WorldWideScience

Sample records for strength latex modified

  1. Experimental investigation of the effect of latex solid/water ratio on latex modified co-matrix mechanical properties

    Directory of Open Access Journals (Sweden)

    Ahmed M. Diab

    2013-03-01

    Full Text Available Numerous researches were performed on latex modified concretes and associated properties, however; some vital factors were not given attention in previous works. This study focus on new factor which significantly affects the properties of latex modified cement paste, mortar or concrete. This factor is termed as ‘latex solid/water ratio’ which is defined herein as the ratio of weight of solid latex to weight of total water content of cement composite including the water in latex itself. The effect of this factor on some properties of cement paste, mortar and concrete were experimentally evaluated. Properties of cement paste include the produced calcium hydroxide and ettringite content during hydration process, while those of cement mortar take account of absorption and effect of temperature on compressive strength. Furthermore, the effect of this factor on the compressive and flexural strengths, modulus of elasticity, water penetration depth and drying shrinkage of concrete were explored. Based on experimental evidences, and spite of using different cement contents, sources of latex, water–cement ratios and slump values, it can be generally concluded that the latex solid/water ratio is a dominant factor affecting different properties of latex modified mortars and concrete.

  2. Latex-modified fiber-reinforced concrete bridge deck overlay : construction/interim report.

    Science.gov (United States)

    1993-06-01

    Latex-modified concrete (LMC) is Portland cement concrete (PCC) with an admixture of latex. LMC is considered to be nearly impermeable to chlorides and is extensively used to construct bridge deck overlays. Unfortunately, some of these overlays have ...

  3. Studies on physico-chemical and mechanical properties of the irradiated latex modified mortar

    International Nuclear Information System (INIS)

    Yassene, A.A.M.A.

    2009-01-01

    This thesis contains three chapter; chapter(I): Introduction and literature review on:- Introduction to polymer. - Mechanism of polymer-cement co-matrix formation.-Sulphate attack. - Solidification /stabilization of heavy metal in cement mortar. chapter(II): Materials and experimental techniques that include: 1- Preparation of latex polymer films from different polymer latices of styrene butadine rubber latex (SBR), poly (styrene-acrylic ester) latex (SAE) and vinylacetate /versatic -ester copolymer latex (C2A). The effect of γ-irradiation dose on the physico - chemical and mechanical properties of different latex polymer films was studied.2- Preparation of latex polymer-modified cement mortar with different ratios of cement: latex polymer and different curing method.3- Solidification /stabilization (S/S) of electroplating heavy metal precipitate in latex polymer- modified mortar with different cement /electroplating heavy metal sludge ratio. chapter(III) results and discussion

  4. Copolymer natural latex in concrete: Dynamic evaluation through energy dissipation of polymer modified concrete

    Science.gov (United States)

    Andayani, Sih Wuri; Suratman, Rochim; Imran, Iswandi; Mardiyati

    2018-05-01

    Portland cement concrete have been used in construction due to its strength and ecomical value. But it has some limitations, such low flexural strength, low tensile strength, low chemical resistant and etc. Due to its limitations in flexural and tensile strength, Portland cement concrete more susceptible by seismic force. There are some methods for improving its limitations. Polymer addition into concrete mixture could be one of solution for improving the flexural and tensile strength, in aiming to get erthquake resistant properties. Also, the eartquake resistant could be achieved by improving energy dissipation capacity. In this research, the earthquake resistant evalution was approached from dynamic evaluation through energy dissipation capacity, after polymer addition as concrete additives. The polymers were natural latex (Indonesian naural resource) grafted with styrene and methacrylate, forming copolymer - natural latex methacrylate (KOLAM) and copolymer - natural latex styrene (KOLAS). They were added into concrete mixture resulting polymer modified concrete. The composition of polymer are 1%, 5% and 10% weight/weight of cement. The higher capacity of energy dissipation will give more capability in either absorbing or dissipating energy, and it was predicted would give better earthquake resistant.. The use of KOLAM gave better performance than KOLAS in energy dissipation capacity. It gave about 46% for addition of 1% w/w compared to Portland cement concrete. But for addition 5% w/w and 10% w/w, they gave about 7% and 5% higher energy dissipation capacity. The KOLAM addition into concrete mixture would reduce the maximum impact load with maximumabout 35% impact load reducing after 1% w/w addition. The higher concentration of KOLAM in concrete mixture, lower reducing of impact load, they were about 4% and 3% for KOLAM 5% and 10%. For KOLAS addition in any compositions, there were no positive trend either in energy dissipation capacity or impact load properties

  5. Mechanical and Permeability Characteristics of Latex-Modified Pre-Packed Pavement Repair Concrete as a Function of the Rapid-Set Binder Content

    Directory of Open Access Journals (Sweden)

    Jae-Woong Han

    2015-10-01

    Full Text Available We evaluated the strength and durability characteristics of latex-polymer-modified, pre-packed pavement repair concrete (LMPPRC with a rapid-set binder. The rapid-set binder was a mixture of rapid-set cement and silica sand, where the fluidity was controlled using a latex polymer. The resulting mix exhibited a compressive strength of ¥21 MPa and a flexural strength of ¥3.5 MPa after 4 h of curing (i.e., the traffic opening term for emergency repairs of pavement. The ratio of latex polymer to rapid-set binder material was varied through 0.40, 0.33, 0.29, and 0.25. Mechanical characterization revealed that the mechanical performance, permeability, and impact resistance increased as the ratio of latex polymer to rapid-set binder decreased. The mixture exhibited a compressive strength of ¥21 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.29. The mixture exhibited a flexural strength of ¥3.5 MPa after 4 h when the ratio of latex polymer to rapid-set binder material was ¤0.33. The permeability resistance to chloride ions satisfied 2000 C after 7 days of curing for all ratios. The ratio of latex polymer to rapid-set binder material that satisfied all conditions for emergency pavement repair was ¤0.29.

  6. Latex-modified grouts for in-situ stabilization of buried transuranic/mixed waste

    International Nuclear Information System (INIS)

    Allan, M.L.

    1996-06-01

    The Department of Applied Science at Brookhaven national Laboratory was requested to investigate latex-modified grouts for in-situ stabilization of buried TRU/mixed waste for INEL. The waste exists in shallow trenches that were backfilled with soil. The objective was to formulate latex-modified grouts for use with the jet grouting technique to enable in-situ stabilization of buried waste. The stabilized waste was either to be left in place or retrieved for further processing. Grouting prior to retrieval reduces the potential release of contaminants. Rheological properties of latex-modified grouts were investigated and compared with those of conventional neat cement grouts used for jet grouting

  7. Solid state NMR and LVSEM studies on the hardening of latex modified tile mortar systems

    International Nuclear Information System (INIS)

    Rottstegge, J.; Arnold, M.; Herschke, L.; Glasser, G.; Wilhelm, M.; Spiess, H.W.; Hergeth, W.D.

    2005-01-01

    Construction mortars contain a broad variety of both inorganic and organic additives beside the cement powder. Here we present a study of tile mortar systems based on portland cement, quartz, methyl cellulose and different latex additives. As known, the methyl cellulose stabilizes the freshly prepared cement paste, the latex additive enhances final hydrophobicity, flexibility and adhesion. Measurements were performed by solid state nuclear magnetic resonance (NMR) and low voltage scanning electron microscopy (LVSEM) to probe the influence of the latex additives on the hydration, hardening and the final tile mortar properties. While solid state NMR enables monitoring of the bulk composition, scanning electron microscopy affords visualization of particles and textures with respect to their shape and the distribution of the different phases. Within the alkaline cement paste, the poly(vinyl acetate) (VAc)-based latex dispersions stabilized by poly(vinyl alcohol) (PVA) were found to be relatively stable against hydrolysis. The influence of the combined organic additives methyl cellulose, poly(vinyl alcohol) and latexes stabilized by poly(vinyl alcohol) on the final silicate structure of the cement hydration products is small. But even small amounts of additives result in an increased ratio of ettringite to monosulfate within the final hydrated tile mortar as monitored by 27 Al NMR. The latex was found to be adsorbed to the inorganic surfaces, acting as glue to the inorganic components. For similar latex water interfaces built up by poly(vinyl alcohol), a variation in the latex polymer composition results in modified organic textures. In addition to the networks of the inorganic cement and of the latex, there is a weak network build up by thin polymer fibers, most probably originating from poly(vinyl alcohol). Besides the weak network, polymer fibers form well-ordered textures covering inorganic crystals such as portlandite

  8. Bonding Characteristics of Macrosynthetic Fiber in Latex-Modified Fiber-Reinforced Cement Composites as a Function of Carbon Nanotube Content

    Directory of Open Access Journals (Sweden)

    Ji-Hong Jean

    2016-01-01

    Full Text Available The effect of carbon nanotube content (0, 0.5, 1.0, 1.5, and 2.0% of the cement weight on the bonding properties of macrosynthetic fiber in latex-modified hybrid fiber cement-based composites (LMHFRCCs was evaluated. The slump value, compressive strength, and bonding strength were measured for each LMHFRCC. As the carbon nanotube content increased to 1.5%, the bonding properties of the macrosynthetic fiber improved. However, the bonding performance deteriorated at a carbon nanotube content of 2.0%. A decrease in the fluidity of the mix negatively affected the dispersion of the nanotubes in the LMHFRCCs. The addition of carbon nanotubes also affected the relative bonding strength independently of the improvement in compressive strength. Microscopic analysis of the macrosynthetic fiber surfaces was used to understand changes in the bonding behavior.

  9. Novel Polyvinyl Alcohol/Styrene Butadiene Rubber Latex/Carboxymethyl Cellulose Nanocomposites Reinforced with Modified Halloysite Nanotubes

    Directory of Open Access Journals (Sweden)

    Yanjun Tang

    2013-01-01

    Full Text Available Novel polyvinyl alcohol (PVA/styrene butadiene rubber (SBR latex/carboxymethyl cellulose (CMC/halloysite nanotubes (HNTs nanocomposites were successfully prepared through physical blending. The as-obtained PVA/SBR/CMC/HNTs nanocomposites were coated on the surface of old corrugated container (OCC-based paper in an effort to improve the mechanical properties of paper. To improve the dispersion of HNTs and enhance the compatibility between HNTs and polymer matrix, HNTs were modified with titanate coupling agent (TCA. FT-IR, together with TGA, confirmed that TCA was grafted onto the surface of HNTs successfully. XRD demonstrated that the crystal structures of HNTs remained almost unchanged. TEM showed that modified HNTs exhibited good dispersion and possessed nanotubular structures with an outer diameter of around 50 nm and an inner diameter of about 20 nm. SEM gave an indication that modified HNTs were dispersed more uniformly than unmodified HNTs within PVA/SBR/CMC matrix. Rheological measurement exhibited that surface modification process enhanced the compatibility between HNTs and polymer matrix, thus resulting in the decreased viscosity of nanocomposites. In comparison with unmodified HNTs, modified HNTs were found to contribute more to the enhancement in mechanical properties, which might be attributed to the better dispersion and compatibility of modified HNTs evidenced by TEM, SEM, and rheological measurement.

  10. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO2/Ag-exchanged-zeolite-A nanocomposite

    International Nuclear Information System (INIS)

    Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon

    2015-01-01

    Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO 2 /Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO 2 /Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO 2 /Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO 2 /Ag-exchanged-zeolite-A nanocomposite additive with TiO 2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination

  11. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite

    Energy Technology Data Exchange (ETDEWEB)

    Nosrati, Rahimeh, E-mail: ra.nosrati@gmail.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Olad, Ali, E-mail: a.olad@yahoo.com [Polymer Composite Research Laboratory, Department of Applied Chemistry, Faculty of Chemistry, University of Tabriz, Tabriz (Iran, Islamic Republic of); Nofouzi, Katayoon, E-mail: nofouzi@tabrizu.ac.ir [Faculty of Veterinary Medicine, University of Tabriz, Tabriz (Iran, Islamic Republic of)

    2015-08-15

    Graphical abstract: - Highlights: • A novel nanocomposite coating based on polyacrylic was prepared. • Nanostructured TiO{sub 2}/Ag-exchanged-zeolite-A composite material was prepared. • Prepared nanocomposite used as additive for modification of polyacrylic latex. • Modified coatings show self-cleaning and antibacterial properties. • Modified coatings show better stability in water in versus of unmodified polymer. - Abstract: The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV–visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO{sub 2}/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO{sub 2}/Ag-exchanged-zeolite-A nanocomposite additive with TiO{sub 2} to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.

  12. A self-cleaning coating based on commercial grade polyacrylic latex modified by TiO2/Ag-exchanged-zeolite-A nanocomposite

    Science.gov (United States)

    Nosrati, Rahimeh; Olad, Ali; Nofouzi, Katayoon

    2015-08-01

    The commercial grade polyacrylic latex was modified in order to prepare a self-cleaning coating. TiO2/Ag-exchanged-zeolite-A nanocomposite was prepared and used as additive in the matrix of polyacrylic latex to achieve a hydrophilic and photocatalytic coating. FTIR and UV-visible spectroscopy, X-ray diffraction patterns and FESEM were used to characterize the composition and structure of the nanocomposites and coatings. The acrylic coatings, were prepared by using of TiO2/Ag-exchanged-zeolite-A additive, had better UV and visible light absorption, hydrophilic, degradation of organic pollutants, stability in water and antimicrobial properties than pristine commercial grade polyacrylic latex coating. According to the results, the modified polyacrylic based coating containing 0.5 wt% of TiO2/Ag-exchanged-zeolite-A nanocomposite additive with TiO2 to Ag-exchanged-zeolite-A ratio of 1:2 was the best coating considering most of useful properties such as small band gap and low water contact angle. The water contact angle for unmodified polyacrylic latex coating was 68° which was decreased to less than 10° in modified coating after 24 h LED lamp illumination.

  13. Cosmic growth signatures of modified gravitational strength

    Energy Technology Data Exchange (ETDEWEB)

    Denissenya, Mikhail; Linder, Eric V., E-mail: mikhail.denissenya@nu.edu.kz, E-mail: evlinder@lbl.gov [Energetic Cosmos Laboratory, Nazarbayev University, Astana, 010000 Kazakhstan (Kazakhstan)

    2017-06-01

    Cosmic growth of large scale structure probes the entire history of cosmic expansion and gravitational coupling. To get a clear picture of the effects of modification of gravity we consider a deviation in the coupling strength (effective Newton's constant) at different redshifts, with different durations and amplitudes. We derive, analytically and numerically, the impact on the growth rate and growth amplitude. Galaxy redshift surveys can measure a product of these through redshift space distortions and we connect the modified gravity to the observable in a way that may provide a useful parametrization of the ability of future surveys to test gravity. In particular, modifications during the matter dominated era can be treated by a single parameter, the ''area'' of the modification, to an accuracy of ∼0.3% in the observables. We project constraints on both early and late time gravity for the Dark Energy Spectroscopic Instrument and discuss what is needed for tightening tests of gravity to better than 5% uncertainty.

  14. Practical Latex

    CERN Document Server

    Grätzer, George

    2014-01-01

    Accessible at 200+ pages to all who want to learn the practical usages of LaTeX Avoids technical subjects like font usage Friendly and easy to read, with many examples included Extra source materials include sample LaTeX files and suggestions for further reading

  15. Effects of Reinforcing Fiber and Microsilica on the Mechanical and Chloride Ion Penetration Properties of Latex-Modified Fiber-Reinforced Rapid-Set Cement Concrete for Pavement Repair

    Directory of Open Access Journals (Sweden)

    Woong Kim

    2018-01-01

    Full Text Available This study evaluated the influence of reinforcement fiber type and microsilica content on the performance of latex-modified fiber-reinforced roller-compacted rapid-hardening cement concrete (LMFRCRSC for a concrete pavement emergency repair. Experimental variables were the microsilica substitution ratio (1, 2, 3, and 4%, and the reinforcement fiber (jute versus macrosynthetic fiber. In the tests, compressive, flexural, and splitting tensile strength; chloride ion penetration resistance; and abrasion resistance were assessed. From the compressive and flexural strength tests with microsilica substitution, the 4-hour curing strength decreased as the microsilica substitution ratio increased. From the chloride ion penetration test, as the microsilica substitution ratio increased, chloride ion penetration decreased. The abrasion resistances increased with the substitution ratio of microsilica increase. Based on these test results, microsilica at a substitution ratio of 3% or less and macrosynthetic fiber as the reinforcement improved the performance of LMFRCRSC for a concrete pavement emergency repair and satisfied all of the target strength requirements.

  16. Push-out strength of modified Portland cements and resins.

    Science.gov (United States)

    Iacono, Francesco; Gandolfi, Maria Giovanna; Huffman, Bradford; Sword, Jeremy; Agee, Kelli; Siboni, Francesco; Tay, Franklin; Prati, Carlo; Pashley, David

    2010-02-01

    Modified calcium-silicate cements derived from white Portland cement (PC) were formulated to test their push-out strength from radicular dentin after immersion for 1 month. Slabs obtained from 42 single-rooted extracted teeth were prepared with 0.6 mm diameter holes, then enlarged with rotary instruments. After immersion in EDTA and NaOC1, the holes were filled with modified PCs or ProRoot MTA, Vitrebond and Clearfil SE. Different concentrations of phyllosilicate (montmorillonite-MMT) were added to experimental cements. ProRoot MTA was also included as reference material. Vitrebond and Clearfil SE were included as controls. Each group was tested after 1 month of immersion in water or PBS. A thin-slice push-out test on a universal testing machine served to test the push-out strength of materials. Results were statistically analyzed using the least squares means (LSM) method. The modified PCs had push-out strengths of 3-9.5 MPa after 1 month of immersion in water, while ProRoot MTA had 4.8 MPa. The push-out strength of PC fell after incubation in PBS for 1 month, while the push-out strength of ProRoot MTA increased. There were no significant changes in Clearfil SE Bond or Vitrebond after water or PBS storage.

  17. Strength of biodegradable polypropylene tapes filled with a modified starch

    Science.gov (United States)

    Vinidiktova, N. S.; Ermolovich, O. A.; Goldade, V. A.; Pinchuk, L. S.

    2006-05-01

    The possibility of creating composite materials with high deformation and strength characteristics based on polypropylene (PP) and a natural polysaccharide in the form of a modified starch (MS) has been studied. The modified starch is shown to interact chemically with functional groups of PP, thereby positively affecting the physicomechanical properties, structure, and water absorption properties of films and oriented flat fibers based on starch-filled PP. The strength characteristics of both oriented and unoriented composites are 1.5-2.0 times as high as those of the initial PP. The water absorption ability of the materials varies symbatically with content of MS, which points to the dominant contribution of interactions at the PP-MS interface. The introduction of MS into synthetic polymers offers a possibility of producing new ecologically safe materials with high strength characteristics.

  18. Micromechanical analysis of polyacrylamide-modified concrete for improving strengths

    Energy Technology Data Exchange (ETDEWEB)

    Sun Zengzhi [School of Materials Science and Engineering, Chang' an University, Xi' an 710064 (China)], E-mail: zz-sun@126.com; Xu Qinwu [Pavement research, Transtec Group Inc., Austin 78731 (United States)], E-mail: qinwu_xu@yahoo.com

    2008-08-25

    This paper studies how polyacrylamide (PAM) alters the physicochemical and mechanical properties of concrete. The microstructure of PAM-modified concrete and the physicochemical reaction between PAM and concrete were studied through scanning electron microscope (SEM), differential thermal analysis (DTA), thermal gravimetric analysis (TGA), and infrared spectrum analysis. Meanwhile, the workability and strengths of cement paste and concrete were tested. PAM's modification mechanism was also discussed. Results indicate that PAM reacts with the Ca{sup 2+} and Al{sup 3+} cations produced by concrete hydration to form the ionic compounds and reduce the crystallization of Ca(OH){sub 2}, acting as a flexible filler and reinforcement in the porosity of concrete and, therefore, improving concrete's engineering properties. PAM also significantly alters the microstructure at the aggregate-cement interfacial transition zone. Mechanical testing results indicate that the fluidity of cement paste decreases initially, then increases, and decreases again with increasing PAM content. PAM can effectively improve the flexural strength, bonding strength, dynamic impact resistance, and fatigue life of concrete, though it reduces the compressive strength to some extent.

  19. Micromechanical analysis of polyacrylamide-modified concrete for improving strengths

    International Nuclear Information System (INIS)

    Sun Zengzhi; Xu Qinwu

    2008-01-01

    This paper studies how polyacrylamide (PAM) alters the physicochemical and mechanical properties of concrete. The microstructure of PAM-modified concrete and the physicochemical reaction between PAM and concrete were studied through scanning electron microscope (SEM), differential thermal analysis (DTA), thermal gravimetric analysis (TGA), and infrared spectrum analysis. Meanwhile, the workability and strengths of cement paste and concrete were tested. PAM's modification mechanism was also discussed. Results indicate that PAM reacts with the Ca 2+ and Al 3+ cations produced by concrete hydration to form the ionic compounds and reduce the crystallization of Ca(OH) 2 , acting as a flexible filler and reinforcement in the porosity of concrete and, therefore, improving concrete's engineering properties. PAM also significantly alters the microstructure at the aggregate-cement interfacial transition zone. Mechanical testing results indicate that the fluidity of cement paste decreases initially, then increases, and decreases again with increasing PAM content. PAM can effectively improve the flexural strength, bonding strength, dynamic impact resistance, and fatigue life of concrete, though it reduces the compressive strength to some extent

  20. Environmental Factors Affecting the Strength Characteristics of Modified Resin Mortars

    Science.gov (United States)

    Debska, Bernardeta; Licholai, Lech

    2017-12-01

    Resin concretes are composites in which a cement binder has been completely replaced by a synthetic resin. These materials are a good choice for the construction industry, especially in solutions requiring high strength, fast curing and durability. Polymer mortars are mainly used for the manufacture of industrial floors and prefabricated products such as tanks for aggressive chemicals, sewage pipes, or road and bridge drainage systems, as well as for the repair of damaged concrete structures. In all these applications, the strength and high chemical resistance of the applied material solutions are of key importance. It is particularly crucial to obtain information on how resin composites behave when exposed to aggressive agents over extended periods of time. It is also very important to use waste materials in order to obtain resin composites, as these activities are very well inscribed in the idea of environmental protection and meet the criteria of sustainable construction. The mortars described in this article meet the above principles. The article presents how the compressive strength of glycolyzate-modified epoxy mortars, obtained with the use of poly(ethylene terephthalate), changes after they are immersed in 10% sodium chloride solution. Sodium chloride solution was chosen due to the prospective applicability of the tested composites as repair materials used for e.g. bridges or overpasses that are exposed to this salt solution in wintertime. Changes in the properties of the composite samples were monitored over the period of one year. Statistical analysis of the test results was carried out with the use of Statistica programme. The module available in the mentioned program called Nonparametric Statistics - Comparing multiple independent samples made it possible to check the monitoring times during which the compressive strength values differed significantly. The obtained results allowed for determining the equation of the function approximating the course of

  1. Latex improvement of recycled asphalt pavement

    Science.gov (United States)

    Drennon, C.

