst them are first dynamic PAES measurements and a high resolution measurement of the CuM 2,3 VV
Histone deacetylase inhibition abolishes stress-induced spatial memory impairment.
Vargas-López, Viviana; Lamprea, Marisol R; Múnera, Alejandro
2016-10-01
Acute stress induced before spatial training impairs memory consolidation. Although non-epigenetic underpinning of such effect has been described, the epigenetic mechanisms involved have not yet been studied. Since spatial training and intense stress have opposite effects on histone acetylation balance, it is conceivable that disruption of such balance may underlie acute stress-induced spatial memory consolidation impairment and that inhibiting histone deacetylases prevents such effect. Trichostatin-A (TSA, a histone deacetylase inhibitor) was used to test its effectiveness in preventing stress' deleterious effect on memory. Male Wistar rats were trained in a spatial task in the Barnes maze; 1-h movement restraint was applied to half of them before training. Immediately after training, stressed and non-stressed animals were randomly assigned to receive either TSA (1mg/kg) or vehicle intraperitoneal injection. Twenty-four hours after training, long-term spatial memory was tested; plasma and brain tissue were collected immediately after the memory test to evaluate corticosterone levels and histone H3 acetylation in several brain areas. Stressed animals receiving vehicle displayed memory impairment, increased plasma corticosterone levels and markedly reduced histone H3 acetylation in prelimbic cortex and hippocampus. Such effects did not occur in stressed animals treated with TSA. The aforementioned results support the hypothesis that acute stress induced-memory impairment is related to histone deacetylation. Copyright © 2016 Elsevier Inc. All rights reserved.
Temporal pore pressure induced stress changes during injection and depletion
Müller, Birgit; Heidbach, Oliver; Schilling, Frank; Fuchs, Karl; Röckel, Thomas
2016-04-01
Induced seismicity is observed during injection of fluids in oil, gas or geothermal wells as a rather immediate response close to the injection wells due to the often high-rate pressurization. It was recognized even earlier in connection with more moderate rate injection of fluid waste on a longer time frame but higher induced event magnitudes. Today, injection-related induced seismicity significantly increased the number of events with M>3 in the Mid U.S. However, induced seismicity is also observed during production of fluids and gas, even years after the onset of production. E.g. in the Groningen gas field production was required to be reduced due to the increase in felt and damaging seismicity after more than 50 years of exploitation of that field. Thus, injection and production induced seismicity can cause severe impact in terms of hazard but also on economic measures. In order to understand the different onset times of induced seismicity we built a generic model to quantify the role of poro-elasticity processes with special emphasis on the factors time, regional crustal stress conditions and fault parameters for three case studies (injection into a low permeable crystalline rock, hydrothermal circulation and production of fluids). With this approach we consider the spatial and temporal variation of reservoir stress paths, the "early" injection-related induced events during stimulation and the "late" production induced ones. Furthermore, in dependence of the undisturbed in situ stress field conditions the stress tensor can change significantly due to injection and long-term production with changes of the tectonic stress regime in which previously not critically stressed faults could turn to be optimally oriented for fault reactivation.
Stress induces pain transition by potentiation of AMPA receptor phosphorylation.
Li, Changsheng; Yang, Ya; Liu, Sufang; Fang, Huaqiang; Zhang, Yong; Furmanski, Orion; Skinner, John; Xing, Ying; Johns, Roger A; Huganir, Richard L; Tao, Feng
2014-10-08
Chronic postsurgical pain is a serious issue in clinical practice. After surgery, patients experience ongoing pain or become sensitive to incident, normally nonpainful stimulation. The intensity and duration of postsurgical pain vary. However, it is unclear how the transition from acute to chronic pain occurs. Here we showed that social defeat stress enhanced plantar incision-induced AMPA receptor GluA1 phosphorylation at the Ser831 site in the spinal cord and greatly prolonged plantar incision-induced pain. Interestingly, targeted mutation of the GluA1 phosphorylation site Ser831 significantly inhibited stress-induced prolongation of incisional pain. In addition, stress hormones enhanced GluA1 phosphorylation and AMPA receptor-mediated electrical activity in the spinal cord. Subthreshold stimulation induced spinal long-term potentiation in GluA1 phosphomimetic mutant mice, but not in wild-type mice. Therefore, spinal AMPA receptor phosphorylation contributes to the mechanisms underlying stress-induced pain transition. Copyright © 2014 the authors 0270-6474/14/3413737-10$15.00/0.