    1982-08-01

    The performance of a single unmodified milled recycled asphalt concrete was compared to milled asphalt concrete modified by addition of three types of rubber latex. Latex was added at 2, 3, 5, and 8 percent latex by weight of asphalt in the asphalt concrete. Lattices used were a styrene butadiene (SBR), a natural rubber (NR), an acrylonitrile butadiene (NBR), and four varieties of out of specification SBR lattices. Marshall tests, while indecisive, showed a modest improvement in properties of SBR and NR added material at 3 and 5 percent latex. Addition of NBR latex caused deterioration in Marshall stability and flow over that of control. Repeated load tests were run using the indirect tensile test, analyzed by the VESYS program, which computes life of pavements. Repeated load tests showed improvement in asphalt concrete life when 3 and 5 percent SBR was added. Improvement was also shown by the out of specification SBR.

  2. Radiation vulcanization of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, A.M.; Abad, L.V.; Sta.Ana-Relleve, L.P.; Tranquilan-Aranilla, C.O.; Pascual, C.L.

    1996-01-01

    The response of Philippine natural rubber latex to irradiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated latices obtained from various rubber plantations in Mindanao island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI 60 Co irradiation facility at a dose rate of 2.57 kGy/hr. Unirradiated cast latex films gave different green strengths which varied from 2-11 MPa. Cast films from INRL exhibited maximum tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 o -377 o C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose was increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubbe latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 1000 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% , and crosslinking density upon storage. While there were observed changes in the physical properties of the INRL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL films were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry, TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex produced and processed in the Philippines is suited for radiation vulcanization

  3. The increase of compressive strength of natural polymer modified concrete with Moringa oleifera

    Science.gov (United States)

    Susilorini, Rr. M. I. Retno; Santosa, Budi; Rejeki, V. G. Sri; Riangsari, M. F. Devita; Hananta, Yan's. Dianaga

    2017-03-01

    Polymer modified concrete is one of some concrete technology innovations to meet the need of strong and durable concrete. Previous research found that Moringa oleifera can be applied as natural polymer modifiers into mortars. Natural polymer modified mortar using Moringa oleifera is proven to increase their compressive strength significantly. In this resesearch, Moringa oleifera seeds have been grinded and added into concrete mix for natural polymer modified concrete, based on the optimum composition of previous research. The research investigated the increase of compressive strength of polymer modified concrete with Moringa oleifera as natural polymer modifiers. There were 3 compositions of natural polymer modified concrete with Moringa oleifera referred to previous research optimum compositions. Several cylinder of 10 cm x 20 cm specimens were produced and tested for compressive strength at age 7, 14, and, 28 days. The research meets conclusions: (1) Natural polymer modified concrete with Moringa oleifera, with and without skin, has higher compressive strength compared to natural polymer modified mortar with Moringa oleifera and also control specimens; (2) Natural polymer modified concrete with Moringa oleifera without skin is achieved by specimens contains Moringa oleifera that is 0.2% of cement weight; and (3) The compressive strength increase of natural polymer modified concrete with Moringa oleifera without skin is about 168.11-221.29% compared to control specimens

  4. Artificially modified collagen fibril orientation affects leather tear strength.

    Science.gov (United States)

    Kelly, Susyn J; Wells, Hannah C; Sizeland, Katie H; Kirby, Nigel; Edmonds, Richard L; Ryan, Tim; Hawley, Adrian; Mudie, Stephen; Haverkamp, Richard G

    2018-07-01

    Ovine leather has around half the tear strength of bovine leather and is therefore not suitable for high-value applications such as shoes. Tear strength has been correlated with the natural collagen fibril alignment (orientation index, OI). It is hypothesized that it could be possible to artificially increase the OI of the collagen fibrils and that an artificial increase in OI could increase tear strength. Ovine skins, after pickling and bating, were strained biaxially during chrome tanning. The strain ranged from 2 to 15% of the initial sample length, either uniformly in both directions by 10% or with 3% in one direction and 15% in the other. Once tanned, the leather tear strengths were measured and the collagen fibril orientation was measured using synchrotron-based small-angle X-ray scattering. The OI increased as a result of strain during tanning from 0.48 to 0.79 (P = 0.001) measured edge-on and the thickness-normalized tear strength increased from 27 to 43 N mm -1 (P leather was strained 10% in two orthogonal directions. This is evidence to support a causal relationship between high OI (measured edge-on), highly influenced by thickness, and tear strength. It also provides a method to produce stronger leather. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  5. Latex in the Hospital Environment

    Science.gov (United States)

    LATEX in the Hospital Environment Updated Fall 2015 This list provides a guide to some of the most common objects containing latex and offers some ... remover–Sepha Pharm) 1 LATEX in the Hospital Environment (continued) Frequently contains LATEX OR/Infection Control masks, ...

  6. Exploiting epoxidized natural rubber latex (ENRL) as a starting raw material for latex-based products

    Science.gov (United States)

    Siti Nor Qamarina, M.; Fatimah Rubaizah, M. R.; Nurul Suhaira, A.; Norhanifah, M. Y.

    2017-12-01

    Epoxidized natural rubber latex (ENRL) is a chemically modified natural rubber latex produced from epoxidation process that involves usage of organic peracids. Conversion of the ENRL into dry rubber products has been known to exhibit many beneficial properties, however limited published works were found on diversifiying the ENRL latex-based products applications. In this preliminary work, different source of raw materials and neutralization systems were investigated. The objective was to explore possibilities in producing distinctive ENRL. Findings have demonstrated that different source of raw materials and neutralization systems influenced the typical ENRL specifications, stability behavior and particle size distribution. Morphological observations performed on these ENRL systems appeared to agree with the ENRL characteristics achieved. Since experimenting these two main factors resulted in encouraging ENRL findings, detailed work shall be further scrutinized to search for an optimum condition in producing marketable ENRL specifically for latex-based products applications.

  7. Aspects of Degradability and Aging of Natural Rubber Latex Films Obtained by Induced Ionizing Radiation Processes of Latex Vulcanization

    International Nuclear Information System (INIS)

    Parra, D. F.

    2006-01-01

    This study refers to the degradability of NRLF, natural rubber latex films, obtained by ionizing radiation. Three types of NRLF were prepared: irradiated latex, irradiated latex with about 1% of soy lecithin and sulfur-vulcanized latex, by cold vulcanization process. The films were buried in vases of two different kinds of soil: common soil and common soil with earthworm humus. Fast aging tests in laboratory with exposition to ultraviolet rays were done in irradiated latex films and irradiated latex films with soy lecithin. The results obtained after ten months of tests with buried films agree with the results of the fast aging tests, showing singularities of each type of soil and each kind of latex process. It also shows how weather inclemency can induce the films degradation process. The sulfur-vulcanized films were weakly degraded when buried. The films with lecithin and buried in vase with only common soil showed the biggest mass loss, but the films with lecithin buried in vases with common earthworm humus and soil increased their weigh and dimensions due to fungi formation. The irradiated latex films are more degradable then the sulfur-vulcanized films. The irradiated latex film, unlike the sulfur vulcanized film, showed high fungi colonization when buried. We conclude that the irradiated latex films are more easily biodegradable than the sulfur vulcanized latex films. The biodegradability increases with the addition of small amounts of soy lecithin (∼1%). The mechanical resistance of the buried films decreased related to the non-buried ones, proving that the outdoor aging in soil and the presence of fungi in the films can modify the mechanical properties of the irradiated latex owing to the biodegradation

  8. Using the reactive strength index modified to evaluate plyometric performance.

    Science.gov (United States)

    Ebben, William P; Petushek, Erich J

    2010-08-01

    The ability to develop force quickly is a requisite ability in most sports. The reactive strength index (RSI) has been developed as a measure of explosive strength and is derived by evaluating jump height divided by ground contact time during the depth jump (DJ). At present, the RSI is typically used to evaluate DJ performance, because it is the only plyometric exercise with an identifiable ground contact time. The purpose of this study was to introduce a modification of the RSI (RSImod) that can be used to evaluate the explosive power of any vertical plyometric exercise. This study will also assess the reliability of the RSImod, evaluate the RSImod of a variety of plyometric exercises, and examine gender differences. Twenty-six men and 23 women served as subjects. Subjects performed 3 repetitions for each of 5 plyometric exercises including the countermovement jump (CMJ), tuck jump, single-leg jump, squat jump, and dumbbell CMJ. Data were analyzed using a 2-way analysis of variance to evaluate differences in RSImod between the plyometric exercise and the interaction between plyometric exercise RSImod and gender. The analysis of RSImod revealed significant main effects for plyometric exercise type (p plyometric exercise type and gender (p > 0.05). Results of pairwise comparisons indicate that the RSImod is statistically different between all plyometric exercises studied. Intraclass correlation coefficients indicate that RSImod is highly reliable for all of the exercises studied. The RSImod offers a highly reliable method of assessing the explosiveness developed during a variety of plyometric exercises.

  9. Tensile Strength of the Al-9%Si Alloy Modified with Na, F and Cl Compounds

    Directory of Open Access Journals (Sweden)

    T. Lipiński

    2010-01-01

    Full Text Available The modification of the Al-9%Si alloy with the use of a complex modifier containing Na, F and Cl was investigated in the study. The modifier was composed of NaCl, Na3AlF6 and NaF compounds. The modifier and the liquid Al-Si alloy were kept in the crucible for 15 minutes. The modifier's effect relative to the weight of the processed alloy on its tensile strength was presented in graphic form. The results of the study indicate that the complex modifier altered the investigated properties of the eutectic Al-9%Si alloy.

  10. Radiation vulcanization of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, Alumanda M.; Abad, Lucille V.; Sta, Lorna P.; Ana-Relleve; Tranquilan-Aranilla, Charito O.; Pascual, Cristina L.

    1996-01-01

    The response of Philippine natural rubber latex to radiation vulcanization and the stability of the irradiated natural rubber latex (INRL) upon storage and aging were investigated. Commercially available high ammonia (HA) concentrated lattices obtained from various rubber plantations in Mindanao Island were treated with 5 phr of n-butyl acrylate (nBA), and gamma-irradiated at the PNRI sup 60 Co irradiation facility at dose rate of 2.57 KGy/hr. Unirradiated cast latex films gave different green strength which varied from 2 - 11 MPa. Cast films from INRL exhibited maximum tensile strengths of 25 - 32 MPa at a radiation dose of 15 kGy. Higher tensile strengths were obtained from cast films with low Mg and high nitrogen contents. Thermal analysis using thermogravimetry (TG) revealed one major decomposition product at 374 degree C - 377 degree C. Its rate of decomposition decreased to a minimum at 15 kGy, then increased as radiation dose increased. This trend correlated well with the tensile strength measurements. The stability of the INRL upon storage and aging is an essential parameter to the rubber latex industry. For storage studies, INRL was stored for various periods of time. It was found that the pH and total solids content of the stored INRL did not change significantly after 12 months of storage; the MST values remained at above 100 seconds, and the viscosity decreased with time. The cast films exhibited a decline in tensile strength, modulus 300% and crosslinking density upon storage. While there were observed changes in the physical properties of the IRNL during the storage period, the data indicate that these properties were within values acceptable to the latex industry. Tests on the aging properties of INRL film were undertaken. It was shown that among the chemical antioxidants presently used by the latex industry. TNPP demonstrated the highest antioxidant property, followed by Antage DAHQ and Vulcanox BKF. Our data indicate that the natural rubber latex

  11. Radiation response of Philippine natural rubber latex

    International Nuclear Information System (INIS)

    Dela Rosa, A.M.; Abad, L.V.; Ana-Relleve, L.S.; Tranquilan-Aranilla, C.; Pascual, C.L.

    1998-01-01

    Our earlier work has shown that the natural rubber latex (NRL) produced and processed in the Philippines is suited for radiation vulcanization. The cast films from NRL with 50% TSC exhibited maximum tensile strengths of 25-32 MPa at 15 kGy, which is the vulcanization dose or Dv. In the manufacture of dipped NRL products, certain specifications such as %TSC, protein content and tensile properties, must be met to ensure an acceptable product. For radiation vulcanization of natural rubber latex (RVNRL) to be accepted as an alternative process, it must also meet the requirements. Thus, this paper presents additional data on the radiation response of local NRL at different total solids contents (TSC), leachable proteins from NRL films as a function of dose, and the thermal activities of irradiated natural rubber latex (INRL). Different formulations of NRL showed varying tolerances to nBA. Data showed that as %TSC increases, the maximum concentration of nBA that can be added without affecting the stability of the latex decreases. The Dv increases as the %TSC increases and the nBA content decreases. This difference in response may be attributed to a lower concentration of nBA in formulations with higher %TSC. These data indicate that the parameters in the radiation treatment will be dictated by the intended applications of INRL. The thermogravimetric data showed greater stability of INRL to thermal oxidation relative to the unirradiated NRL, which correlates directly with the tensile properties of the INRL. A radiation dose of 10 kGy increased the amount of proteins leached from cast latex films. The amount of extractable proteins did not increase significantly at higher doses. The SDS PAGE analysis of the extractable proteins from unirradiated latex film showed distinct bands. An additional band at 60 Kda appeared at 10 kGy. All these bands became diffuse at higher doses, indicating the radiolysis of the proteins

  12. Latex and friends

    CERN Document Server

    Dongen, M R C van

    2012-01-01

    LaTeX is a free, automated state-of-the-art typesetting system. This book teaches all the ins and outs of LaTeX which are needed to write an article, report, thesis, or book. The book teaches by example, giving many worked out examples showing input and output side by side. The book presents the most recent techniques for presenting data plots, complex graphics, and computer presentations, but does not require previous knowledge. However, it is also a reference for the more seasoned user, with pointers to modern techniques and packages. Recurring themes in the book are consistent and effective

  13. More math into Latex

    CERN Document Server

    Grätzer, George

    2007-01-01

    For close to two decades, Math into Latex has been the standard introduction and complete reference for writing articles and books containing mathematical formulas. In this fourth edition, the reader is provided with important updates on articles and books. An important new topic is discussed: transparencies (computer projections). Key features of More Math into Latex, 4th edition: Installation instructions for PC and Mac users; An example-based, visual approach and a gentle introduction with the Short Course; A detailed exposition of multiline math formulas with a Visual Guide; A unified appr

  14. Effects of hydrodynamic mixing intensity coupled with ionic strength on the initial stage dynamics of bridging flocculation of polystyrene latex particles with polyelectrolyte

    NARCIS (Netherlands)

    Adachi, Y.; Matsumoto, T.; Cohen Stuart, M.A.

    2002-01-01

    Effects of hydrodynamic mixing intensity on the initial stage dynamics of bridging flocculation induced by adsorbing polyelectrolyte were analyzed as an extension of previous report on the effect of ionic strength (J. Coll. Int. Sci. 204 (1998) 328). Mixing condition were changed by adopting forked

  15. Latex allergy in health care

    Directory of Open Access Journals (Sweden)

    Tina Virtič

    2012-11-01

    Full Text Available The increasing use of natural rubber latex medical gloves in the last three decades has caused an increase in latex allergy. The majority of risk groups for allergy development include health care workers, workers in the rubber industry, atopic individuals and children with congenital malformations. Three types of pathological reactions can occur in people using latex medical gloves: irritant contact dermatitis, allergic contact dermatitis and immediate hypersensitivity. The latex allergy is caused by constituent components of latex gloves and added powders; there are also numerous latex allergens involved in cross-reactivity between latex and fruits and vegetables, the so-called latex-fruit syndrome. The diagnosis is based on an accurate history of exposure, clinical presentation and confirmatory in vivo and in vitro tests. Prevention is the easiest, most effective and least expensive way to avoid latex allergy. Powder-free latex gloves with reduced levels of proteins and chemicals, and synthetic gloves for allergic workers must be provided in the work environment. There are already many health care institutions around the world where all latex products have been replaced by synthetic material products.

  16. Radiation vulcanization of natural rubber latex using irradiation n-butyl acrylate aqueous emulsion as sensitizer

    International Nuclear Information System (INIS)

    Vo Van Thien; Nguyen Quoc Hien; Keizo Makuuchi; Fumio Yoshii

    2000-01-01

    Natural rubber latex was vulcanized by gamma radiation with n-butyl acrylate aqueous emulsion irradiated at dose of 1.5 kGy as sensitizer. The total solid content of latex increases on the irradiation dose. The viscosity of latex on the standing time was investigated and became stable after one month of storage. The gel content of latex films increasing with irradiation dose and attained more than 94% at dose of 10 kGy. Tensile strength of films reached the values of 31MPa; 30 Mpa and 25 Mpa at vulcanization doses of 20 kGy, 15 kGy and 8 kGy for the concentrations of sensitizer 7 phr, 9 phr and 13 phr respectively. Elongation at break decreases as increasing dose. Tear strength of rubber films was from 30-40 N/mm. The tackiness of latex films decreases and smell of vulcanized latex is almost negligible. (author)

  17. Influence of surface modified basalt fiber on strength of cinder lightweight aggregate concrete

    Science.gov (United States)

    Xiao, Liguang; Li, Jiheng; Liu, Qingshun

    2017-12-01

    In order to improve the bonding and bridging effect between volcanic slag lightweight aggregate concrete cement and basalt fiber, The basalt fiber was subjected to etching and roughening treatment by NaOH solution, and the surface of the basalt fiber was treated with a mixture of sodium silicate and micro-silica powder. The influence of modified basalt fiber on the strength of volcanic slag lightweight aggregate concrete was systematically studied. The experimental results show that the modified basalt fiber volcanic slag lightweight aggregate concrete has a flexural strength increased by 47%, the compressive strength is improved by 16% and the toughness is increased by 27% compared with that of the non-fiber.

  18. Bond strength of orthodontic light-cured resin-modified glass ionomer cement.

    Science.gov (United States)

    Cheng, Hsiang Yu; Chen, Chien Hsiu; Li, Chuan Li; Tsai, Hung Huey; Chou, Ta Hsiung; Wang, Wei Nan

    2011-04-01

    The purpose of this study was to compare the bond strengths and debonded interfaces achieved with light-cured resin-modified glass ionomer cement (RMGIC) and conventional light-cured composite resin. In addition, the effects of acid etching and water contamination were examined. One hundred human premolars were randomly divided into five equal groups. The mini Dyna-lock upper premolar bracket was selected for testing. The first four groups were treated with light-cured RMGIC with or without 15 per cent phosphoric acid-etching treatment and with or without water contamination preceding bracket bonding. The control samples were treated with the conventional light-cured Transbond composite resin under acid etching and without water contamination. Subsequently, the brackets were debonded by tensile force using an Instron machine. The modified adhesive remnant index (ARI) scores were assigned to the bracket base of the debonded interfaces using a scanning electron microscope. The bond strength and modified ARI scores were determined and analysed statistically by one-way analysis of variance and chi-square test. Under all four conditions, the bond strength of the light-cure RMGIC was equal to or higher than that of the conventional composite resin. The highest bond strength was achieved when using RMGIC with acid etching but without water contamination. The modified ARI scores were 2 for Fuji Ortho LC and 3 for Transbond. No enamel detachment was found in any group. Fifteen per cent phosphoric acid etching without moistening the enamel of Fuji Ortho LC provided the more favourable bond strength. Enamel surfaces, with or without water contamination and with or without acid etching, had the same or a greater bond strength than Transbond.

  19. Effects of a Modified German Volume Training Program on Muscular Hypertrophy and Strength.

    Science.gov (United States)

    Amirthalingam, Theban; Mavros, Yorgi; Wilson, Guy C; Clarke, Jillian L; Mitchell, Lachlan; Hackett, Daniel A

    2017-11-01

    Amirthalingam, T, Mavros, Y, Wilson, GC, Clarke, JL, Mitchell, L, and Hackett, DA. Effects of a modified German volume training program on muscular hypertrophy and strength. J Strength Cond Res 31(11): 3109-3119, 2017-German Volume Training (GVT), or the 10 sets method, has been used for decades by weightlifters to increase muscle mass. To date, no study has directly examined the training adaptations after GVT. The purpose of this study was to investigate the effect of a modified GVT intervention on muscular hypertrophy and strength. Nineteen healthy men were randomly assign to 6 weeks of 10 or 5 sets of 10 repetitions for specific compound resistance exercises included in a split routine performed 3 times per week. Total and regional lean body mass, muscle thickness, and muscle strength were measured before and after the training program. Across groups, there were significant increases in lean body mass measures, however, greater increases in trunk (p = 0.043; effect size [ES] = -0.21) and arm (p = 0.083; ES = -0.25) lean body mass favored the 5-SET group. No significant increases were found for leg lean body mass or measures of muscle thickness across groups. Significant increases were found across groups for muscular strength, with greater increases in the 5-SET group for bench press (p = 0.014; ES = -0.43) and lat pull-down (p = 0.003; ES = -0.54). It seems that the modified GVT program is no more effective than performing 5 sets per exercise for increasing muscle hypertrophy and strength. To maximize hypertrophic training effects, it is recommended that 4-6 sets per exercise be performed, as it seems gains will plateau beyond this set range and may even regress due to overtraining.

  20. Tensile strength of structural concrete repaired with hi-bond polymer modified mortar

    International Nuclear Information System (INIS)

    Khaskheli, G.B.

    2009-01-01

    Repair of cracks in concrete is often required to save the concrete structures. Appearance of crack in concrete is bound with the tensile strength of concrete. Recently a cement factory in Sindh has launched a HBPMM (Hi-Bond Polymer Modified Mortar) that can be used as a concrete repairing material instead of normal OPC (Ordinary Portland Cement). It is needed to investigate its performance compared to that of OPC. In total 144 concrete cylinders (150x300mm) having strength of 3000 and 5000 psi were manufactured. These cylinders were then splitted by using a UTM (Universal Testing Machine) and their actual tensile strength was obtained. The concrete cylinders were then repaired with different applications of HBPMM and arc. The repaired samples were again splitted at different curing ages (3, 7 and 28 days) and their tensile strength after repair was obtained. The results show that the concrete cylinders repaired with HBPMM could give better tensile strength than that repaired with arc, the tensile strength of concrete cylinders after repair could increase with increase in the application of repairing material i.e. HBPMM or OPC and with curing time, and HBPMM could remain more effective in case of rich mix concrete than that of normal mix concrete. (author)

  1. Experimental data on compressive strength and durability of sulfur concrete modified by styrene and bitumen.

    Science.gov (United States)

    Dehestani, M; Teimortashlu, E; Molaei, M; Ghomian, M; Firoozi, S; Aghili, S

    2017-08-01

    In this data article experimental data on the compressive strength, and the durability of styrene and bitumen modified sulfur concrete against acidic water and ignition are presented. The percent of the sulfur cement and the gradation of the aggregates used are according to the ACI 548.2R-93 and ASTM 3515 respectively. For the styrene modified sulfur concrete different percentages of styrene are used. Also for the bitumen modified sulfur concrete, different percentages of bitumen and the emulsifying agent (triton X-100) are utilized. From each batch three 10×10×10 cm cubic samples were casted. One of the samples was used for the compressive strength on the second day of casting, and one on the twenty-eighth day. Then the two samples were put under the high pressure flame of the burning liquid gas for thirty seconds and their ignition resistances were observed. The third sample was put into the acidic water and after twenty eight days immersion in water was dried in the ambient temperature. After drying its compressive strength has been evaluated.

  2. The effects of shelf life on the compressive strength of resin-modified glass ionomer cement

    Science.gov (United States)

    Wajong, K. H.; Damiyanti, M.; Irawan, B.

    2017-08-01

    Resin-modified glass ionomer cement (RMGIC) is a restoration material composed of powder and liquid whose stability is affected by its shelf life. This is an issue that has not been taken into consideration by customers or sellers. To observe the effects of shelf life on the compressive strength of RMGIC, 30 cylindrical (d = 4mm and t = 6mm) specimens of RMGIC (Fuji II LC, GC, Tokyo, Japan) were divided into three groups with different storage times and their compressive strength was tested with a universal testing machine. Results were statistically analyzed with the one-way ANOVA test. There were significant differences (p<0.05) between the three groups of RMGIC. There is a decrease in the compressive strength value along with the duration of storage time.

  3. Influence of association of "EVA-NBR" on indirect tensile strength of modified bituminous concrete

    Science.gov (United States)

    Chinoun, M.; Soudani, K.; Haddadi, S.

    2016-04-01

    The aim of this work is to contribute to the improvement of the mechanical properties of bituminous concrete by modification of bituminous concrete. In this study, we present the results of the indirect tensile strength "ITS" of modified bituminous concrete by the combination of two modifiers, one is a plastomer EVA (Ethylene Vinyl Acetate) and the other is a industrial waste from the shoe soles grinding NBR (Nitrile Butadiene Rubber) as crumb rubber. To modify the bitumen a wet process was used. The results show that the modification of bitumen by EVA-NBR combination increases their resistance to the indirect traction "ITS" compared to the bituminous concrete control. The mixture of 5% [50% EVA+ 50% NBR] is given the best result among the other associations.

  4. Latex medical gloves

    DEFF Research Database (Denmark)

    Palosuo, Timo; Antoniadou, Irini; Gottrup, Finn

    2011-01-01

    Many hospitals have implemented policies to restrict or ban the use of devices made of natural rubber latex (NRL) in healthcare as precautionary measures against the perceived risk of NRL allergy. Changes in glove technology, progress in measuring the specific allergenic potential of gloves...... properties of NRL and synthetic gloves and the role of glove powder. The review shows that NRL medical gloves, when compared with synthetic gloves, tend to be stronger, more flexible and better accepted by clinicians. The introduction of powder-free gloves has been associated with reductions in protein...

  5. PDMS-modified poly(styrene-alt-maleic anhydride)s as water-borne coatings based on surfactant-free latexes

    NARCIS (Netherlands)

    Gunbas, I.D.; Wouters, M.E.L.; Benthem, R.A.T.M. van; Koning, C.E.; Noordover, B.A.J.

    2013-01-01

    In this work, two series of PDMS-modified poly(styrene-alt-maleic anhydride)s (PSMA) were prepared by the partial imidization of their anhydride groups with mono-functional, amine-terminated polydimethyl siloxanes (PDMS-NH2) with two different molecular weights. Subsequently, surfactant-free

  6. Latex allergy in the workplace.

    Science.gov (United States)

    Toraason, M; Sussman, G; Biagini, R; Meade, J; Beezhold, D; Germolec, D

    2000-11-01

    While less than 1% of the general population is sensitized to latex, the U.S. Occupational Safety and Health Administration estimates that 8-12% of health-care workers are sensitized. The major source of workplace exposure is powdered natural rubber latex (NRL) gloves. NRL is harvested from HEVEA: brasiliensis trees and ammoniated to prevent coagulation resulting in the hydrolysis of the latex proteins. Prior to use in manufacturing, the latex is formulated by the addition of multiple chemicals. Thus, human exposure is to a mixture of residual chemicals and hydrolyzed latex peptides. Clinical manifestations include irritant contact dermatitis, allergic contact dermatitis (type IV), and type I immediate hypersensitivity response. Type I (IgE-mediated) NRL allergy includes contact urticaria, systemic urticaria, angioedema, rhinitis, conjunctivitis, bronchospasm, and anaphylaxis. Taking an accurate history, including questions on atopic status, food allergy, and possible reactions to latex devices makes diagnosis of type-I latex allergy possible. To confirm a diagnosis, either in vivo skin prick testing (SPT) or in vitro assays for latex-specific IgE are performed. While the SPT is regarded as a primary confirmatory test for IgE-mediated disease, the absence of a U.S. Food and Drug Administration-licensed HEVEA: brasiliensis latex extract has restricted its use in diagnosis. Serological tests have, therefore, become critically important as alternative diagnostic tests. Three manufacturers currently have FDA clearance for in vitro tests, to detect NRL-specific IgE. The commercially available assays may disagree on the antibody status of an individual serum, which may be due to the assay's detecting anti-NRL IgEs to different allergenic NRL proteins. Sensitized individuals produce specific IgE antibody to at least 10 potent HEVEA: allergens, Hev b 1-Hev b 10, each of which differs in its structure, size, and net charge. The relative content and ratios of Hevs in the

  7. Modified forelimb grip strength test detects aging-associated physiological decline in skeletal muscle function in male mice.

    Science.gov (United States)

    Takeshita, Hikari; Yamamoto, Koichi; Nozato, Satoko; Inagaki, Tadakatsu; Tsuchimochi, Hirotsugu; Shirai, Mikiyasu; Yamamoto, Ryohei; Imaizumi, Yuki; Hongyo, Kazuhiro; Yokoyama, Serina; Takeda, Masao; Oguro, Ryosuke; Takami, Yoichi; Itoh, Norihisa; Takeya, Yasushi; Sugimoto, Ken; Fukada, So-Ichiro; Rakugi, Hiromi

    2017-02-08

    The conventional forelimb grip strength test is a widely used method to assess skeletal muscle function in rodents; in this study, we modified this method to improve its variability and consistency. The modified test had lower variability among trials and days than the conventional test in young C57BL6 mice, especially by improving the variabilities in male. The modified test was more sensitive than the conventional test to detect a difference in motor function between female and male mice, or between young and old male mice. When the modified test was performed on male mice during the aging process, reduction of grip strength manifested between 18 and 24 months of age at the group level and at the individual level. The modified test was similar to the conventional test in detecting skeletal muscle dysfunction in young male dystrophic mice. Thus, the modified forelimb grip strength test, with its improved validity and reliability may be an ideal substitute for the conventional method.

  8. The Strength Behaviour of Lime Stabilized Organic Clay Soil Modified by Catalyst Additeives

    Directory of Open Access Journals (Sweden)

    Khitam Abdulhussein Saeed

    2016-12-01

    Full Text Available The organic clay soil can be found in many large size reclaimed lands. These soils present enormously high settlement potential and low strength that needs to be improved by means of effective ground improvement techniques. One of the low cost techniques is to modify the soil with lime in-situ to make it suitable for construction and allow it to increase in strength by pozzolanic reactions between lime and clay minerals. Lime is known to be an effective stabilization material for clayey soil. Nevertheless, its effectiveness may be less with organic clay due to low effective strength properties. Thus, this study concerns the addition of catalyst i.e. zeolite which may improve the performance of lime stabilization to accelerate lime-organic clay reactions. The unconfined compressive test (UCT is conducted on remoulded samples (38mm x 80mm for 0, 7, 14 , 28, and 90 days of curing period. The addition of synthetic zeolite in lime-organic stabilized soil has increased the soil strength by 185% at 90 days curing period at the design mix of organic clay + 10% lime +10% zeolite. The higher value of UCS indicates that zeolite is an effective catalyst to enhance lime stabilization.

  9. Radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Wan Manshol bin Wan Zin; Norjanah binti Mohid

    1994-01-01

    This paper describes the experimental techniques and the results of radiation vulcanization of natural rubber latex carried out on several high ammonia latices available in the country. The efficiency of various sensitisers and stabilisers used were evaluated in terms of the gamma radiation dose required to produce the maximum tensile strengths. The extent of crosslinking of RVNRL sample films were estimated by equilibrium swelling ratio measurements. The stability of pre-irradiated and post-irradiated samples were monitored using viscosity measurements as the parameter

  10. Latex allergy and filaggrin null mutations

    DEFF Research Database (Denmark)

    Carlsen, Berit C; Meldgaard, Michael; Hamann, Dathan

    2011-01-01

    to aeroallergens and it is possible that filaggrin null mutations also increase the risk of latex allergy. The aim of this paper was to examine the association between filaggrin null mutations and type I latex allergy. Methods Twenty latex allergic and 24 non-latex allergic dentists and dental assistants...... in the cases in this study may not have occurred through direct skin contact but through the respiratory organs via latex proteins that are absorbed in glove powder and aerosolized...

  11. Effect of heterogeneous distribution of crosslink density on physical properties of radiation vulcanized NR (Natural Rubber) latex film

    International Nuclear Information System (INIS)

    Keizo Makuuchi; Fumio Yoshii; Miura, H.; Murakami, K.

    1996-01-01

    Thus a study has been carried out to investigate the effect of particle to particle variation in crosslink density on physical properties of radiation vulcanized NR latex film. NR latex was irradiated in small bottle by γ rays without vulcanization accelerator to provide latex rubber particles having homogeneous distribution of crosslink density. The doses were 30, 50, 100, 250, 300, 400, 500 and 600 kGy. Weight swelling ratio, gel fraction, tensile strength and elongation at break of the latex film from the mixed latex were measured. The vulcanization dose of this latex was 250 kGy. Then the two different latexes were mixed in a such way to adjust the average dose of 250 kGy to prepare a latex consisting of rubber particles having heterogeneous distribution of crosslink density. Tensile strength of the latex film was depressed by mixing. The reduction increased with increasing the decrease of gel fraction by mixing. However the reduction was not serious when the dose difference of two latexes was less than 200 kGy

  12. Reduction factors for creep strength and fatigue life of modified 9 Cr-1 Mo steel weldments

    International Nuclear Information System (INIS)

    Blass, J.J.; Battiste, R.L.; O'Connor, D.G.

    1991-01-01

    The provisions of ASME B ampersand PV Code Case N-47 currently include reduction factors for creep strength and fatigue life of weldments. To provide experimental confirmation of such factors for modified 9 Cr-1 Mo steel, tests of tubular specimens were conducted at 538 degree C (1000 degree F). Three creep-rupture specimens with longitudinal welds were tested in tension; and, of three with circumferential welds, two were tested in tension and one in torsion. In each specimen with a circumferential weld, a nonuniform axial distribution of strain was easily visible. The test results were compared to an existing empirical model of creep-rupture life. For the torsion test, the comparison was based on a definition of equivalent normal stress recently adopted in Code Case N-47. Some 27 fatigue specimens, with longitudinal, circumferential, or no welds, were tested under axial or torsional strain control. In specimens with welds, fatigue cracking initiated at fusion lines. In axial tests cracks grew in the circumferential direction, and in torsional tests cracks grew along fusion lines. The test results were compared to empirical models of fatigue life based on two definition of equivalent normal strain range. The results have provided some needed confirmation of the reduction factors for creep strength and fatigue life of modified 9 Cr-1 Mo steel weldments currently under consideration by ASME Code committees. 8 refs., 5 figs

  13. Test trial radiation vulcanization of natural rubber latex in Jakarta Indonesia

    International Nuclear Information System (INIS)

    Devendra, R.; Kulatunge, S.S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.

    1994-01-01

    Radiation vulcanization of natural rubber latex (RVNRL) can be used to make large quantities of specially stabilized latex. It is possible to obtain RVNRL films of tensile strength over 25 MPa. The films could be either coagulant dipped or cast. It is very important to determine the correct radiation dose which gives the maximum tensile strength. Cross linking density or prevulcanized relax modulus (PRM) at 100% is a reliable property to control the prevulcanization

  14. Latex allergies - for hospital patients

    Science.gov (United States)

    ... ency/patientinstructions/000499.htm Latex allergies - for hospital patients To use the sharing features on this page, ... ADAM Health Solutions. About MedlinePlus Site Map FAQs Customer Support Get email updates Subscribe to RSS Follow ...

  15. Cream concentrated latex for foam rubber products

    Science.gov (United States)

    Suksup, R.; Imkaew, C.; Smitthipong, W.

    2017-12-01

    Fresh natural latex (around 40% rubber and 60% water) can be transformed to concentrated natural latex (around 60% rubber and 40% water) in order to realise economical transportation and easier latex product’s preparation. The concentrated natural latex is an extremely valuable material. It can be applied for many types of products, for example, foam rubber as pillow and mattress, elastic band, etc. Industrially, the concentrated natural latex can be prepared by centrifugation which requires an enormous expensive machine. From the eco-friendly products point of view, most of rubber entrepreneurs in the world try to develop a green rubber product. So, the main objective of this study is to prepare the cream concentrated latex without any sophisticated machine. Thus, we work on a simple, cheap and green method that does not use any expensive machine but uses water-based chemical as sodium alginate to prepare the cream concentrated latex. The optimal amount of sodium alginate in the latex was studied. The main characteristics of the cream concentrated latex were tested by various technics, such as alkalinity, total solid content (TSC), dry rubber content (DRC), etc. We found that there are no significant differences of results between fresh natural latex and cream concentrated latex, except for the TSC and DRC. The TSC and DRC of cream latex are higher than those of fresh natural latex. Finally, we propose a model of natural rubber particle and sodium alginate to form the cream concentrated latex.

  16. Correlation of Solar X-ray Flux and SID Modified VLF Signal Strength

    Science.gov (United States)

    2015-03-26

    Motivation ...……………………………………………………………………1-1 Background …………………………………………………………………….1-1 Research Objectives ……………………………………………………………1-3 II...SOLAR X-RAY FLUX AND SID MODIFIED VLF SIGNAL STRENGTH I. Introduction 1.1 Motivation The ionosphere greatly influences long wave radio...accomplished by a research group from Cambridge in the late 1940s. The group recorded the 16 kHz signal of the transmitter in Rugby , England, with the call

  17. Hybridization of Strength Pareto Multiobjective Optimization with Modified Cuckoo Search Algorithm for Rectangular Array.

    Science.gov (United States)

    Abdul Rani, Khairul Najmy; Abdulmalek, Mohamedfareq; A Rahim, Hasliza; Siew Chin, Neoh; Abd Wahab, Alawiyah

    2017-04-20

    This research proposes the various versions of modified cuckoo search (MCS) metaheuristic algorithm deploying the strength Pareto evolutionary algorithm (SPEA) multiobjective (MO) optimization technique in rectangular array geometry synthesis. Precisely, the MCS algorithm is proposed by incorporating the Roulette wheel selection operator to choose the initial host nests (individuals) that give better results, adaptive inertia weight to control the positions exploration of the potential best host nests (solutions), and dynamic discovery rate to manage the fraction probability of finding the best host nests in 3-dimensional search space. In addition, the MCS algorithm is hybridized with the particle swarm optimization (PSO) and hill climbing (HC) stochastic techniques along with the standard strength Pareto evolutionary algorithm (SPEA) forming the MCSPSOSPEA and MCSHCSPEA, respectively. All the proposed MCS-based algorithms are examined to perform MO optimization on Zitzler-Deb-Thiele's (ZDT's) test functions. Pareto optimum trade-offs are done to generate a set of three non-dominated solutions, which are locations, excitation amplitudes, and excitation phases of array elements, respectively. Overall, simulations demonstrates that the proposed MCSPSOSPEA outperforms other compatible competitors, in gaining a high antenna directivity, small half-power beamwidth (HPBW), low average side lobe level (SLL) suppression, and/or significant predefined nulls mitigation, simultaneously.

  18. Synthesis and Characterization of Core-Shell Acrylate Based Latex and Study of Its Reactive Blends

    Directory of Open Access Journals (Sweden)

    Ying Nie

    2008-03-01

    Full Text Available Techniques in resin blending are simple and efficient method for improving the properties of polymers, and have been used widely in polymer modification field. However, polymer latex blends such as the combination of latexes, especially the latexes with water-soluble polymers, were rarely reported. Here, we report a core-shell composite latex synthesized using methyl methacrylate (MMA, butyl acrylate (BA, 2-ethylhexyl acrylate (EHA and glycidyl methacrylate (GMA as monomers and ammonium persulfate and sodium bisulfite redox system as the initiator. Two stages seeded semi-continuous emulsion polymerization were employed for constructing a core-shell structure with P(MMA-co-BA component as the core and P(EHA-co-GMA component as the shell. Results of Transmission Electron Microscopy (TEM and Dynamics Light Scattering (DLS tests confirmed that the particles obtained are indeed possessing a desired core-shell structural character. Stable reactive latex blends were prepared by adding the latex with waterborne melamine-formaldehyde resin (MF or urea-formaldehyde resin (UF. It was found that the glass transition temperature, the mechanical strength and the hygroscopic property of films cast from the latex blends present marked enhancements under higher thermal treatment temperature. It was revealed that the physical properties of chemically reactive latexes with core-shell structure could be altered via the change of crosslinking density both from the addition of crosslinkers and the thermal treatment.

  19. Encapsulation of Clay Platelets inside Latex Particles

    NARCIS (Netherlands)

    Voorn, D.J.; Ming, W.; Herk, van A.M.; Fernando, R.H.; Sung, Li-Piin

    2009-01-01

    We present our recent attempts in encapsulating clay platelets inside latex particles by emulsion polymerization. Face modification of clay platelets by cationic exchange has been shown to be insufficient for clay encapsulation, leading to armored latex particles. Successful encapsulation of

  20. Study on irradiation condition in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Zhu Nankang; Wang Chunlei; Makuuchi, K.; Yoshii, F.

    1996-01-01

    The effect of gamma rays irradiation dose rates on RVNRL preparation was studied using Malaysian latex added with O.2 phr of KOH and 5 phr n-BA. The results showed, to ensure the tensile strength of the latex film meet the requirement, when applying vulcanisation doses, Dv of 20 kGy 20 and 15 kGy, irradiation dose rates should not be greater than 0. 49 kGy/hr and 1. 6 kGy/hr respectively. Its was found that within the storage time of 20 days there was no change in the physical properties of the latex films

  1. Binding kinetics of magnetic nanoparticles on latex beads and yeast cells studied by magnetorelaxometry

    International Nuclear Information System (INIS)

    Eberbeck, Dietmar; Bergemann, Christian; Hartwig, Stefan; Steinhoff, Uwe; Trahms, Lutz

    2005-01-01

    The ion exchange mediated binding of magnetic nanoparticles (MNP) to modified latex spheres and yeast cells was quantified using magnetorelaxometry. By fitting subsequently recorded relaxation curves, the kinetics of the binding reactions was extracted. The signal of MNP with weak ion exchanger groups bound to latex and yeast cells scales linearly with the concentration of latex beads or yeast cells whereas that of MNP with strong ion exchanger groups is proportional to the square root of concentration. The binding of the latter leads to a much stronger aggregation of yeast cells than the former MNP

  2. Reduction factors for creep strength and fatigue life of modified 9Cr-1 Mo steel weldments

    International Nuclear Information System (INIS)

    Blass, J.J.; Battiste, R.L.; O'Connor, D.G.

    1991-01-01

    This paper reports on the provisions of ASME B and PV code Case N-47 currently include reduction factors for creep strength and fatigue life of weldments. To provide experimental confirmation of such factors for modified 9 Cr-1 Mo steel, tests of tubular specimens were conducted at 538 degrees C (1000 degrees F). Three creep-rupture specimens with longitudinal welds were tested in tension; and, of three with circumferential welds, two were tested in tension and one in torsion. In each specimen with a circumferential weld, a nonuniform axial distribution of strain was easily visible. The test results were compared to an existing empirical model of creep-rupture life. For the torsion test, the comparison was based on a definition of equivalent normal stress recently adopted in code Case N-47. some 27 fatigue specimens, with longitudinal, circumferential, or no welds, were tested under axial or torsional strain control. In specimens with welds, fatigue cracking initiated at fusion lines. In axial tests cracks grew in the circumferential direction, and in torsional tests cracks grew along fusion lines

  3. Effect of organic matter strength on anammox for modified greenhouse turtle breeding wastewater treatment.

    Science.gov (United States)

    Chen, Chongjun; Huang, Xiaoxiao; Lei, Chenxiao; Zhang, Tian C; Wu, Weixiang

    2013-11-01

    Anaerobic ammonium-N removal from modified greenhouse turtle breeding wastewater with different chemical oxygen demand (COD) strengths (194.0-577.8 mg L(-1)) at relatively fixed C/N ratios (≈ 2) was investigated using a lab-scale up-flow anaerobic sludge blanket (UASB) anammox reactor. During the entire experiment, the total nitrogen (TN) removal efficiency was about 85% or higher, while the average COD removal efficiency was around 56.5 ± 7.9%. Based on the nitrogen and carbon balance, the nitrogen removal contribution was 79.6 ± 4.2% for anammox, 12.7 ± 3.0% for denitrification+denitritation and 7.7 ± 4.9% for other mechanisms. Denaturing gradient gel electrophoresis (DGGE) analyses revealed that Planctomycete, Proteobacteria and Chloroflexi bacteria were coexisted in the reactor. Anammox was always dominant when the reactor was fed with different COD concentrations, which indicated the stability of the anammox process with the coexistence of the denitrification process in treating greenhouse turtle breeding wastewater. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Managing latex allergies at home

    Science.gov (United States)

    ... Associate Clinical Professor of Medicine, Division of Allergy, Immunology, and Rheumatology, Georgetown University Medical School, Washington, DC. Also reviewed by David Zieve, MD, MHA, Isla Ogilvie, PhD, and the A.D.A.M. Related MedlinePlus Health Topics Latex Allergy Browse the Encyclopedia A.D.A. ...

  5. Latex Allergy - A Case Report

    Directory of Open Access Journals (Sweden)

    Dr. Athma Prasanna

    2005-10-01

    Full Text Available The usage of rubber and its products are not uncommon in various walks of life. A continuous exposure or contact may sensitize the human body, causing reactions from mild to fatal. Despite the availability of the literature, medical personnel are still unaware of the implications of the use of latex materials.

  6. Radiation graft copolymerization of n-butyl acrylate on natural rubber latex

    International Nuclear Information System (INIS)

    Sundardi, F.; Kadariah, S.

    1986-01-01

    A method of radiation graft copolymerization of n-butyl acrylate (NBA) on natural rubber (NR) latex has been studied. The rate of conversion increases with the increase of NBA in latex. An irradiation dose of about 12 kGy is needed to obtain 90% conversion with 40 phr of NBA in latex. Tensile strength, tear strength, and elongation at break of grafted NR are found to decrease with increasing degree of grafting. The physical strength of a vulcanizate prepared from a mixture of NR and ply-NBA was found to be better than that of NBA-NR graft copolymer vulcanizate. The graft copolymerization reaction takes place in the outer layer of NR particles, and because the secondary bonds between poly-NBA molecules may be weaker than those between NR molecules, the existence of a poly-NBA layer in NR particles will decrease its physical strength

  7. Antioxidant and sensitizer effect on the stability of natural rubber latex vulcanized by gamma rays

    International Nuclear Information System (INIS)

    Canavel, V.

    1993-01-01

    The natural rubber latex was vulcanized by gamma rays and electrons beam, in the presence and absence of sensitizer at room temperature. The sensitizers were the following; n-butyl acrylate (n-BA) / t-butyl hydroperoxide (t-B H) / KOH, C Cl 4 / potassium laurate and n-BA / KOH. The studied antioxidants, Irganox 1520, Vulcanox SP and Vulcanox BKF, were added to the latex after irradiation. Among the studied antioxidants in function of tensile strength (TS) after the aging of rubber plates, the Irganox was the best efficient on the gamma vulcanization in the presence of n-BA/t-B H/KOH, because only 0,20 p hr is enough to obtain the greatest increase of TS, that was 34%, 12 MPa to 16 MPa. The formulating method of latex with the sensitizer constituted the 3,0 p hr of n-BA/ 0,1 p hr of t-B H and 0,2 p hr of KOH, was evaluated respecting the TS of rubber plates. The electrons beam vulcanization produces the greatest reversible perturbance in the colloidal stability of latex after irradiation caused by radiolytic species absorption that promotes the increase of particle size. The antioxidant also contributes to reversible destabilization of gamma irradiated latex, because it is also adsorbed by particles surface. The relation between the latex viscosity and the TS of respective rubber plates is reverse, showing the latex stability affects the quality of rubber goods. (author)

  8. Preparation of irradiated natural rubber latex-styrene copolymer for electrical gloves

    International Nuclear Information System (INIS)

    Made Sumarti Kardha

    2010-01-01

    Research on irradiated natural rubber latex-styrene copolymer to prepare electrical glove have been done. Vulcanization of natural rubber latex (NRL) was done by mixing 2 phr (per hundred of rubber) of normal butyl acrylate (n-BA) emulsion then irradiated with ã-ray "6"0Co at the dose of 30 kGy producing irradiated natural rubber latex (INRL). Natural rubber latex-styrene copolymers (SC) were prepared by mixing NRL and styrene monomer at styrene concentrations of 50 phr, 75 phr, 100 phr, 500 phr and irradiated at the doses of 15 kGy, 30 kGy and 45 kGy, then characterized their latex and film properties to obtain optimum SC of SC50. This optimum SC, SC50 then mixed with IRNL at the weight ratio of 0/100, 30/70, 50/50, 70/30 and 100/0, to produce irradiated natural rubber latex-styrene copolymer. The properties of copolymer rubber films made by dipping process i.e., % conversion, total solid content, latex viscosity, tensile strength, modulus 300 %, elongation at break, electrical resistance and dielectric constant were then characterized. Characterization result showed that (INRL-SC50) with 50/50 ratio irradiated at the dose of 30 kGy, have % conversion of 80.93 %, electrical resistivity of 1.73 x 10"1"4 Ohm cm and dielectric constant of 2.76 which fulfill the requirement as material for electrical gloves. (author)

  9. Maillard Reaction in Natural Rubber Latex: Characterization and Physical Properties of Solid Natural Rubber

    Directory of Open Access Journals (Sweden)

    S. Montha

    2016-01-01

    Full Text Available Maillard reaction in Natural Rubber (NR latex was investigated by treating fresh NR latex with glutaraldehyde (C5H8O2 in amounts of 0, 50, 100, and 200 mmol/kg of latex. Protein cross-linking in fresh NR latex and solid NR was confirmed by using sodium dodecylsulfate polyacrylamide gel electrophoresis (SDS-PAGE and attenuated total reflection infrared (ATR-IR spectroscopy, respectively. It was found that degree of protein cross-linking in NR increased with increasing C5H8O2 concentration. Physical properties of untreated and treated NR substances in terms of gel content, initial Wallace plasticity (P0, plasticity retention index (PRI, Mooney viscosity, and tensile strength were carefully explored. Results clearly showed that the Maillard cross-linking of proteins had remarkable effect on bulk NR properties, that is, solvent resistance, hardness, resistance to oxidation, rheological behavior, and resistance to stretching out.

  10. Effect of cellulose nanocrystals from corn cob with dispersion agent polyvinyl pyrrolidone in natural rubber latex film after aging treatment

    Science.gov (United States)

    Harahap, H.; Ridha, M.; Halimatuddahliana; Taslim; Iriany

    2018-02-01

    This study about the resistance of natural rubber latex films using nanocrystals cellulose filler from corn cob waste by aging treatment. Corn cob used as organic filler composed of cellulose, hemicellulose, and lignin. Each component has a potential for reuse, such as cellulose. Cellulose from corn cob has potential application as a filler prepared by hydrolysis process using a strong acid. The producing of natural rubber latex films through coagulant dowsing process. This research started with the pre-vulcanization process of natural rubber latex at 70 °C and followed by process of vulcanization at 110 °C for 20 minutes. Natural rubber latex films that have been produced continued with the aging treatment at 70 °C for 168 hours. The mechanical properties of natural rubber latex films after aging treatment are the tensile strength, elongation at break, M100 and M300 have performed.

  11. Protein Modifiers Generally Provide Limited Improvement in Wood Bond Strength of Soy Flour Adhesives

    Science.gov (United States)

    Charles R. Frihart; Linda Lorenz

    2013-01-01

    Soy flour adhesives using a polyamidoamine-epichlorohydrin (PAE) polymeric coreactant are used increasingly as wood adhesives for interior products. Although these adhesives give good performance, higher bond strength under wet conditions is desirable. Wet strength is important for accelerated tests involving the internal forces generated by the swelling of wood and...

  12. Rubber/clay nanocomposites by combined latex compounding and melt mixing: A masterbatch process

    International Nuclear Information System (INIS)

    Tan, Jinghua; Wang, Xiaoping; Luo, Yuanfang; Jia, Demin

    2012-01-01

    Highlights: → Rubber/Ca-montmorillonite nanocomposites were prepared by the masterbatch process. → Latex compounding method is efficient to improve the Ca-montmorillonite dispersion. → Exfoliated structure was obtained in the masterbatch by latex compounding method. → Intercalated and exfoliated structures were achieved in the vulcanizate. → The properties of vulcanizate are improved by the addition of Ca-montmorillonite. -- Abstract: Rubber/Ca-montmorillonite (Ca-MMT) nanocomposites with well exfoliated Ca-MMT layers were prepared by combination of latex compounding and melt mixing. Firstly, a high Ca-MMT content masterbatch was co-coagulated by natural rubber (NR) latex and modified Ca-MMT aqueous suspension through latex compounding. The masterbatch was added in the system of styrene butadiene rubber (SBR) and epoxidized natural rubber (ENR) by melt mixing subsequently. The X-ray diffraction (XRD) and transmission electronic microscopy (TEM) results showed that intercalated and exfoliated nanocomposites were obtained by the masterbatch technique. The effects of modified Ca-MMT introduction into the rubber matrix, via the masterbatch technique, on the properties of the resulting composites were studied. It was found that the vulcanization was hindered by the incorporation of modified Ca-MMT, while mechanical performances, thermal stability and aging resistance were improved. The increasingly glass transition temperature and the storage modulus with the loading of modified Ca-MMT were measured by dynamic mechanical analysis (DMA).

  13. Latex sensitisation in healthcare workers in Singapore.

    Science.gov (United States)

    Tang, M B Y; Leow, Y H; Ng, V; Koh, D; Goh, C L

    2005-06-01

    Epidemiological data on latex sensitisation among Asian healthcare workers is lacking. The aim of the study is to determine the rate of latex sensitisation in our healthcare workers. We recruited 313 healthcare workers, of which 46.6% were operating theatre staff and 53.4% were non-operating theatre staff. Seventy-one administrative staff served as controls. All participants answered a self-administered questionnaire relating to latex exposure and glove-related symptoms. Latex sensitisation was determined by skin prick testing to latex and latex-specific IgE detection. The prevalence of latex sensitisation among healthcare workers was 9.6%, with no difference between operating theatre and nonoperating theatre staff. Glove-related symptoms were reported in 13.7% of all healthcare workers, of which 22.9% were sensitised to latex. Only 26.7% of latex-sensitised healthcare workers had glove-related symptoms while the rest were asymptomatic. The most common symptoms were itch and hand eczema but the most important discriminating symptom was contact urticaria. Personal history of atopy was more common in sensitised healthcare workers (40.0%) compared to non-sensitised workers (31.8%). Only 1 out of 9 (11.2%) symptomatic latex-sensitised subjects had sought previous medical attention for the problem. Latex sensitisation among healthcare workers in Singapore should be considered a significant occupational health risk, as it is in the West. Increased screening and awareness of this problem is essential to identify those at risk.

  14. Latex Allergy In Health Care Workers

    Directory of Open Access Journals (Sweden)

    Hayriye Sarıcaoğlu

    2013-05-01

    Full Text Available Background and Design: We aimed to determine the frequency of latex allergy in our hospital and to to evaluate the clinical and demographical features of the cases.Materials and Methods: A detailed questionnaire was administered to healthcare workers by a physician. Skin prick test with latex and patch test with rubber chemicals and a piece of latex glove were performed for all healthcare workers. Latex-specific IgE was measured in serum.Results: The study sample consisted of 36 nurses, 14 doctors, and 50 healthcare workers. While 46 subjects had symptoms, 54 subjects had no symptoms. The relationship of clinical disease with working duration, exposure duration (hour/day, history of atopy, and drug/food allergies was statistically significant. Five nurses and 1 healthcare worker had positive skin prick test. Two of them had positive latex-specific IgE. Positive skin prick test statistically significantly correlated with occupation, working duration, exposure duration (hour/day and positive latex-specific IgE. Two nurses and 2 healthcare workers had positive latex-specific IgE. Two of them had positive skin prick test. Positive latexspecific IgE statistically significantly correlated with working duration, exposure duration, and positive skin prick test. Patch test with a piece of latex glove was negative in all subjects. Three healthcare workers had positive patch test with thiuram-mix, one of them had also positive patch test with mercaptobenzothiazole.Discussion: One of the risk factors for latex allergy is occupations involving frequent exposure to latex products. Latex allergy should be taken into consideration if type I hypersensitivity reactions occur in occupational groups at risk for anaphylactic reaction.

  15. Comparison of Elastic Modulus and Compressive Strength of Ariadent and Harvard Polycarboxylate Cement and Vitremer Resin Modified Glass Ionomer

    Directory of Open Access Journals (Sweden)

    Ahmadian Khoshemehr Leila

    2009-09-01

    Full Text Available Background: Luting agents are used to attach indirect restoration into or on the tooth. Poor mechanical properties of cement may be a cause of fracture of this layer and lead to caries and restoration removal. The purpose of this study was to compare the elastic modulus and compressive strength of Ariadent (A Poly and Harvard polycarboxylate (H Poly cements and Vitremer resin modified glass ionomer (RGl.Materials & Methods: In this experimental study 15 specimens were prepared form each experimental cement in Laboratory of Tehran Oil Refining Company. The cylindrical specimens were compressed in Instron machine after 24 hours. Elastic modulus and compressive strength were calculated from stress/strain curve of each specimen. One way ANOVA and Tukey tests were used for statistical analysis and P values<0.05 were considered to be statistically significant.Results: The mean elastic modulus and mean compressive strength were 2.2 GPa and 87.8MPa in H poly, 2.4 GPa and 56.5 MPa in A Poly, and 0.8GPa and 105.6 MPa in RGI, respectively. Statistical analysis showed that compressive strength and elastic modulus of both polycarboxylate cements were significantly different from hybrid ionomer (P<0.05, but the difference between elastic modulus of two types of polycarboxilate cements was not statistically significant. Compressive strength of two polycarboxilate cements were significantly different (P<0.05. Conclusion: An ideal lutting agent must have the best mechanical properties. Between the tested luttins RGl cement had the lowest elastic modulus and the highest compressive strength, but the A poly cement had the highest elastic modulus and the lowest compressive strength. Therefore none of them was the best.

  16. Effect of irradiation on the prevulcanized latex/low nitrosamines latex blends

    Energy Technology Data Exchange (ETDEWEB)

    Ibrahim, Pairu; Zin, Wan Manshol Wan [Malaysian Nuclear Agency, 43000 kajang, Selangor (Malaysia); Daik, Rusli [Faculty of Science and Technology, Universiti Kebangsaan Malaysia,43600 bangi, Selangor (Malaysia)

    2015-09-25

    Radiation Prevulcanized Natural Rubber Latex (RVNRL) was blended with Low Nitrosamines Latex (LNL) at different composition ratio. Methyl Metachrylate (MMA) was added for grafting onto the blended latex. Blended latex was subjected to gamma irradiation at various doses up to 8kGy. The mechanical properties and FTIR analysis were investigated as a function of the blended composition and irradiation dose. It was found that blending at specific ratio and gamma irradiation at specific dose led to significant improvement on the properties of the latex. The optimum mechanical properties was attained at a total blending ratio of 70% RVNRL and 30% of LNL.

  17. Biodegradability and aging study of rubber films obtained by gamma radiation vulcanization processes of latex

    International Nuclear Information System (INIS)

    Martins, Carlos Felipe Pinto

    2005-01-01

    The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of 60 C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)

  18. Evaluation of Arm and Shoulder Mobility and Strength after Modified Radical Mastectomy and Radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Blomqvist, Lennart; Stark, Birgit; Engler, Natacha; Malm, Maj [Karolinska Inst., Stockholm (Sweden). Dept. of Physiotherapy Center for Surgical Sciences

    2004-04-01

    Seventy-five women, of whom 30 had received postoperative radiotherapy, were tested for range of motion (ROM) and shoulder strength with a goniometer and an isokinetic device (Orthotron II), respectively. On the individual level, irradiated patients exhibited significantly reduced range of motion (varying from p<0.05 to p<0.001) for all movements compared with the non-operated side. In contrast, in the non-irradiated patients only flexion was significantly reduced (p<0.05). The same individual pattern was evident for shoulder strength where all movements except external rotation were significantly reduced in irradiated patients (varying from p<0.05 to p<0.001). Non-irradiated patients exhibited a significant reduction in shoulder strength for flexion and abduction (p<0.05), whereas other movements were less affected. The observed differences in ROM and strength were less pronounced when analyzed on a group level, but were still significant for ROM (p<0.001) for flexion and abduction. Group level analysis also showed reduced shoulder strength for all movements but only rotation was significantly (p<0.01) impaired.

  19. Evaluation of Arm and Shoulder Mobility and Strength after Modified Radical Mastectomy and Radiotherapy

    International Nuclear Information System (INIS)

    Blomqvist, Lennart; Stark, Birgit; Engler, Natacha; Malm, Maj

    2004-01-01

    Seventy-five women, of whom 30 had received postoperative radiotherapy, were tested for range of motion (ROM) and shoulder strength with a goniometer and an isokinetic device (Orthotron II), respectively. On the individual level, irradiated patients exhibited significantly reduced range of motion (varying from p<0.05 to p<0.001) for all movements compared with the non-operated side. In contrast, in the non-irradiated patients only flexion was significantly reduced (p<0.05). The same individual pattern was evident for shoulder strength where all movements except external rotation were significantly reduced in irradiated patients (varying from p<0.05 to p<0.001). Non-irradiated patients exhibited a significant reduction in shoulder strength for flexion and abduction (p<0.05), whereas other movements were less affected. The observed differences in ROM and strength were less pronounced when analyzed on a group level, but were still significant for ROM (p<0.001) for flexion and abduction. Group level analysis also showed reduced shoulder strength for all movements but only rotation was significantly (p<0.01) impaired

  20. Reliability and agreement between 2 strength devices used in the newly modified and standardized Constant score

    DEFF Research Database (Denmark)

    Kristensen, Morten Tange; Aagesen, Maria; Hjerrild, Signe

    2014-01-01

    HYPOTHESIS: The new and standardized test protocol for the Constant score (CS) provides new methodology, but different devices are still used for shoulder strength testing. It was hypothesized that strength measurements using the IsoForceControl (IFC) dynamometer (MDS Medical Device Solutions......, Oberburg, Switzerland) would provide results comparable with the IDO isometer (Innovative Design Orthopaedics, Redditch, UK). MATERIALS AND METHODS: Sixty healthy subjects, aged 19 to 83 years, were studied, with 5 men and 5 women in each of 6 ten-year age groups. The IFC and IDO were used in randomized...... order with an 8-minute interval between testing. Subjects performed 3 successive trials with strong verbal encouragement, with 1 minute between trials. The best strength performance was used in the analysis. The rater and subjects were blinded to all results. RESULTS: The IFC produced 0.28-kg (0.62-lb...

  1. Decontamination of latex gloves; Decontamination de gants en latex

    Energy Technology Data Exchange (ETDEWEB)

    Boutot, P; Schipfer, P; Blachere, A [Commissariat a l' Energie Atomique, Chusclan (France). Centre de Production de Plutonium de Marcoule

    1969-07-01

    Initially the latex gloves used in controlled zones were processed after use as radioactive waste. In view of the continually increasing number used, however, the persons in charge of the SPRAR have considered the possibility of decontaminating the gloves and using them again after control. The recovery installations which have been developed were initially designed rather crudely and operated irregularly; they have been progressively improved as a result of the experience acquired; today they are more really an industrial concern, equipped with automatic machinery. In 1967 it has been possible with this set-up to recover 247000 pairs of gloves, representing nearly 70 per cent of the number treated. (author) [French] Initialement, les gants de latex utilises dans les zones controlees etaient conditionnes apres emploi comme dechets radioactifs. Mais, devant l'augmentation sans cesse croissante des quantites employees, les responsables du SPRAR ont envisage leur decontamination et leur recyclage apres controles. Les installations de recuperation mises au point, de conception artisanale et fonctionnant de maniere episodique au depart, se sont progressivement ameliorees au fur et a mesure de l'experience acquise; elles revetent aujourd'hui le caractere d'une exploitation industrielle equipee de machines automatiques. En 1967, ces nouvelles installations ont permis de recuperer 247000 paires de gants, ce qui represente pres de 70 pour cent des quantites traitees. (auteur)

  2. Effect of T6 heat treatment on tensile strength of EN AB-48000 alloy modified with strontium

    Directory of Open Access Journals (Sweden)

    J. Pezda

    2011-07-01

    Full Text Available Among alloys of non-ferrous metals, aluminum alloys have found their broadest application in foundry industry. Silumins are widely used in automotive, aviation and shipbuilding industries; as having specific gravity nearly three times lower than specific gravity of cast iron. The silumins can be characterized by high mechanical properties. To upgrade mechanical properties of a castings made from silumins one makes use of heat treatment, what leads to change of their structure and advantageously affects on mechanical properties of the silumins. In the paper are presented test results concerning effect of dispersion hardening on change of tensile strength of EN AB-48000 silumin modified with strontium. Investigated alloy was melted in electric resistance furnace. Temperature ranges of solution heat treatment and ageing heat treatment were selected on base of curves from ATD method, recorded for refined alloy and for modified alloy. The heat treatment resulted in change of Rm tensile strength, while performed investigations have enabled determination of temperatures and durations of solution heat treatment and ageing heat treatment, which precondition obtainment of the best tensile strength Rm of the investigated alloy.

  3. EDITORIALS Latex allergy: 'Plight, rights and fights'

    African Journals Online (AJOL)

    anaphylaxis and life-threatening food allergies to cross-reacting fruit allergens such as kiwi, banana, tomato and chestnuts). Latex allergy is also encountered more frequently in children with spina bifida than in other hospitalised children.[7] Sensitisation is usually confirmed by commercial latex allergy skinprick testing or by ...

  4. Use of micrometric latex beads to improve the porosity of hydroxyapatite obtained by chemical coprecipitation method

    Science.gov (United States)

    Webler, G. D.; Rodrigues, W. C.; Silva, A. E. S.; Silva, A. O. S.; Fonseca, E. J. S.; Degenhardt, M. F. S.; Oliveira, C. L. P.; Otubo, L.; Barros Filho, D. A.

    2018-04-01

    Hydroxyapatite is one of the most important biomaterials whose application mainly extends to implants and drug delivery. This work will discuss the changes in the pore size distribution of hydroxyapatite when there are latex beads present during the synthesis. These changes were monitored using different techniques: small angle X-ray scattering, X-ray diffraction, thermal gravimetrical analysis, N2 adsorption, scanning and transmission electron microscopy. Latex beads and hydroxyapatite form a single nanocomposite with well-distinguished inorganic and organic phases. Latex bead removal in the temperature range of 300-600 °C did not modify the original crystalline structure of hydroxyapatite. However, the latex beads favored an increase in the adsorption capacity of mesopores at temperatures higher than their glassy transition (Tg). The main result of this research work consists on the increase of surface area and pore size distribution obtained after the removal of latex beads template. Latex beads have been used in a different approach changing the porosity of hydroxyapatite scaffolds not only introducing new routes for cell integration but also broadening the pore size distribution which can result in a more high efficiency for drug release in living cells.

  5. modified water-cement ratio law for compressive strength of rice

    African Journals Online (AJOL)

    user

    various types of structures due to its structural stability and strength [1]. ... value of water-cement ratio results in greater pore spaces in .... as well as removing the excess water on the surface of the soil particles. ... and aggregate impact value.

  6. Jackfruit anaphylaxis in a latex allergic patient.

    Science.gov (United States)

    Wongrakpanich, Supakanya; Klaewsongkram, Jettanong; Chantaphakul, Hiroshi; Ruxrungtham, Kiat

    2015-03-01

    Several fruits have been reported to crossreact with latex antigen in latex allergy patients but little is known regarding tropical fruits in particular. Here we report the case of a 34-year old nurse who developed anaphylaxis following the ingestion of dried jackfruit (Artocarpus heterophyllus). The patient had a history of chronic eczema on both hands resulting from a regular wear of latex gloves. She and her family also had a history of atopy (allergic rhinitis and/or atopic dermatitis). The results of skin prick tests were positive for jackfruit, latex glove, kiwi and papaya, but the test was negative for banana. While we are reporting the first case of jackfruit anaphylaxis, further research needs to be conducted to identify the mechanisms underlying it. In particular, in-vitro studies need to be designed to understand if the anaphylaxis we describe is due to a cross reactivity between latex and jackfruit or a coincidence of allergy to these 2 antigens.

  7. Nitrile versus Latex for Glove Juice Sampling.

    Science.gov (United States)

    Landers, Timothy F; Dent, Anthony

    2014-01-01

    The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (pnitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.

  8. Nitrile versus Latex for Glove Juice Sampling.

    Directory of Open Access Journals (Sweden)

    Timothy F Landers

    Full Text Available The objective of this study was to explore the utility of nitrile gloves as a replacement for latex surgical gloves in recovering bacteria from the hands. Two types of nitrile gloves were compared to latex gloves using the parallel streak method. Streaks of Klebsiella pneumoniae and Staphylococcus aureus were made on tryptic soy agar plates, and the zones of inhibition were measured around pieces of glove material placed on the plates. Latex gloves produced a mean zone of inhibition of 0.28 mm, compared to 0.002 mm for nitrile gloves (p<.001. While the parallel streak method is not intended as a quantitative estimate of antimicrobial properties, these results suggest that nitrile may be a viable alternative to latex in glove juice sampling methods, since nitrile avoids the risk of latex exposure.

  9. Progress in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Makuuchi, Keizo

    2000-01-01

    Vulcanization dose defined as the radiation dose at which cross-linked natural rubber in latex has the maximum tensile strength can be reduced by adding carbon tetrachloride as a reaction accelerator. The radiation vulcanization of natural rubber latex was selected as one of regional projects of IAEA in 1989 and a pilot plant was built in Jakarta. The products from it were evaluated during 1983-1985, followed by IAEA decision to support the continued R and D study at Takasaki, JAERI. Various factors to improve the properties of the products have been studied. Several advantages of the process over conventional method, such as absence of N-nitrosoamines, low cytotoxicity, decomposability in the environment, transparency and softness, were confirmed. The technology has been transferred toward commercial application in Thailand, and pilot plants being set up in Indonesia, India, Malaysia and Thailand. Moreover, the process was found to be effective in reducing protein remaining in natural rubber latex products and the initial investment and irradiation cost was found to be greatly reduced by employing low energy electron accelerator. This paper reviews such progress. (S. Ohno)

  10. Validation and reliability of a modified sphygmomanometer for the assessment of handgrip strength in Parkinson´s disease

    Directory of Open Access Journals (Sweden)

    Soraia M. Silva

    2015-04-01

    Full Text Available BACKGROUND: Handgrip strength is currently considered a predictor of overall muscle strength and functional capacity. Therefore, it is important to find reliable and affordable instruments for this analysis, such as the modified sphygmomanometer test (MST. OBJECTIVES: To assess the concurrent criterion validity of the MST, to compare the MST with the Jamar dynamometer, and to analyze the reproducibility (i.e. reliability and agreement of the MST in individuals with Parkinson's disease (PD. METHOD: The authors recruited 50 subjects, 24 with PD (65.5±6.2 years of age and 26 healthy elderly subjects (63.4±7.2 years of age. The handgrip strength was measured using the Jamar dynamometer and modified sphygmomanometer. The concurrent criterion validity was analyzed using Pearson's correlation coefficient and a simple linear regression test. The reproducibility of the MST was evaluated with the coefficient of intra-class correlation (ICC2,1, the standard error of measurement (SEM, the minimal detectable change (MDC, and the Bland-Altman plot. For all of the analyses, α≤0.05 was considered a risk. RESULTS: There was a significant correlation of moderate magnitude (r≥0.45 between the MST and the Jamar dynamometer. The MST had excellent reliability (ICC2,1≥0.7. The SEM and the MDC were adequate; however, the Bland-Altman plot indicated an unsatisfactory interrater agreement. CONCLUSIONS: The MST exhibited adequate validity and excellent reliability and is, therefore, suitable for monitoring the handgrip strength in PD. However, if the goal is to compare the measurements between examiners, the authors recommend that the data be interpreted with caution.

  11. The entry of free radicals into polystyrene latex particles

    International Nuclear Information System (INIS)

    Adams, M.E.; Trau, M.; Gilbert, R.C.; Napper, D.R.

    1988-01-01

    Mechanistic understanding of the processes governing the kinetics of emulsion polymerization has both scientific and technical interest. One component of this process that is poorly understood at present is that of free radical entry into latex particles. Measurements were made of the entry rate coefficient as a function of temperature for free radicals entering polystyrene latex particles in seeded emulsion polymerizations initiated by γ-rays. The activation energy for entry was found to be less than 24 ± 3 kJ mol -1 , consistent with entry being controlled by a physical (e.g. diffusional) rather than a chemical process. Measurement of the entry rate coefficient as a function of the γ-ray dose rate suggested that the factors that determine the entry rate when the primary free radicals are uncharged are similar to those that determine the entry rate for charged free radicals derived from chemical initiation by peroxydisulfate. This result was consistent with measurements of the entry rate coefficient of charged free radicals derived from peroxydisulfate; these data were found to be virtually independent of both the extent of the latex surface coverage by the anionic surfactant sodium dodecyl sulfate and the ionic strength of the continuous phase. The data refute several proposals given in the literature for the rate-determining step for entry, being inconsistent with control by collision of free radicals with the latex particles, surfactant desorption, and an electrostatic barrier arising from the colloidal nature of the entering free radical. The origin of the activation energy for entry remains obscure

  12. Bond Strength of Silorane- and Methacrylate-Based Composites to Resin-Modified Glass Ionomers

    Science.gov (United States)

    2012-01-13

    genre was given the name of resin-modified glass ionomers (RMGI) (Antonucci et al., 1988). The addition of resin improved many of the drawbacks of...entire surface for 15 seconds then gentle air was used to create an even film over the sample. This layer was cured for 10 seconds using the Bluephase

  13. Microtensile Bond Strength of Polyacid-modified Composite Resin to Irradiated Primary Molars.

    Science.gov (United States)

    Keles, Sultan; Yilmaz, Yucel; Sezen, Orhan

    2018-02-01

    This study evaluated the influence of various doses of radiotherapy on the microtensile bond strength (pTBS) of compomer resin to dentin and enamel in primary molars. Thirty-five intact primary molars were collected and divided into seven groups. Teeth were irradiated with doses from 10 to 60 Gy, except for the control group. Compomer restorations were performed, and enamel-compomer resin beams and dentin-compomer resin beams were tested at a crosshead speed of 1 mm/min. No statistically significant difference was found between the irradiated tooth enamel and the control group (F = 1.1468; p = 0.194). However, statistically significant differences were evident among the dentin groups (F = 11.050; p pTBS of compomer resin to primary tooth enamel, but appears to dose dependently decrease its bond strength to primary tooth dentin. Radiotherapy may affect the success rate of compomer fillings in primary teeth, especially in deeper cavities with exposed dentin.

  14. Extractable proteins from field radiation vulcanized natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Parra, Duclerc F. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)]. E-mail: dfparra@ipen.br; Pinto Martins, Carlos Felipe [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Collantes, Hugo D.C. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil); Lugao, Ademar B. [Chemical and Environmental Centre, Nuclear Energy Research Institute, Av. Lineu Prestes, 2242-CEP Sao Paulo (Brazil)

    2005-07-01

    The type I allergy associated with the use of natural rubber latex (NRL) products is caused by the NRL proteins leached by the sweat or other body fluids. Makuuchi's group proposed for the first time the proteins removal by the addition of water-soluble polymers (WSP) on radiation vulcanization of natural rubber latex (RVNRL) that is a promising process under development in many countries. In this study, Brazilian field natural rubber was irradiated with a {sup 60}Co gamma source to reduce the content of WSP in the final product. WSP was used as additive to improve the extraction of protein. After irradiation the RVNRL was centrifuged to extract the WSP and proteins. The analytical methodology for protein content was based on the modified Lowry method according to ASTM D5712. Protein determination was carried out in serum of latex and in the extracts of the gloves. The concentration of extractable water-soluble proteins in serum of irradiated field NRL (NRL1), not irradiated one (NRL2); of twice centrifuged sample with polymer additive NRL (NRL3) and of the glove manufactured (NRLG) are compared with commercial glove (CG). The irradiation process increases the extractable water-soluble proteins, EP, as reported in the literature. In this study the use of polymeric additive on the bi-centrifugation process to remove protein was successful and the EP of the glove obtained in NRL3 was at around 40% of the commercial glove.

  15. Improving the strength of additively manufactured objects via modified interior structure

    Science.gov (United States)

    Al, Can Mert; Yaman, Ulas

    2017-10-01

    Additive manufacturing (AM), in other words 3D printing, is becoming more common because of its crucial advantages such as geometric complexity, functional interior structures, etc. over traditional manufacturing methods. Especially, Fused Filament Fabrication (FFF) 3D printing technology is frequently used because of the fact that desktop variants of these types of printers are highly appropriate for different fields and are improving rapidly. In spite of the fact that there are significant advantages of AM, the strength of the parts fabricated with AM is still a major problem especially when plastic materials, such as Acrylonitrile butadiene styrene (ABS), Polylactic acid (PLA), Nylon, etc., are utilized. In this study, an alternative method is proposed in which the strength of AM fabricated parts is improved employing direct slicing approach. Traditional Computer Aided Manufacturing (CAM) software of 3D printers takes only the geometry as an input in triangular mesh form (stereolithography, STL file) generated by Computer Aided Design software. This file format includes data only about the outer boundaries of the geometry. Interior of the artifacts are manufactured with homogeneous infill patterns, such as diagonal, honeycomb, linear, etc. according to the paths generated in CAM software. The developed method within this study provides a way to fabricate parts with heterogeneous infill patterns by utilizing the stress field data obtained from a Finite Element Analysis software, such as ABAQUS. According to the performed tensile tests, the strength of the test specimen is improved by about 45% compared to the conventional way of 3D printing.

  16. Evaluation of the effect of blood contamination on the compressive strength of MTA modified with hydration accelerators

    Directory of Open Access Journals (Sweden)

    Kaveh Oloomi

    2013-08-01

    Full Text Available Objectives This study was performed to evaluate the effect of blood contamination on the compressive strength (CS of Root MTA (RMTA modified with Calcium chloride (CaCl2 and Disodium hydrogen phosphate (Na2HPO4 as setting accelerators over time. Materials and Methods A total of 110 cylindrical specimens of RMTA were divided into 6 experimental groups as follows: Group1, RMTA; Group 2, RMTA modified with CaCl2 (RMTA-C; Group 3, RMTA modified with Na2HPO4 (RMTA-N; Group 4, RMTA contaminated with blood; Group 5, RMTA-C contaminated with blood; Group 6, RMTA-N contaminated with blood. The CS of specimens in all groups was evaluated after 3 hr, 24 hr, and 1 wk. In the modified groups (groups 2, 3, 5, and 6 the CS of five specimens per group was also evaluated after 1 hr. Results Blood contamination significantly reduced the CS of all materials at all time intervals (p < 0.05. After 3 hr, the CS of specimens in the RMTA groups (with and without blood contamination was significantly lower than those in the RMTA-C and RMTA-N groups (p < 0.05. The CS values were not significantly different at the other time intervals. In all groups, the CS of specimens significantly increased over time (p < 0.05. Conclusions Blood contamination decreased the CS of both original and accelerated RMTA.

  17. Transcript Profiling of Hevea brasiliensis during Latex Flow

    Directory of Open Access Journals (Sweden)

    Jinquan Chao

    2017-11-01

    Full Text Available Latex exploitation enhances latex regeneration in rubber trees. The latex exploitation-caused latex flow lasts from 10 min to a few hours, which is convenient for exploring the transcript profiling of latex metabolism-related genes at the different stages of latex flow. In the present study, the expression pattern of 62 latex metabolism-related genes involved in water transportation, carbohydrate metabolism, natural rubber biosynthesis, hormone signaling, ROS generation and scavenging, and latex coagulum across three stages of latex flow between rubber tree clones CATAS7-33-97 and CATAS8-79 were comparatively analyzed by quantitative real-time PCR. The two clones show differences in latex regeneration and have a different duration of latex flow. The results showed that the expression levels of 38 genes were significantly higher in CATAS8-79 latex than in CATAS7-33-97 during latex regeneration, while 45 genes had a notably higher expression level in CATAS8-79 latex during latex flow. Together with the activation of the MEP pathway and jasmonate pathway in CATAS8-79 latex, HbPIP1;3, HbPIP1;4, HbSUT3, HbSus3, HbHMGS1-2, HbMK should contribute to the high latex regeneration ability. The up-regulation of ethylene signaling and Hb44KD and the down-regulation of latex coagulation-related genes in CATAS8-79 latex might contribute to its longer latex flow duration. This study provides some cues for revealing the regulation of latex metabolism in rubber trees.

  18. [Latex allergy in a population at risk].

    Science.gov (United States)

    Ruiz Fernández, M; Flores Sandoval, G; Orea Solano, M

    1999-01-01

    The allergy to latex is an illness whose prevalence has been increased in very significant form in the last years. To know the allergy incidence to latex in population of risk, as well as to identify the related sintomatology and the importance or paper that play the atopia antecedents and time of contact with latex for the development of the illness. We carry out a prospective, descriptive, experimental and traverse study in population of risk, in the service of Allergy and clinical Immunology of the Hospital Regional Lic. Adolfo López Mateos, ISSSTE. One hundred patients of both sexes were included, with age of 20 to 50 years, with the antecedent of being personal medical and paramedic and to have presented contact with latex material in a minimum period of one year. They were carried out clinical history with registration of sintomatology nasal, bronchial, cutaneous and associated to contact with latex. They were carried out cutaneous test for prick to latex with positive control with the help of histamine solution and negative control with solution of Evans and immediate reading of the same one. 22% of the patients in study, they presented positive skin test latex, with a time of exhibition 10 year-old average, 68% presented antecedent of atopy personal, family and, likewise the associate sintomatology was in a 33.3% dermatology, 54.5 nasal, nobody presented bronchial symptoms and a 9% asymptomatic was reported. We support that the immediate skin test latex for Prick is an important parameter of support diagnosis for allergy to type 1 latex.

  19. Modified heat treatment for lower temperature improvement of the mechanical properties of two ultrahigh strength low alloy steels

    Science.gov (United States)

    Tomita, Yoshiyuki; Okabayashi, Kunio

    1985-01-01

    In the previous papers, a new heat treatment for improving the lower temperature mechanical propertise of the ultrahigh strength low alloy steels was suggested by the authors which produces a mixed structure of 25 vol pct lower bainite and 75 vol pct martensite through isothermal transformation at 593 K for a short time followed by water quenching (after austenitization at 1133 K). In this paper, two commercial Japanese ultrahigh strength steels, 0.40 pct C-Ni-Cr-Mo (AISI 4340 type) and 0.40 pct C-Cr-Mo (AISI 4140 type), have been studied to determine the effect of the modified heat treatment, coupled above new heat treatment with γ ⇆ α' repctitive heat treatment, on the mechanical properties from ambient temperature (287 K) to 123 K. The results obtained for various test temperatures have been compared with those for the new heat treatment reported previously and the conventional 1133 K direct water quenching treatment. The incorporation of intermediate four cyclic γ ⇆ α' repctitive heat treatment steps (after the initial austenitization at 1133 K and oil quenching) into the new heat treatment reported previously, as compared with the conventional 1133 K direct water quenching treatment, significantly improved 0.2 pct proof stress as well as notch toughness of the 0.40 pct C-Ni-Cr-Mo ultrahigh strength steel at similar fracture ductility levels from 287 to 123 K. Also, this heat treatment, as compared with the conventional 1133 K direct water quenching treatment, significantly improved both 0.2 pct proof stress and notch toughness of the 0.40 pct C-Cr-Mo ultrahigh strength steel with increased fracture ductility at 203 K and above. The microstructure consists of mixed areas of ultrafine grained martensite, within which is the refined blocky, highly dislocated structure, and the second phase lower bainite (about 15 vol pct), which appears in acicular form and partitions prior austenite grains. This newly developed heat treatment makes it possible to modify

  20. Effects of a 12-Week Modified German Volume Training Program on Muscle Strength and Hypertrophy—A Pilot Study

    Directory of Open Access Journals (Sweden)

    Daniel A. Hackett

    2018-01-01

    Full Text Available This study investigated the effect of a 12-week modified German Volume Training intervention, or the 10 sets method, on muscle strength and hypertrophy. Twelve healthy males were randomly assigned to either a 5-SET or 10-SET group and performed 5 or 10 sets, respectively, of 10 repetitions at 60–80% one-repetition maximum (1RM. Muscle strength and body composition measures were taken at baseline, six weeks, and after 12 weeks of training. No significant changes in total, trunk, and arm lean mass were found within and between groups at any time point. There was no significant difference between groups for lean leg mass. However, a decrease in lean leg mass was observed within the 10-SET group between six and 12 weeks (p = 0.02. An increase in 1RM bench press was found within the 5-SET group at week 6 (p = 0.001 and 12 (p = 0.001 when compared to baseline, while no increases in 1RM leg press were observed at any time point within any group. No significant differences were found for 1RM bench press and leg press between groups. For 1RM bench press moderate effect sizes (ES favored 5-SET and for 1RM leg press small ESs favored 10-SET. Findings suggest performing >5 sets per exercise does not promote greater gains in muscle strength and hypertrophy. Future research should aim to substantiate these preliminary findings in a larger cohort.

  1. Modified method for the assessment of the remaining strength of corroded pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Benjamin, Adilson C.; Andrade, Edmundo Q. de [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)

    2003-07-01

    In this paper a modified version of the RSTRENG 085dL method is proposed. This method, named RPA method or Modified 085dL method, uses two different equations to predict the failure pressure of a corrosion defect: one for short defects (defects in which L {<=} {radical}20 D{sub e} t) and other for long defects (defects in which L > {radical}20 D{sub e} t). The equation for short defects is the same equation used by the original 085dL method in the assessment of short defects. However the equation for long defects is different from the equation used by the original 085dL method in the assessment of long defects and gives conservative results for long uniform depth defects. Also the failure pressures measured in the PETROBRAS laboratory tests are compared with those predicted by the RPA method, the ASME B31G method, the RSTRENG 085dL method and the DNV RP-F101 method for single defects (Part B). (author)

  2. Trial Production of Surgical Gloves from Irradiated Natural Rubber Latex on Factory Scale

    Directory of Open Access Journals (Sweden)

    M. Utama

    2005-07-01

    Full Text Available Trial production of surgical gloves from irradiated natural rubber latex at the PT. Laxindo Utama Serang Banten glove factory has been carried out. The variation of heating temperature and leaching time during processing were evaluated. The physical and mechanical properties and the protein allergen respond of surgical gloves using ELISA method were measured. The results showed that the physical and mechanical of surgical gloves such as tensile strength, modulus, and elongation at break arefound to meet the requirements of the ISO or SNI standard for surgical gloves. While the allergic response through clinical tested latex-sensitive protein allergen known as ELISA test is found to be negative.

  3. Mechanical and morphological properties of kenaf powder filled natural rubber latex foam

    Energy Technology Data Exchange (ETDEWEB)

    Karim, Ahmad Fikri Abdul, E-mail: a.fikri-89@yahoo.com; Ariff, Zulkifli Mohamad [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, 14300 Nibong Tebal, Pulau Pinang (Malaysia); Ismail, Hanafi [Cluster for Polymer Composites (CPC), Science and Engineering Research Centre, Engineering Campus, Universiti Sains Malaysia,14300 Nibong Tebal, Pulau Pinang (Malaysia)

    2015-07-22

    This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)

  4. Mechanical and morphological properties of kenaf powder filled natural rubber latex foam

    International Nuclear Information System (INIS)

    Karim, Ahmad Fikri Abdul; Ariff, Zulkifli Mohamad; Ismail, Hanafi

    2015-01-01

    This research is carried out by incorporate kenaf powder with natural rubber latex (NRL) compound and is foamed to make natural rubber latex foam (NRLF) by using a well known technique called Dunlop method. Different loading of kenaf powder was added to NRL compound and was foamed to make NRLF. The tensile properties, and morphology of kenaf filled NRLF was studied. Increase in kenaf loading reduced the tensile strength and elongation at break and of a compound. Modulus at 100% elongation of the compound increased with increased in filler loading. The morphological and micro structural characterization has been performed by using scanning electron microscopy (SEM)

  5. Allergy to latex in health workers

    Directory of Open Access Journals (Sweden)

    Fajardo-Zapata, Álvaro L.

    2015-01-01

    Full Text Available Introduction: A common and growing problem in hospitals is hypersensitivity to rubber latex antigens, since many products, including gloves, are manufactured from this material, with the consequent possibility of producing allergy in persons who use them. Objective: To find out if health workers at a fourth level clinic in Bogotá, Colombia, are allergic to rubber latex, in relation to the use of gloves. Materials and methods: Descriptive, cross-sectional study of a non-probabilistic intentional-type sample in each one of four hospital units. A survey was applied to participants. Results: 16 of the 26 persons (61.5% with history of allergic processes manifested some kind of reaction when they had contact with latex gloves; the problem was more significant in the nursing personnel compared to physicians. Conclusions: The exposure to latex gloves may be generating the appearance of allergic occupational disease in health workers.

  6. Latex glove sensitivity amongst diagnostic imaging healthcare ...

    African Journals Online (AJOL)

    kemrilib

    Sciences, Faculty of Health Sciences and Technology, University of Nigeria, Enugu Campus, Enugu. State, Nigeria. .... Occupation. No of .... latex protein residue and act as a hapten or .... at Work Act, 1989 and the safety, Health and Welfare at.

  7. Effects of radio sensitizers in the vulcanization of natural rubber latex induced by gamma radiation

    International Nuclear Information System (INIS)

    Souza, A. de; Canavel, V.; Araujo, S.C. de; Guedes, S.M.L.

    1992-01-01

    The effect of C Cl 4 and n-butyl acrylate as a sensitizer for radiation vulcanization of 60% DRC natural rubber latex with gamma rays, was studied relating tensile strength of vulcanized latex. The vulcanization dose is 200 kGy for natural rubber latex and it decreases to 40 kGy and to 9 kGy in the presence of C Cl 4 / potassium laureate and n-butyl acrylate / t-butyl hydroperoxide, respectively. The H 2 O 2 as a co-sensitizer does not change the efficiency of the combination of these sensitizers. The IV spectra show the formation of C=O after the irradiation as consequence of oxidation reactions. (author)

  8. Trialed production of low protein irradiated natural rubber latex in factory scale by gamma irradiation technique

    International Nuclear Information System (INIS)

    Utama, Marga; Herwinarni, S.; Halik, H.M.; Siswanto; Suharyanto; Syamsu, Y.; Handoko, B.

    2006-01-01

    Four tons fresh field natural rubber latex (FNRL) with total solid content 30% were added with 2 phr (part hundred ratio of rubber) normal butyl acrylate (nBA) then irradiated by gamma rays at 25 kGy. The irradiated FNRL was centrifuged, then the properties of irradiated centrifuged natural rubber latex (INRL) and its film were measured before and after storage for 5 months. It is found that the INRL is stable latex during storage in 5 months, with lowest protein, and free nitrosamine content. The tensile strength of INRL film was 24-27 MPa, and modulus 600% was 1,5-2,0 MPa, elongation at break was 900%, and hardness was 27-29 Shore A, while the extractable protein content less than 100 μg/g. (author)

  9. Environmental conditions during breeding modify the strength of mass-dependent carry-over effects in a migratory bird.

    Directory of Open Access Journals (Sweden)

    Xavier A Harrison

    Full Text Available In many animals, processes occurring in one season carry over to influence reproductive success and survival in future seasons. The strength of such carry-over effects is unlikely to be uniform across years, yet our understanding of the processes that are capable of modifying their strength remains limited. Here we show that female light-bellied Brent geese with higher body mass prior to spring migration successfully reared more offspring during breeding, but only in years where environmental conditions during breeding were favourable. In years of bad weather during breeding, all birds suffered reduced reproductive output irrespective of pre-migration mass. Our results suggest that the magnitude of reproductive benefits gained by maximising body stores to fuel breeding fluctuates markedly among years in concert with conditions during the breeding season, as does the degree to which carry-over effects are capable of driving variance in reproductive success among individuals. Therefore while carry-over effects have considerable power to drive fitness asymmetries among individuals, our ability to interpret these effects in terms of their implications for population dynamics is dependent on knowledge of fitness determinants occurring in subsequent seasons. 

  10. [Prevention of adverse effects in latex allergic patients: organizing a latex safe operating theatre].

    Science.gov (United States)

    Bonalumi, Sabrina; Barbonaglia, Patrizia; Bertocchi, Carmen

    2006-01-01

    In 2001 the General Health Direction of Region Lombardia approved (decree n. 22303) a guideline for the prevention of latex allergic reactions in patients and health care workers. This document provides general recommendations in order to standardize behaviors in regional health care facilities. The reason is due to a rise in the incident of reactions to latex products in the last 20 years. Nowadays the prevalence is higher in certain risk groups (subjected to frequent and repeated exposures) rather than the general population. The aim of the project was to organize a latex safe operating theatre in the Ospedale Maggiore Policlinico, Mangiagalli e Regina Elena of Milan (Fondazione) and to standardize behaviors in order to prevent adverse effects in latex allergic patients. Thanks to the literature review and the creation of a multidisciplinar team, we produced a protocol. Therefore, we requested manufacturers the certification of the latex content of their products. Results and conclusion. When latex allergic patients need to undergone surgery in our hospital, a latex safe operating theatre is organized by personnel following a multidisciplinar protocol. No allergic reactions were experienced during surgical procedures after the creation of an environment as free as possible from latex contamination. The project will involve an emergency room, one room or more of a ward and of the outpatients department.

  11. Anti-ulcer activity of Synadenium grantii latex

    Directory of Open Access Journals (Sweden)

    Larissa L. G. Costa

    2012-10-01

    Full Text Available Synadenium grantii Hook f., Euphorbiaceae, is popularly known as leitosinha or janaúba. The diluted latex (18 drops/L of water is commonly used in the south of Brazil to treat gastric disturbances. This study evaluated phytochemical screening and toxicity using Artemia salina Leach of crude bark extract and also latex. The toxicity and the anti-ulcer activity of S. grantii latex were also tested in rats. Phytochemical results showed presence of tannins, terpenes, unsaponificable substances, coumarins and anthraquinones in the crude bark extract and terpenes in the latex. Gas chromatography-mass spectrometry (GC-MS analysis demonstrated the presence of diterpene tigliane esters in the latex, identified as 12-deoxyphorbol-13-(2-metilpropionate and phorbol 12,13,20-triacetate. The toxicity results using A. salina presented CL50 26.58μg/mL and CL50 778.66μg/mL, for the latex and the crude bark extract respectively. The toxicological hepatic parameters of the diluted latex were not different to the control group (p<0.05. The eosinophils cells showed an increase in both the diluted and pure latex groups. The pure latex showed gastric protection of 90% (p<0.05 and the diluted latex showed 6% compared to the negative control. Therefore, our data indicate that S. grantii latex, under research conditions presented gastric protection. Pure latex showed more toxicity than the diluted latex.

  12. Experimental study on the drying of natural latex medical gloves

    Science.gov (United States)

    Chankrachang, Mano; Yongyingsakthavorn, Pisit; Tohsan, Atitaya; Nontakaew, Udomkiat

    2018-01-01

    The purpose of this research was to study latex film drying at 70 °C using a laboratory drying oven. Two different total solid content (TSC) latex compounds, which 45% TSC and 35% TSC were used. The undried latex films were prepared according to the common procedures used in latex gloves manufacturers, that is, by dry coagulant dipping process. The experimental results such as initial moisture content, the amount of moisture and drying time of latex films in each latex compound formula were determined. After that, the results were projected to calculate on the production capacity expand by 1 million piece/day of natural latex medical gloves. Finally, the rate of moisture entering the latex drying oven and the energy consumption of the drying oven were estimated. The results indicated that when the 35% TSC of latex compound was used. The initial moisture content of latex film was higher than 45% TSC of latex compound about 7%. The drying time of 35% TSC was longer than 45% TSC for 2.5 min and consume more energy about 10%. As a result, the 45% TSC latex compound was the better way to saving energy and managing humidity in the production line. Therefore, it was found to very useful to an approximate design length and size of actual of latex drying oven and the rate of moisture entering the oven as well.

  13. Characteristics of Red Algae Bioplastics/Latex Blends under Tension

    Directory of Open Access Journals (Sweden)

    M. Nizar Machmud

    2013-10-01

    Full Text Available Cassava, corn, sago and the other food crops have been commonly used as raw materials to produce green plastics. However, plastics produced from such crops cannot be tailored to fit a particular requirement due to their poor water resistance and mechanical properties. Nowadays, researchers are hence looking to get alternative raw materials from the other sustainable resources to produce plastics. Their recent published studies have reported that marine red algae, that has been already widely used as a raw material for producing biofuels, is one of the potential algae crops that can be turned into plastics. In this work, Eucheuma Cottonii, that is one of the red alga crops, was used as raw material to produce plastics by using a filtration technique. Selected latex of Artocarpus altilis and Calostropis gigantea was separately then blended with bioplastics derived from the red algae, to replace use of glycerol as plasticizer. Role of the glycerol and the selected latex on physical and mechanical properties of the red algae bioplastics obtained under a tensile test performed at room temperature are discussed. Tensile strength of some starch-based plastics collected from some recent references is also presented in this paperDoi: 10.12777/ijse.5.2.81-88 [How to cite this article: Machmud, M.N., Fahmi, R.,  Abdullah, R., and Kokarkin, C.  (2013. Characteristics of Red Algae Bioplastics/Latex Blends under Tension. International Journal of Science and Engineering, 5(2,81-88. Doi: 10.12777/ijse.5.2.81-88

  14. Biodegradability and aging study of rubber films obtained by gamma radiation vulcanization processes of latex; Estudo da biodegradabilidade e envelhecimento de filmes de borracha obtidos por processos de vulcanizacao do latex por radiacao induzida de fonte gama

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Carlos Felipe Pinto

    2005-07-01

    The natural rubber latex (NRL) is industrially crosslinked by the conventional process of vulcanization, which uses sulphur and heat. Otherwise, the network can also be done by the alternative process with ionizing radiation. In this work the crosslinking of NRL was studied by the comparison of the conventional vulcanization system and the ionizing radiation process of {sup 60}C source. The products obtained, the irradiated latex, the irradiated latex with approximately 1% of soy lecithin and the sulphur vulcanized latex were tested by accelerated aging with ultraviolet (UV) and outdoor aging with compostage, tensile strength at break, swelling and gel fraction, fungi micro biota, scanning electron microscopy (SEM), infrared spectroscopy (FTIR) and thermogravimetry and differential scanning calorimetry analysis (TG and DSC). The results showed that the aging with microorganisms have a great influence in the physical properties of the samples. The thermal stability order observed showed that the sulphur vulcanized latex is more resistant, what is probably associated to a network more stable under the aging conditions. On the other hand, the irradiated latex showed intense biodegradation aspects, particularly with the presence of the soy lecithin. (author)

  15. Recombinant albumin monolayers on latex particles.

    Science.gov (United States)

    Sofińska, Kamila; Adamczyk, Zbigniew; Kujda, Marta; Nattich-Rak, Małgorzata

    2014-01-14

    The adsorption of recombinant human serum albumin (rHSA) on negatively charged polystyrene latex micro-particles was studied at pH 3.5 and the NaCl concentration range of 10(-3) to 0.15 M. The electrophoretic mobility of latex monotonically increased with the albumin concentration in the suspension. The coverage of adsorbed albumin was quantitatively determined using the depletion method, where the residual protein concentration was determined by electrokinetic measurements and AFM imaging. It was shown that albumin adsorption was irreversible. Its maximum coverage on latex varied between 0.7 mg m(-2) for 10(-3) M NaCl to 1.3 mg m(-2) for 0.15 M NaCl. The latter value matches the maximum coverage previously determined for human serum albumin on mica using the streaming potential method. The increase in the maximum coverage was interpreted in terms of reduced electrostatic repulsion among adsorbed molecules. These facts confirm that albumin adsorption at pH 3.5 is governed by electrostatic interactions and proceeds analogously to colloid particle deposition. The stability of albumin monolayers was measured in additional experiments where changes in the latex electrophoretic mobility and the concentration of free albumin in solutions were monitored over prolonged time periods. Based on these experimental data, a robust procedure of preparing albumin monolayers on latex particles of well-controlled coverage and molecule distribution was proposed.

  16. The Morphology of Emulsion Polymerized Latex Particles

    Science.gov (United States)

    Wignall, G. D.; Ramakrishnan, V. R.; Linne, M. A.; Klein, A.; Sperling, L. H.; Wai, M. P.; Gelman, R. A.; Fatica, M. G.; Hoerl, R. H.; Fisher, L. W.

    1987-11-01

    Under monomer starved feed conditions, emulsion polymerization of perdeuterated methyl methacrylate and styrene in the presence of preformed polymethylmethacrylate latexes resulted in particles with a core-shell morphology, as determined by small-angle neutron scattering (SANS) analysis for a hollow sphere. The locus of polymerization of the added deuterated monomer is therefore at the particle surface. In similar measurements a statistical copolymer of styrene and methyl methacrylate was used as seed particles for further polymerization of trideuteromethyl methacrylate. The resulting polymer latex was again shown to have a core-shell morphological structure as determined by SANS. SANS experiments were also undertaken on polystyrene latexes polymerized by equilibrium swelling methods, with deuterated polymer forming the first or second step. The experiments covered a molecular weight range of 6 x 10{sup 4} 10{sup 6} the molecular weights are consistent with the experimental errors, indicating that the deuterium labeled molecules are randomly distributed in the latex. These results led to the finding that the polymer chains were constrained in the latex particles by factors of 2 to 4 from the relaxed coil dimensions. For M molecules. Several models were examined, including the possible development of core-shell structures at lower molecular weights.

  17. Home Healthcare Workers: How to Prevent Latex Allergies

    Science.gov (United States)

    ... can help prevent allergic reactions for both home healthcare workers and their clients. LATEX EXPOSURE REACTIONS Three ... being used). • Inform your employer and your personal healthcare professionals that you have latex allergy. • Wear a ...

  18. Angiogenic activity of Synadenium umbellatum Pax latex

    Directory of Open Access Journals (Sweden)

    PR. Melo-Reis

    Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. Latex of this plant is used to treat various diseases such as diabetes mellitus, Hansen´s disease, tripanosomiases, leukemia and several malignant tumors. In the present study, the angiogenic activity of S. umbellatum latex was evaluated using the chick embryo chorioallantoic membrane (CAM assay. Results showed significant increase of the vascular net (p < 0.05 compared to the negative control (H2O. The histological analysis was in accordance with the results obtained. In conclusion, our data indicate that S. umbellatum latex, under the conditions of this research, presented angiogenic effect.

  19. CHARACTERIZATION AND RECYCLING OF WASTE WATER FROM GUAYULE LATEX EXTRACTION

    Science.gov (United States)

    Guayule commercialization for latex production to be used in medical products and other applications is now a reality. Currently, waste water following latex extraction is discharged into evaporation ponds. As commercialization reaches full scale, the liquid waste stream from latex extraction will b...

  20. Plant latex lipase as biocatalysts for biodiesel production | Mazou ...

    African Journals Online (AJOL)

    Plant latex lipase as biocatalysts for biodiesel production. ... This paper provides an overview regarding the main aspects of latex, such as the reactions catalyzed, physiological functions, specificities, sources and their industrial applications. Keywords: Plant latex, lipase, Transesterification, purification, biodiesel ...

  1. Thermodynamics of swelling of latex particles with two monomers

    NARCIS (Netherlands)

    Maxwell, I.A.; Kurja, J.; van Doremaele, G.H.J.; German, A.L.

    1992-01-01

    The partitioning of 2 monomers between the latex particle, monomer droplet, and aq. phases of an emulsion polymer latex are measured at satn. swelling of the latex particle phase (corresponding to intervals I and II of an emulsion polymn.). The monomer (Me acrylate, Bu acrylate, styrene) and polymer

  2. Smart cement modified with iron oxide nanoparticles to enhance the piezoresistive behavior and compressive strength for oil well applications

    International Nuclear Information System (INIS)

    Vipulanandan, C; Mohammed, A

    2015-01-01

    In this study, smart cement with a 0.38 water-to-cement ratio was modified with iron oxide nanoparticles (NanoFe 2 O 3 ) to have better sensing properties, so that the behavior can be monitored at various stages of construction and during the service life of wells. A series of experiments evaluated the piezoresistive smart cement behavior with and without NanoFe 2 O 3 in order to identify the most reliable sensing properties that can also be relatively easily monitored. Tests were performed on the smart cement from the time of mixing to a hardened state behavior. When oil well cement (Class H) was modified with 0.1% of conductive filler, the piezoresistive behavior of the hardened smart cement was substantially improved without affecting the setting properties of the cement. During the initial setting the electrical resistivity changed with time based on the amount of NanoFe 2 O 3 used to modify the smart oil well cement. A new quantification concept has been developed to characterize the smart cement curing based on electrical resistivity changes in the first 24 h of curing. Addition of 1% NanoFe 2 O 3 increased the compressive strength of the smart cement by 26% and 40% after 1 day and 28 days of curing respectively. The modulus of elasticity of the smart cement increased with the addition of 1% NanoFe 2 O 3 by 29% and 28% after 1 day and 28 days of curing respectively. A nonlinear curing model was used to predict the changes in electrical resistivity with curing time. The piezoresistivity of smart cement with NanoFe 2 O 3 was over 750 times higher than the unmodified cement depending on the curing time and nanoparticle content. Also the nonlinear stress–strain and stress–change in resistivity relationships predicated the experimental results very well. Effects of curing time and NanoFe 2 O 3 content on the model parameters have been quantified using a nonlinear model. (paper)

  3. Effect of Copolymer Latexes on Physicomechanical Properties of Mortar Containing High Volume Fly Ash as a Replacement Material of Cement

    Directory of Open Access Journals (Sweden)

    El-Sayed Negim

    2014-01-01

    Full Text Available This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA as partial replacement of cement in presence of copolymer latexes. Portland cement (PC was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA and 2-hydroxymethylacrylate (2-HEMA. Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM. The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.

  4. Effect of copolymer latexes on physicomechanical properties of mortar containing high volume fly ash as a replacement material of cement.

    Science.gov (United States)

    Negim, El-Sayed; Kozhamzharova, Latipa; Gulzhakhan, Yeligbayeva; Khatib, Jamal; Bekbayeva, Lyazzat; Williams, Craig

    2014-01-01

    This paper investigates the physicomechanical properties of mortar containing high volume of fly ash (FA) as partial replacement of cement in presence of copolymer latexes. Portland cement (PC) was partially replaced with 0, 10, 20, 30 50, and 60% FA. Copolymer latexes were used based on 2-hydroxyethyl acrylate (2-HEA) and 2-hydroxymethylacrylate (2-HEMA). Testing included workability, setting time, absorption, chemically combined water content, compressive strength, and scanning electron microscopy (SEM). The addition of FA to mortar as replacement of PC affected the physicomechanical properties of mortar. As the content of FA in the concrete increased, the setting times (initial and final) were elongated. The results obtained at 28 days of curing indicate that the maximum properties of mortar occur at around 30% FA. Beyond 30% FA the properties of mortar reduce and at 60% FA the properties of mortar are lower than those of the reference mortar without FA. However, the addition of polymer latexes into mortar containing FA improved most of the physicomechanical properties of mortar at all curing times. Compressive strength, combined water, and workability of mortar containing FA premixed with latexes are higher than those of mortar containing FA without latexes.

  5. Fresh and Hardened State of Polymer Modified Concrete and Mortars – A Review

    Directory of Open Access Journals (Sweden)

    Tukimat Nurul Nadrah Aqilah

    2017-01-01

    Full Text Available Polymer modified concrete or mortar is an alternative to the advancement of long serving civil engineering material - mortar and concrete. The excellence and promising benefits of modified composites have led to numerous progressive studies of its application. This paper presented a critical review from previous research on the polymer modified concrete and mortar. Both fresh and hardened state behaviours were reviewed as they are important for the development of excellent engineering material. Most of the applications of polymer modified concrete and mortar can be seen in diverse types of polymer such as latex, epoxy and emulsion. The utilization of each type of polymers resulted in different characteristics of composite concrete or mortar. Such applications have contributed to the improvement in terms of workability and mechanical strength, especially at higher grade of composite strength of concrete material.

  6. Pilot Scale Production of Irradiated Natural Rubber Latex and its Dipping Products

    Directory of Open Access Journals (Sweden)

    M. Utama

    2005-07-01

    Full Text Available One hundred and fifty kg natural rubber latex (NRL before and after concentration were added with 3 phr (part hundred ratio of rubber normal butyl acrylate, then the mixture were irradiated at 25 kGy by gamma rays of 60Co in pilot scale. The irradiated natural rubber latex (INRL were then being to use for producing rubber products such as condom, surgical gloves, and spygmomanometer in factory scale. The quality of INRL and rubber products such as : total solid content (TSC, dry rubber content (DRC, KOH, VFA and MST number, tensile strength, modulus, elongation at break, extractable protein content, and response against Type I allergy etc. were evaluated. The economic aspect for producing INRL by means of Gamma Irradiator (GI and Electron Beam Machine (EBM such as payback period (PP, net present value (NPV and internal rate return (IRR were calculated. The results showed that the latex properties of INRL such as DRC, TSC, KOH, VFA, and MST number are not only found to the requirement of the ISO 2004 standard but also the latex has low protein, lipid, and carbohydrate content. The physical and mechanical properties (tensile strength, modulus, and elongation at break of rubber dipping products such as condom, gloves, and sphygmomanometer are not only found to the requirement of ISO 4074, ISO 10282, and ANSI/AAMI SP-1994 standards, but also the allergic response tested clinical latex-sensitive protein allergen by ELISA test on gloves, and by SPT test on condom are found to be negative. It indicates that production of INRL or PVNRL or RVNRL by EBM 250 keV/10 mA, was more cheap than by using gamma γ irradiator 200 kCi, or sulfur vulcanization. The value of PBP (payback period was 2,1 years, NPV (net present value was 4,250 US $, PI (profitability index 1,06 and IRR (internal rate of returns was 25,0%.

  7. Emotion with tears decreases allergic responses to latex in atopic eczema patients with latex allergy.

    Science.gov (United States)

    Kimata, Hajime

    2006-07-01

    Allergic responses are enhanced by stress, whereas they are reduced by laughter in atopic eczema patients. Emotion with tears decreases plasma IL-6 levels in patients with rheumatoid arthritis. Thus, the effect of emotion with tears on allergic responses in patients with atopic eczema was studied. Sixty patients with atopic eczema having latex allergy viewed both the weather information video and the heart-warming movie, Kramer vs. Kramer. Just before and immediately after viewing each video, allergic responses to latex were measured. Viewing the weather information video did not cause emotion with tears in any patients, and it failed to modulate allergic responses. In contrast, viewing Kramer vs. Kramer caused emotion with tears in 44 of 60 patients, and it reduced allergic skin wheal responses to latex and latex-specific IgE production in them. Emotion with tears reduced allergic responses, and it may be useful in the treatment of allergic diseases.

  8. Preparation of highly stabilised natural rubber latex for radiation vulcanisation

    International Nuclear Information System (INIS)

    Kulatunge, S.S.; Nadarajah, M.; Kalyani, N.M.V.; Chandralal, H.N.K.K.; Devendra, R.

    1996-01-01

    There is a bright future for radiation vulcanised natural rubber latex (RVNRL) but there are problems in manufacturing it as the centrifuged latex to be used for radiation has to be kept for at least a month or sometimes even three to six months before adding the sensitisers and even then the latex sometimes coagulates on adding the sensitisers. This paper describes a process by which the latex can be stabilised by addition of an anionic soap before centrifuging so that it has a high mechanical stability and hence can be used even within one week of the manufacture of the centrifuged latex

  9. Exploring Polymer-Modified Concrete and Cementitious Coating with High-Durability for Roadside Structures in Xinjiang, China

    Directory of Open Access Journals (Sweden)

    Yinchuan Guo

    2017-01-01

    Full Text Available The concrete roadside structures in Xinjiang, China, such as roadside barriers, bridge rails, and drainage holes, are severely damaged by the coupled effect of seasonal freeze-thaw cycles and deicer salts. To solve the corrosion problems of roadside structures, polymer-modified concrete was recommended for the future construction of roadside structures and polymer-modified cementitious coating was suggested for the protection of the current corroded ones. In this study, air-entraining agent and carboxylated styrene-butadiene latex were added for concrete modification and the corresponding performance tests were conducted. In addition, the performances of six types of readily available coating materials, including the acrylic latex modified cementitious coating designed in this study, were tested in freeze-thaw condition with the presence of chloride ions. The results show that 0.013% of the air-entraining agent and 10% of the carboxylated styrene-butadiene latex were appropriate dosage rates for the modification of Portland cement concrete, in terms of the improvement of the freeze-thaw resistance, compressive strength, and chloride impermeability. For the protection of the current corroded roadside structures, the acrylic-modified cementitious coating material demonstrated a good performance and the field monitoring confirmed that the coating is suitable for the protection of the roadside structures in Xinjiang.

  10. CHEMICAL EXAMINATION OF JACK TREE LATEX AND

    Indian Academy of Sciences (India)

    and on Saponification yielded fatty acids, Volatile as well as non-volatile. The unsaponifiable portion on repeated crystallisation provided a crystal- line, sharp melting compound which was identified as artostenone? from a. Latex (200 c.c.). ത്ത min- pe. Coagulum (A) Aqueous alcoholic solution (B). Acetone or ethyl acetate ...

  11. Application of recombinant latex allergens in diagnostics of occupational latex allergy

    Directory of Open Access Journals (Sweden)

    Ewa Nowakowska-Świrta

    2015-02-01

    Full Text Available Over many years, allergy to natural rubber latex has been a major problem among health care workers (HCW. The diagnosis of occupational allergy requires methods of high diagnostic accuracy in view of certification implications (e.g., a sick worker quits a job. With the development of molecular methods, the frequency of application of recombinant allergens in the diagnostics of allergic diseases continues to increase. This paper reviews the applicability of laboratory tests which use recombinant allergens in the diagnostics of occupational allergy. The diagnosis of latex allergy is based on the presence of clinical symptoms linked with exposure to latex allergens, positive skin prick tests and detection of specific IgE antibodies to latex in serum. Moreover, in some cases specific challenge tests are conducted. The analysis of literature indicates that applying the panel of recombinant latex allergens in diagnostic tests, cross-reactivity can very likely be excluded and/or sensitization can be confirmed without the need for specific challenge tests, which in case of latex allergens carries a potential risk of generalized reactions. Med Pr 2015;66(1:85–97

  12. The effect of emulsifier on the stability of irradiated LA-TZ latex

    International Nuclear Information System (INIS)

    Made Sumarti K; Utama, Marga; Puspitasari, Tita

    1998-01-01

    The effect of six kinds of stabilizer on the stability of the concentrated LA-TZ latex which contains n-BA have been studied. The six stabilizers are: 1. Naphthalene sulfonic acid formaldehyde condensate, 2. Sodium dialkyl sulfosuccinate, 3. Triethanol amine lauryl sulfate, 4. Sodium polyoxyethylene alkyl phenol ether sulfate, 5. Dodecyl benzene sulfonic acid (Neopelex FS), and 6. Ammonium laurat. The concentrations of the stabilizers are in the range of 0,1 to 0,3% and of the n-BA is 5phr (per hundred rubber). The field natural rubber latex was stabilized by Tetramethyl tiuram disulfide - Zine oxide (TMTD-ZnO) and ammonium gas, and was concentrated by centrifuge. The obtain concentrated LA-TZ latex was added by the n-BA and was kept with various storage time i.e. o, 2, 4, 6, 18, and 24 hours. It was found that the stable latex was irradiated by 15 kGy dose and the physical properties was tested, then the maximum tensile strength of 223,3 kg/cm 2 was found on Neopelex FS concentrate at 0,1%. (authors)

  13. Radiation vulcanization of natural rubber latex with low energy accelerator-II

    Energy Technology Data Exchange (ETDEWEB)

    Haque, Md. Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume, Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Dept. of Biological and Chemical Engineering, Kiryu, Gunma (Japan)

    2002-03-01

    The natural rubber latex (NRL) was radiation vulcanized under a low energy electron accelerator. Accelerating voltage and maximum beam current of this accelerator are 250 kV and 10 mA respectively. Irradiation was carried out in a reaction vessel with constant stirring. The capacity of the vessel is 18 liters. Radiation vulcanization accelerators (RVA) were normal butyl acrylate (n-BA) and nonane-diol-diacrylate (NDDA). NDDA has no bad smell like that of n-BA. 20 minutes irradiation time is enough to vulcanize 14 liters of latex when 5 phr RVA (both types) are used. Maximum of {approx}30 MPa tensile strength was obtained with 5 phr NDD-A. However the remained NDDA is difficult to remove due to high molecular weight. Water-extractable proteins content was determined in dipped films for various leaching conditions without and with additive (polyvinyl alcohol, PVA). Water extractable proteins content is reduced to {<=} 41 by adding 5 phr PVA and leaching for 8 hours. The tackiness of the dipped films is reduced to 0.1 from 9 gf by mixing 6 phr PVA with the irradiated latex. Hand gloves (surgical and examination) were successfully produced from the irradiated latex. (author)

  14. Study on grafting of monomer onto natural rubber latex by radiation technique

    International Nuclear Information System (INIS)

    Nguyen Tan Man; Le Hai; Tran Thi Tam; Le Huu Tu, Pham Thi Sam; Dao Minh Phuong; Ha Thuc Huy

    2004-01-01

    Radiation vulcanization of natural rubber latex has been extensively developed through programmers assisted by the IAEA and UNDP under RCA in Asia and Pacific Region. R-D has been done in most of the Member States with technical assistance from Japan's Takasaki Radiation Chemistry Establishment. Radiation vulcanized natural rubber latex (RVNRL) has many advantages over the conventional sulfur vulcanized latex, such as absence of nitrosamine and low cytotoxicity. Radiation crosslinking is a room temperature process, itself an important cost advantage, it is easily controlled and desired extend of crosslinking is easily achieved by controlling the dose (irradiation time). Disadvantages of RVNRL to be improved are poor physical properties of film such as low tensile strength and tear strength. The research groups of Japan, Thailand and Indonesia concentrated on the improvement of physical properties of RVNRL using radiation grafted PMMA as additive [2]. F. Sundardi and W. Sofiarti have reported that tensile strength and hardness increased by radiation grafting of styrene onto NR [5]. Ono et al have reported the grafting of MMA onto NR by gamma irradiation at a dose of 5 kGy for producing thermoplastic elastomers [4]. The objective of this project is to report the results of studies of radiation graft-copolymerization of methyl methacrylate (MMA) or styrene (St) onto natural rubber latex in order to improve their physico-mechanical properties and evaluation of grafted material using Small-Angle Neutron Scattering through FNCA Project. The grafting degree of MMA and St onto NR increased with the increase of irradiation dose and monomer concentration. The alteration of grafted products structure was determined by IR method. Tensile strength, Shore A hardness, 100% modulus of grafted products increased with the increase of monomer concentration and irradiation dose while elongation at break decreased. The grafted products were characterized by Transmission Electron

  15. Dynamics of polyelectrolyte adsorption and colloidal flocculation upon mixing studied using mono-dispersed polystyrene latex particles

    NARCIS (Netherlands)

    Feng, Lili; Cohen Stuart, Martien; Adachi, Yasuhisa

    2015-01-01

    The dynamic behavior of polyelectrolytes just after their encounter with the surface of bare colloidal particles is analyzed, using the flocculation properties of mono-dispersed polystyrene latex (PSL) particles. Applying a Standardized Colloid Mixing (SCM) approach, effects of ionic strength and

  16. Bond strength of resin modified glass ionomer cement to primary dentin after cutting with different bur types and dentin conditioning

    Directory of Open Access Journals (Sweden)

    Rebeca Di Nicoló

    2007-10-01

    Full Text Available The aim of this in vitro study was to evaluate the effect of different bur types and acid etching protocols on the shear bond strength (SBS of a resin modified glass ionomer cement (RM-GIC to primary dentin. Forty-eight clinically sound human primary molars were selected and randomly assigned to four groups (n=12. In G1, the lingual surface of the teeth was cut with a carbide bur until a 2.0-mm-diameter dentin area was exposed, followed by the application of RM-GIC (Vitremer - 3M/ESPE prepared according to the manufacturer's instructions. The specimens of G2, received the same treatment of G1, however the dentin was conditioned with phosphoric acid. In groups G3 and G4 the same procedures of G1 and G2 were conducted respectively, nevertheless dentin cutting was made with a diamond bur. The specimens were stored in distilled water at 37ºC for 24h, and then tested in a universal testing machine. SBS. data were submitted to 2-way ANOVA (= 5% and indicated that SBS values of RM-GIC bonded to primary dentin cut with different burs were not statistically different, but the specimens that were conditioned with phosphoric acid presented SBS values significantly higher that those without conditioning. To observe micromorphologic characteristics of the effects of dentin surface cut by diamond or carbide rotary instruments and conditioners treatment, some specimens were examined by scanning electron microscopy. Smear layer was present in all specimens regardless of the type of rotary instrument used for dentin cutting, and specimens etched with phosphoric acid presented more effective removal of smear layer. It was concluded that SBS of a RM-GIC to primary dentin was affected by the acid conditioning but the bur type had no influence.

  17. Triterpenoid biosynthesis in Euphorbia lathyris latex

    International Nuclear Information System (INIS)

    Hawkins, D.R.

    1987-11-01

    The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I 50 concentration of 3.2 μM. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I 50 of 4 μM. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4- 3 H-mevalonic acid and incubating latex with a mixture of this and 14 C-mevalonic acid. From the 3 H/ 14 C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs

  18. Triterpenoid biosynthesis in Euphorbia lathyris latex

    Energy Technology Data Exchange (ETDEWEB)

    Hawkins, D.R.

    1987-11-01

    The structures of triterpenols, not previously been known, from Euphorbia lathyris latex are reported. A method for quantifying very small amounts of these compounds was developed. Concerning the biochemistry of the latex, no exogenous cofactors were required for the biosynthesis and the addition of compounds such as NADPAH and ATP do not stimulate the biosynthesis. The addition of DTE or a similar anti-oxidant was found to help reduce the oxidation of the latex, thus increasing the length of time that the latex remains active. The requirement of a divalent cation and the preference for Mn in the pellet was observed. The effect of several inhibitors on the biosynthesis of the triterpenoids was examined. Mevinolin was found to inhibit the biosynthesis of the triterpenoids from acetate, but not mevalonate. A dixon plot of the inhibition of acetate incorporation showed an I/sub 50/ concentration of 3.2 ..mu..M. Fenpropimorph was found to have little or no effect on the biosynthesis. Tridemorph was found to inhibit the biosynthesis of all of the triterpenoids with an I/sub 50/ of 4 ..mu..M. It was also observed that the cyclopropyl containing triterpenols, cycloartenol and 24-methylenecycloartenol were inhibited much more strongly than those containing an 8-9 double bond, lanosterol and 24-methylenelanosterol. The evidence indicates, but does not definetely prove, that lanosterol and 24-methylenelanosterol are not made from cycloartenol and 24-methylenecycloartenol via a ring-opening enzyme such as cycloeucalenol-obtusifoliol isomerase. The possibilty that cycloartenol is made via lanosterol was investigated by synthesizing 4-R-4-/sup 3/H-mevalonic acid and incubating latex with a mixture of this and /sup 14/C-mevalonic acid. From the /sup 3/H//sup 14/C ratio it was shown that cycloartenol and 24-methylenecycloartenol are not made via an intermediate containing as 8-9 double bond. 88 refs., 15 figs., 30 tabs.

  19. Deposition kinetics of quantum dots and polystyrene latex nanoparticles onto alumina: role of water chemistry and particle coating.

    Science.gov (United States)

    Quevedo, Ivan R; Olsson, Adam L J; Tufenkji, Nathalie

    2013-03-05

    A clear understanding of the factors controlling the deposition behavior of engineered nanoparticles (ENPs), such as quantum dots (QDs), is necessary for predicting their transport and fate in natural subsurface environments and in water filtration processes. A quartz crystal microbalance with dissipation monitoring (QCM-D) was used to study the effect of particle surface coatings and water chemistry on the deposition of commercial QDs onto Al2O3. Two carboxylated QDs (CdSe and CdTe) with different surface coatings were compared with two model nanoparticles: sulfate-functionalized (sPL) and carboxyl-modified (cPL) polystyrene latex. Deposition rates were assessed over a range of ionic strengths (IS) in simple electrolyte (KCl) and in electrolyte supplemented with two organic molecules found in natural waters; namely, humic acid and rhamnolipid. The Al2O3 collector used here is selected to be representative of oxide patches found on the surface of aquifer or filter grains. Deposition studies showed that ENP deposition rates on bare Al2O3 generally decreased with increasing salt concentration, with the exception of the polyacrylic-acid (PAA) coated CdTe QD which exhibited unique deposition behavior due to changes in the conformation of the PAA coating. QD deposition rates on bare Al2O3 were approximately 1 order of magnitude lower than those of the polystyrene latex nanoparticles, likely as a result of steric stabilization imparted by the QD surface coatings. Adsorption of humic acid or rhamnolipid on the Al2O3 surface resulted in charge reversal of the collector and subsequent reduction in the deposition rates of all ENPs. Moreover, the ratio of the two QCM-D output parameters, frequency and dissipation, revealed key structural information of the ENP-collector interface; namely, on bare Al2O3, the latex particles were rigidly attached as compared to the more loosely attached QDs. This study emphasizes the importance of considering the nature of ENP coatings as well

  20. Safety Evaluation Test on Human for Radiation Pre vulcanised Natural Rubber Latex (RVNRL)

    International Nuclear Information System (INIS)

    Pairu Ibrahim; Wan Manshol Wan Zain; Chai, Chee Keong; Sofian Ibrahim; Saadiah Sulaiman; Sharifah Ismail

    2010-01-01

    This paper discussed about clinical test conducted to determine safety evaluations on human for latex examination gloves and latex films made from Radiation Vulcanized Natural Rubber Latex (RVNRL). Two types of test were being adopted which are i) Modified Draize-95 test and ii) Patch Test on Sensitized Individuals. Modified Draize-95 test was conducted on 200 non-sensitized human subjects and Patch Test on Sensitized Individuals was conducted on 25 individuals who are allergic to the defined major chemical sensitizer presents in natural rubber product. It was found that Modified Draize-95 test has prove that there is no clinical evidence on the presence of residual chemical additives at the level that may induce Type IV allergy in the un sensitized general user population in the RVNRL gloves. Meanwhile Patch Test on Sensitized Individuals has proved that the patch test conducted using the test article on 25 individuals who are allergic to the defined major chemical sensitizers present in natural rubber products, thiuram, carbamates or thiazoles produced a negative response, meeting the pre requirement for the claim of reduced reaction-inducing potential. (author)

  1. Does modifying the particle size distribution of a granular material (i.e., material scalping alters its shear strength?

    Directory of Open Access Journals (Sweden)

    Azéma Emilien

    2017-01-01

    Full Text Available By means of two dimensional contact dynamics simulations, we analyzed the effect of the particle size distribution (PSD on the shear strength of granular materials composed of un-breakable disks. We modelled PSDs with a normalized beta function, which allows for building S-shaped gradation curves, such as those that typically occur in soils. We systematically controlled and varied the size span and the shape of the PSD, and found that the shear strength is independent both characteristics. This implies that PSD modification procedures such as material scalping (i.e., removing the smallest and/or largest particles in the sample should not affect significantly the shear strength of the material composed of unbreakable discs. In order to explore the origins of the invariance of the shear strength with PSD, we analyzed the connectivity, force transmission, and friction mobilization in terms of anisotropies, finding that the constant shear strength is due to a subtle compensation of anisotropies.

  2. The effect of salivary pH on diametral tensile strength of resin modified glass ionomer cement coated with coating agent

    Science.gov (United States)

    Ismayanti, D.; Triaminingsih, S.; Eriwati, Y. K.

    2017-08-01

    The aim of this study was to evaluate the effect of artificial saliva with different acidities on the diametral tensile strength of Resin Modified Glass Ionomer Cement (RMGIC) coated with varnish and nanofilled coating agent. The specimens coated with coating agents were immersed in artificial saliva with pH of 4.5, 5.5, and 7 for 24 hours in an incubatorat 37°C. The diametral tensile strength of the specimens was tested with Universal Testing Machine. There were no significant differences on the diametral tensile strength of all specimens that were put into groups based on the acidity of the saliva and the type of coating agent (p>0.05). Both varnish and nanofilled coating agent stayed on the RMGIC in the acidic condition that simulated the true condition of oral cavity in people with high caries risk for the 24 hours of maturation.

  3. Microchip capillary gel electrophoresis using programmed field strength gradients for the ultra-fast analysis of genetically modified organisms in soybeans.

    Science.gov (United States)

    Kim, Yun-Jeong; Chae, Joon-Seok; Chang, Jun Keun; Kang, Seong Ho

    2005-08-12

    We have developed a novel method for the ultra-fast analysis of genetically modified organisms (GMOs) in soybeans by microchip capillary gel electrophoresis (MCGE) using programmed field strength gradients (PFSG) in a conventional glass double-T microchip. Under the programmed electric field strength and 0.3% poly(ethylene oxide) sieving matrix, the GMO in soybeans was analyzed within only 11 s of the microchip. The MCGE-PFSG method was a program that changes the electric field strength during GMO analysis, and was also applied to the ultra-fast analysis of PCR products. Compared to MCGE using a conventional and constantly applied electric field, the MCGE-PFSG analysis generated faster results without the loss of resolving power and reproducibility for specific DNA fragments (100- and 250-bp DNA) of GM-soybeans. The MCGE-PFSG technique may prove to be a new tool in the GMO analysis due to its speed, simplicity, and high efficiency.

  4. Effect of Antioxidants on Radiation Vulcanization Natural Rubber Latex (RVNRL) Film

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Muhammad Saiful Omar

    2015-01-01

    This paper presents the results on the effects of different antioxidants used in Radiation Vulcanization Natural Rubber Latex (RVNRL)) films between 0 to 10 weeks monitoring. Antioxidants used for the RVNRL formulation were Aquanox LP, Irganox and Wingstay L. Color difference evaluation by using Chroma Meter CR-400 found that RVNRL film with Irganox was the most stained yellowish after 8 weeks monitoring. Tensile strength for RVNRL with Aquanox found achieved the optimum strength between 25.4 to 27.13 mPa. The scanner electron microscopic (SEM) indicated more Aquanox molecules to penetrate and interact with the rubber molecule, thus becoming more effective inhibitor against its oxidative ageing. (author)

  5. Cement-latex grouting mortar for cementing boreholes

    Energy Technology Data Exchange (ETDEWEB)

    Kateev, I S; Golyshkina, L A; Gorbunova, I V; Kurochkin, B M; Vakula, Ya V

    1980-01-01

    The need for the development of cement-latex grouting mortar for the purpose of separating strata when reinforcing boreholes at deposits in the Tatar Associated SSR is evaluated. Results of studies of the physical and mechanical properties of cement-latex grouting mortar systems (mortar plus brick) are presented. Formulas for preparing cement-latex grouting mortor are evaluated and results of industrial tests of such mortars shown.

  6. n-BA/KOH/t-BHP behaviour in the natural rubber latex vulcanization by gamma rays

    International Nuclear Information System (INIS)

    Souza, A. de.

    1994-01-01

    Natural rubber latex was vulcanized in the absence and in the presence of sensitizer (S), with gamma ray from 60 Co source, panoramic type, at the dose rate range of 1,20-1,33 kGy/h. The components of used S were n-butyl acrylate (n-BA), the KOH as stabilizer and t-butyl hydroperoxide (t-BHP) as co-S. The purpose of this work was to study the efficiency and the behaviour of each component of S in the irradiated latex crosslinking by tensile strength (T b ), volume fraction and permanent set. In the absence of S occur straight crosslinking between macromolecular adjacent radicals. IN the presence of S, the n-BA participates in the crosslinking through acrylic bridges between macromolecules. (author)

  7. The effect of proteins on the aging properties of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Abad, L.V.

    1993-01-01

    The effect of natural rubber latex (NRL) proteins on the aging properties of NRL films was investigated. SDS-PAGE electrophoresis of the rubber proteins in NRL (Sri-Lanka) indicated a total of 18 proteins. A sharp decrease in tensile strength was observed after aging when NRL films were leached in 1% NH 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleashed samples. Electrophoretic analysis of the proteins present in the NH 3 extracts of leached RVNRL films showed a high concentration of the protein herein. This protein was not found in the NH 3 extracts of ethanol soaked films. NRL proteins were shown to decelerate the aging process of Radiation Vulcanized Natural Rubber Latex (RVNRL) films. Among the proteins, herein exhibited good anti-aging properties. The hydrolyzates from NR proteins also enhanced considerably the aging properties of RVNRL. (auth.). 8 refs.; 40 figs.; 30 tabs

  8. The role of proteins on the thermal oxidative aging of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Abad, L.V.; Rosa, A. de la; Keizo Makuuchi; Fumio Yoshii

    1996-01-01

    The effect of Hevea latex proteins on the aging properties of radiation vulcanized natural rubber latex (RVNRL) was investigated. Unpurified RVNRL films exhibited better aging properties than the purified RVNRL films. A sharp decrease in tensile strength was observed after aging when RVNRL films were leached in 1% NH sub 4 OH. However, when these films were soaked in ethanol prior to leaching, the aging properties approximated those of the unleached samples. Kjeldahl and FT-IR analyses of the leached and unleached RVNRL films indicated a higher protein content for both the unleached and ethanol-soaked films than for leached films. Electrophoretic analysis of the proteins present in the NH, extracts of leached RVNRL films showed a high concentration of hevein. This protein was not found in the ATH, extracts of ethanol soaked films. Hevein was shown to improve the aging properties of RVNRL

  9. Effect of Amphiphilic Alkyl Chain Length Upon Purified LATEX Stability

    International Nuclear Information System (INIS)

    Amira Amir Hassan; Amir Hashim Mohd Yatim

    2015-01-01

    Rubber particles in purified latex (PL) are stabilized by a film of protein and fatty acid soap (surfactant). Saturated straight-chain fatty acid soaps can assist an enhancement of latex stability. However, whether the alkyl chain length plays an important role in increasing the stability is still an issue. The aim of this study is to investigate the effect of alkyl chain length of anionic surfactant on the stability of purified latex. The fatty acid soap of decanoate (9), laurate (11), sodium dodecyl sulphate (SDS) (12) and palmitate (15) were used. The numbers in parentheses indicating the number of carbon present in alkyl chain of the soap. The results showed that the impact of alkyl chain length on the stability of latex is in the order of laurate > decanoate > SDS > palmitate > purified latex accordingly. The alkyl chain length does giving a significant effect on latex stability after longer stirring time. The particle size of latex with the presence of surfactant is greater compare to a single particle itself due to extension of particles diameter. Thus suitable interaction of the nonpolar tail of surfactant with the hydrophobic regions of latex surface played a major role in maintaining a stable latex system. (author)

  10. Content of Asthmagen Natural Rubber Latex Allergens in Commercial Disposable Gloves.

    Science.gov (United States)

    Bittner, C; Garrido, M V; Krach, L H; Harth, V

    The use of natural rubber latex (NRL) gloves in many occupations may lead to latex sensitization, allergic asthma, and skin reactions. Due to their good properties and environmental safety NRL gloves are still being used in the healthcare setting, but also in the food industry, by hairdressers, cleaners, etc. The aim of our study was to assess the protein and NRL allergen content in commercial gloves by different methods, including a new assay. Twenty commercially available NRL gloves were analyzed. Protein extraction was performed according to the international standard ASTM D-5712. Total protein content was measured with a modified Lowry method, NRL content with the CAP Inhibition Assay, the Beezhold ELISA Inhibition Assay, and an innovative ELISA with IgY-antibodies extracted from eggs of NRL-immunized hens (IgY Inhibition Assay). We found a high protein content in a range of 215.0-1304.7 μg/g in 8 out of the 20 NRL gloves. Seven of the 20 gloves were powdered, four of them with a high protein content. In gloves with high protein content, the immunological tests detected congruently high levels of NRL allergen. We conclude that a high percentage of commercially available NRL gloves still represent a risk for NRL allergy, including asthma. The modified Lowry Method allows to infer on the latex allergen content.

  11. Gloves against mineral oils and mechanical hazards: composites of carboxylated acrylonitrile-butadiene rubber latex.

    Science.gov (United States)

    Krzemińska, Sylwia; Rzymski, Władysław M; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz

    2016-09-01

    Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile-butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves.

  12. Gloves against mineral oils and mechanical hazards: composites of carboxylated acrylonitrile–butadiene rubber latex

    Science.gov (United States)

    Krzemińska, Sylwia; Rzymski, Władysław M.; Malesa, Monika; Borkowska, Urszula; Oleksy, Mariusz

    2016-01-01

    Resistance to permeation of noxious chemical substances should be accompanied by resistance to mechanical factors because the glove material may be torn, cut or punctured in the workplace. This study reports on glove materials, protecting against mineral oils and mechanical hazards, made of carboxylated acrylonitrile–butadiene rubber (XNBR) latex. The obtained materials were characterized by a very high resistance of the produced materials to oil permeation (breakthrough time > 480 min). The mechanical properties, and especially tear resistance, of the studied materials were improved after the addition of modified bentonite (nanofiller) to the XNBR latex mixture. The nanocomposite meets the requirements in terms of parameters characterizing tear, abrasion, cut and puncture resistance. Therefore, the developed material may be used for the production of multifunctional protective gloves. PMID:26757889

  13. Follow-up Study of Latex-allergic Health Care Workers in Japan

    Directory of Open Access Journals (Sweden)

    Akiko Yagami

    2006-01-01

    Conclusions: After avoiding latex products and following our educational suggestions, the patients' allergy symptoms had generally improved. This indicates that our countermeasures against latex allergy were largely successful.

  14. [Latex allergy in a paediatric hospital. Characteristics and risk factors].

    Science.gov (United States)

    Bailey, Michael; Norambuena, Ximena; Roizen, Gigia; Rodríguez, Jorge; Quezada, Arnoldo

    The prevalence of latex sensitisation varies according to the population studied. There are various risk factors that increase latex sensitisation, such as genetic risk, atopy, and multiple surgeries. To characterise patients referred to an Immunology Unit with suspected latex allergy, and to analyse their clinical features and risk factors. A retrospective, descriptive study was conducted on children suspected of latex allergy. Their medical records were reviewed in order to assess symptoms with contact or exposure to latex materials. Known risk factors to latex sensitisation, such as pathologies requiring repeated surgery (spina bifida, myelomeningocele, scoliosis and nephro-urological alterations), atopy (rhinitis, asthma, atopic dermatitis) were investigated. A prick test and/or specific IgE to latex were also performed. A multivariate logistic regression model was performed to find associations between symptoms triggered by exposure to latex with underlying diseases and other risk conditions. A total of 106 patients were enrolled in the study, of whom 50 were evaluable. At diagnosis 96% of patients were older than five years. Most of the risk factors described were observable in these patients, such as multiple surgeries, neurological and nephro-urological malformations, surgery before one year-old, and repeated bladder catheterisation. After latex exposure, mucous cutaneous manifestations were the most common (52%), followed by respiratory symptoms (36%). All patients were sensitised and allergic to latex. Latex allergy is a significant problem in children with risk factors. The results shown in this study raise important challenges for preventive measures and awareness. Copyright © 2016 Sociedad Chilena de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.

  15. Push-out bond strength of fiber posts to root dentin using glass ionomer and resin modified glass ionomer cements

    Directory of Open Access Journals (Sweden)

    Jefferson Ricardo PEREIRA

    2014-10-01

    Full Text Available OBJECTIVE: The purpose of this study was to assess the push-out bond strength of glass fiber posts to root dentin after cementation with glass ionomer (GICs and resinmodified glass ionomer cements (RMGICs. MATERIAL AND METHODS: Fifty human maxillary canines were transversally sectioned at 15 mm from the apex. Canals were prepared with a step back technique until the application of a #55 K-file and filled. Post spaces were prepared and specimens were divided into five groups according to the cement used for post cementation: Luting & Lining Cement; Fuji II LC Improved; RelyX Luting; Ketac Cem; and Ionoseal. After cementation of the glass fiber posts, all roots were stored at 100% humidity until testing. For push-out test, 1-mm thick slices were produced. The push-out test was performed in a universal testing machine at a crosshead speed of 0.5 mm/minute and the values (MPa were analyzed by Kolmogorov-Smirnov and Levene's tests and by two-way ANOVA and Tukey's post hoc test at a significance level of 5%. RESULTS: Fiber posts cemented using Luting & Lining Cement, Fuji II LC Improved, and Ketac Cem presented the highest bond strength to root dentin, followed by RelyX Luting. Ionoseal presented the lowest bond strength values (P>0.05. The post level did not influence the bond strength of fiber posts to root dentin (P=0.148. The major cause of failure was cohesive at the cement for all GICs and RMGICs. CONCLUSIONS: Except for Ionoseal, all cements provided satisfactory bond strength values.

  16. NMR relaxation times of natural rubber latex

    International Nuclear Information System (INIS)

    Harun, S.; Aziz, H.; Basir, Z.

    1994-01-01

    NMR relaxation times T sub 1 and T sub 2 of natural rubber latex have been measured at 25 degree C on a pulsed NMR spectrometer. The work focuses on the variation of the relaxation times with the amount of water content from 0% to 50%. The water content was adjusted by centrifuging and removing a certain amount of water from the sample. The data were analysed using a biexponential fitting procedure which yields simultaneously either T sub 1a and T sub 1b or T sub 2a and T sub 2b. The amount of solid was compared with the known amount of dry rubber content

  17. Evaluation of the interfacial shear strength and residual stress of TiAlN coating on ZIRLO™ fuel cladding using a modified shear-lag model approach

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Y., E-mail: troy.liu@manchester.ac.uk [Materials Performance Centre, School of Materials, The University of Manchester, M13 9PL (United Kingdom); Bhamji, I., E-mail: imran.bhamji@manchester.ac.uk [Materials Performance Centre, School of Materials, The University of Manchester, M13 9PL (United Kingdom); Withers, P.J., E-mail: p.j.withers@manchester.ac.uk [Materials Performance Centre, School of Materials, The University of Manchester, M13 9PL (United Kingdom); Wolfe, D.E., E-mail: dew125@arl.psu.edu [The Pennsylvania State University, University Park, State College, PA 16801 (United States); Motta, A.T., E-mail: atmnuc@engr.psu.edu [The Pennsylvania State University, University Park, State College, PA 16801 (United States); Preuss, M., E-mail: michael.preuss@manchester.ac.uk [Materials Performance Centre, School of Materials, The University of Manchester, M13 9PL (United Kingdom)

    2015-11-15

    This paper investigates the residual stresses and interfacial shear strength of a TiAlN coating on Zr–Nb–Sn–Fe alloy (ZIRLO™) substrate designed to improve corrosion resistance of fuel cladding used in water-cooled nuclear reactors, both during normal and exceptional conditions, e.g. a loss of coolant event (LOCA). The distribution and maximum value of the interfacial shear strength has been estimated using a modified shear-lag model. The parameters critical to this analysis were determined experimentally. From these input parameters the interfacial shear strength between the TiAlN coating and ZIRLO™ substrate was inferred to be around 120 MPa. It is worth noting that the apparent strength of the coating is high (∼3.4 GPa). However, this is predominantly due to the large compressive residuals stress (3 GPa in compression), which must be overcome for the coating to fail in tension, which happens at a load just 150 MPa in excess of this.

  18. Effect of Rebonding on the Bond Strength of Orthodontic Tubes: A Comparison of Light Cure Adhesive and Resin-Modified Glass Ionomer Cement In Vitro

    Directory of Open Access Journals (Sweden)

    Monika Aleksiejunaite

    2017-01-01

    Full Text Available The purpose of this study was to determine the impact of different enamel preparation procedures and compare light cure composite (LCC and resin-modified glass ionomer (RMGI on the bond strength of orthodontic metal tubes rebonded to the enamel. Twenty human molars were divided into two groups (n=10. Tubes were bonded using LCC (Transbond XT in group 1 and RMGI (Fuji Ortho LC in group 2. The tubes in each group were bonded following manufacturers’ instructions (experiment I and then debonded using testing machine. Then, the same brackets were sandblasted and rebonded twice. Before the first rebonding, the enamel was cleaned using carbide bur (experiment II and before second rebonding, it was cleaned using carbide bur and soda blasted (experiment III. Mann–Whitney and Wilcoxon signed-rank tests showed no significant difference between RMGI and LCC bond strengths in case of normal bonding and rebonding, when enamel was cleaned using carbide bur before rebonding. Enamel soda blasting before rebonding significantly increased RMGI tensile bond strength value compared to LLC (p<0.05. LCC and RMGI (especially RMGI provide sufficient bond strengths for rebonding of molar tubes, when residual adhesive from previous bonding is removed and enamel soda blasted.

  19. Are rate of perceived exertion and feelings of pleasure/displeasure modified in elderly women undergoing 8 week of strength training of prescribe intensity?

    Science.gov (United States)

    Benites, Mariana L; Alves, Ragami C; Ferreira, Sandro S; Follador, Lucio; da Silva, Sergio G

    2016-01-01

    [Purpose] The aim of the present study was to verify the rate of perceived exertion and feelings of pleasure/displeasure in elderly women, who did normally perform physical exercises, following eight weeks of strength training in a constant routine. [Subjects and Methods] Eleven sedentary women were subjected to anthropometric assessment. The maximum load (100%) for each used in this study was determined by performing a test to determined the 1RM for each of them according to the protocol of Fatouros et al. and the Feeling Scale and RPE scale were explained to the women. After these initial procedures, the subjects followed a routine for strength training, performing three sets of repetitions at 70% of the one-repetition maximum for each exercise (bench press, leg extension, pulldown, leg curl) without modifying the exercises and their execution order. The frequency of training was three days per week. ANOVA was used to analyze the behavior of the dependent variable, and the post hoc tests were used to identify significant differences. [Results] Strength increased only in the fifth week. The rate of perceived exertion showed a reduction only in the fifth week in the leg extension, pulldown, leg curl. [Conclusion] The percentage of 70% the one-repetition maximum recommended to increase the strength gains and hypertrophy of skeletal muscle does not provide feelings of displeasure when performing proposed exercise. However, it may be possible to modulate this percentage to obtain more pleasant feelings over two months.

  20. Antimalarial Anthrone and Chromone from the Leaf Latex of Aloe ...

    African Journals Online (AJOL)

    In Ethiopian traditional medicine, the leaf latex of Aloe debranan Chrstian is used for the treatment of several diseases including malaria. In an ongoing search for effective, safe and cheap antimalarial agents from plants, the leaf latex of A. debrana was tested for its in vivo antimalarial activity, in a 4-day suppressive assay ...

  1. Antimicrobial activity of latex silver nanoparticles using Calotropis procera

    Directory of Open Access Journals (Sweden)

    Nadia Hussein Mohamed

    2014-11-01

    Conclusions: It can be concluded that serum latex of Calotropis procera was found to display strong potential for the synthesis of AgNPs as antimicrobial agents through rapid reduction of silver ions (Ag+ to Ag0. The green synthesized AgNPs were found to show higher antimicrobial efficacy than crude latex.

  2. Installing fonts in LaTeX a user's experience

    NARCIS (Netherlands)

    Hanssen, F.T.Y.

    2003-01-01

    This paper presents a user's experience with installing fonts for use in LaTeX. It will be shown that it is not hard to make a standard Type 1 font work, if you use modern font installation software for LaTeX. All the steps necessary to install the example fonts will be shown. The example fonts used

  3. High concentrations of natural rubber latex allergens in gloves used ...

    African Journals Online (AJOL)

    Introduction. Gloves made of natural rubber latex (NRL) are commonly used by healthcare workers because of their good qualities. However, allergic reactions to latex allergens are still commonly reported. Objective. To measure the concentrations of Hev b 1, Hev b 3, Hev b 5 and Hev b 6.02 allergens in gloves used by a ...

  4. Allergenicity of latex rubber products used in South African dental ...

    African Journals Online (AJOL)

    Fourteen latex examination gloves (powdered and non-powdered) and five dental rubber dams, representing 6 brands, from five dental academic institutions were analysed for latex allergens and total protein. Total protein content was determined using the BioRad DC protein assay kit and natural rubber allergen levels ...

  5. Rapid latex agglutination test for the serodiagnosis of human brucellosis

    NARCIS (Netherlands)

    Abdoel, Theresia H.; Smits, Henk L.

    2007-01-01

    We developed and evaluated a user-friendly latex agglutination assay for the serodiagnosis of human brucellosis. The assay was obtained by coating colored latex beads with Brucella lipopolysaccharides and drying of the activated beads onto white agglutination cards. Individual cards were sealed in a

  6. Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization

    Science.gov (United States)

    Hassmoro, N. F.; Rusop, M.; Abdullah, S.

    2013-06-01

    The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1-5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30-60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.

  7. Syntheses of crosslinked latex nanoparticles using differential microemulsion polymerization

    International Nuclear Information System (INIS)

    Hassmoro, N F; Abdullah, S; Rusop, M

    2013-01-01

    The differential microemulsion polymerization was used to synthesize latex nanoparticles. In this paper, 1, 3-butylene glycol dimethacrylate (1, 3-BGDMA) was used as a crosslinker respectively 1–5 weight% of monomer total. Butyl acrylate (BA), butyl methacrylate (BMA), and methacrylic acid (MAA) was used as the monomer. The thin film of latex nanoparticles were prepared by using spin coating method and have been dried at 100°C for 5 minutes. The amount of the crosslinker added in the polymerization was optimized and we found that the particle sizes fall in the range of 30–60 nm. The structural morphology of the uncrosslinked latex represented the most homogeneous image compared to the crosslinked latex. The effect of the amount of crosslinker on the particle sizes investigated by the Zeta-sizer Nano series while Atomic Force microscopy (AFM) was used to study the structural properties of latex nanoparticles.

  8. Mechanical properties of polymer-modified porous concrete

    Science.gov (United States)

    Ariffin, N. F.; Jaafar, M. F. Md.; Shukor Lim, N. H. Abdul; Bhutta, M. A. R.; Hussin, M. W.

    2018-04-01

    In this research work, polymer-modified porous concretes (permeable concretes) using polymer latex and redispersible polymer powder with water-cement ratio of 30 %, polymer-cement ratios of 0 to 10 % and cement content of 300 kg/m3 are prepared. The porous concrete was tested for compressive strength, flexural strength, water permeability and void ratio. The cubes size of specimen is 100 mm ×100 mm × 100 mm and 150 mm × 150 mm × 150 mm while the beam size is 100 mm × 100 mm × 500 mm was prepared for particular tests. The tests results show that the addition of polymer as a binder to porous concrete gives an improvement on the strength properties and coefficient of water permeability of polymer-modified porous concrete. It is concluded from the test results that increase in compressive and flexural strengths and decrease in the coefficient of water permeability of the polymer-modified porous concrete are clearly observed with increasing of polymer-cement ratio.

  9. Plant Growth and Water Purification of Porous Vegetation Concrete Formed of Blast Furnace Slag, Natural Jute Fiber and Styrene Butadiene Latex

    Directory of Open Access Journals (Sweden)

    Hwang-Hee Kim

    2016-04-01

    Full Text Available The purpose of this study is to investigate porous vegetation concrete formed using the industrial by-products blast furnace slag powder and blast furnace slag aggregates. We investigated the void ratio, compressive strength, freeze–thaw resistance, plant growth and water purification properties using concretes containing these by-products, natural jute fiber and latex. The target performance was a compressive strength of ≥12 MPa, a void ratio of ≥25% and a residual compressive strength of ≥80% following 100 freeze–thaw cycles. Using these target performance metrics and test results for plant growth and water purification, an optimal mixing ratio was identified. The study characterized the physical and mechanical properties of the optimal mix, and found that the compressive strength decreased compared with the default mix, but that the void ratio and the freeze–thaw resistance increased. When latex was used, the compressive strength, void ratio and freeze–thaw resistance all improved, satisfying the target performance metrics. Vegetation growth tests showed that plant growth was more active when the blast furnace slag aggregate was used. Furthermore, the use of latex was also found to promote vegetation growth, which is attributed to the latex forming a film coating that suppresses leaching of toxic components from the cement. Water purification tests showed no so significant differences between different mixing ratios; however, a comparison of mixes with and without vegetation indicated improved water purification in terms of the total phosphorus content when vegetation had been allowed to grow.

  10. Nano-engineered polyurethane resin-modified concrete.

    Science.gov (United States)

    2014-04-01

    The goal of the proposed work is to investigate the application of nano-engineered polyurethane (NEPU) emulsions for latex modified : concrete (LMC). NEPU emulsions are non-toxic, environment friendly, durable over a wide temperature range, provide b...

  11. Analysis of sulfidic linkages formed in natural rubber latex medical gloves by using X-ray absorption near edge structure

    Science.gov (United States)

    Chankrachang, M.; Limphirat, W.; Yongyingsakthavorn, P.; Nontakaew, U.; Tohsan, A.

    2017-09-01

    A study of sulfidic linkages formed in natural rubber (NR) latex medical gloves by using X-ray Absorption Near Edge Structure (XANES) is presented in this paper. The NR latex compound was prepared by using prevulcanization method, that is, it was prevulcanized at room temperature for 24 hrs before utilization. After the 24 hrs of prevulcanization, the latex film samples were obtained by dipping process. The dipped films were subjected to vulcanize at 110°C for 5 to 25 min. It was observed that after the compound was prevulcanized for 24 hrs, polysulfidic linkages were mainly formed in the sample. It was however found that after curing at 110°C for 5-25 min, the polysulfidic linkages are tended to change into disulfide linkages. Especially, in the case of 25 minutes cured sample, disulfide linkages are found to be the main linkages. In term of tensile strength, it was observed that when cure time increased from 5 - 10 min, tensile strengths were also increased. But when the cure time of the film is 25 minutes, tensile strength was slightly dropped. The dropped of tensile strength when cure time is longer than 10 minutes can be ascribed to a degradation of polysulfidic and disulfidic linkages during curing. Therefore, by using XANES analysis, it was found to be very useful to understand the cure characteristic, thus it can be very helpful to optimize cure time and tensile properties of the product.

  12. Biodegradation of high strength phenolic wastewater in a modified external loop inversed fluidized bed airlift bioreactor (EIFBAB)

    Energy Technology Data Exchange (ETDEWEB)

    Aye, T. T.; Loh, K-C. [National University of Singapore, Dept. of Chemical and Environmental Engineering, (Singapore)

    2003-12-01

    Phenol degradation at high concentrations was investigated in both batch and continuous mode, using a modified external loop inversed fluidized bed airlift bioreactor (EIFBAB). It was found that the modified EIFBAB, when operated at five litres/hour was capable of degrading 3,000 mg/L phenol. Under continuous operation the bioreactor was capable of degrading up to 5,000 mg/L phenol, with gradual acclimatization of the biofilm on the expanded polystyrene beads. Response of the system under shock loading was also evaluated. Results showed that the system was able to absorb the shock well up to 5,000 mg/L phenol. Although phenol breakthrough was evident in the effluent beyond 4,500 mg/L., the increase in effluent phenol concentration was gradual, and the effluent concentration did not increase beyond 1,000 mg/L phenol. 6 refs., 3 tabs., 3 figs.

  13. Mechanical strengths of modified PET mortar composites in aggressive MgSO4 medium: ACI & B.S predictions

    OpenAIRE

    Kazi Tani N; Benosman A.S.; Senhadji Y.; Taïbi H.; Mouli M.

    2018-01-01

    Composites mortars based on plastic aggregates are often considered as an innovative materials of the future because of their potential and the advantages they present. In this paper, a comparative study was carried out on the effect of magnesium sulfate MgSO4 (5%) attack on the durability of composite mortars modified by recycled polyethylene terephthalate (PET). Laboratory tests were accomplished on limestone sand and cement mortars where the blended Portland cement was partially replaced b...

  14. Study of the effect of ionizing radiation on the structure of natural rubber latex by positron annihilation technique

    International Nuclear Information System (INIS)

    Lopez Saldana, I.R.

    1993-01-01

    At the present research, were studied the changes in natural rubber latex structure, due to electron beam by a 3 MeV, 25 m A Dynamitron electron accelerator. The natural rubber latex was irradiated at 30, 40 and 50 kGy/s dose rate, over a total dose range from 150 to 250 kGy, for each dose rate used. From natural rubber latex irradiated films were prepared by casting with 0.7 mm. thickness. In the main part, the study was made by positron annihilation lifetime (PAL), this technique is unique in the determination of free-volume properties due to the fact that positronium atom (Ps) is found to be preferentially localized in the free-volume region of polymeric materials. The positron lifetime measurements were performing using a gamma-gamma coincidence system. These results were analyzed by PATFIT-88 program computer into three components, the long-lived component for orthopositronium (o-Ps) with parameters lifetime (τ 3 ) and formation intensity (I 3 ), were plotted and analyzed for each dose rate and total dose used. Besides with τ 3 were calculated the mean free-volume size based on the spherical model for the free-volume bubble, found that the free-volume decrease slightly with the total dose due to the crosslinking of natural rubber latex. Besides was studied the effect of dose rate on tensile strength, the tensile strength is increased with the total dose although there was not a clear effect due to the dose rate. Also the films were subjected to aging in order to determined the thermal stability of natural rubber latex irradiated, the results show that the films have good stability. Besides was used the infrared spectroscopy to determine the changes due to the crosslinking by variations in the characteristically absorption bands for cis 1,4-polyisoprene. (Author)

  15. Modified sphygmomanometer test for the assessment of strength of the trunk, upper and lower limbs muscles in subjects with subacute stroke: reliability and validity.

    Science.gov (United States)

    Aguiar, Larissa T; Lara, Eliza M; Martins, Julia C; Teixeira-Salmela, Luci F; Quintino, Ludmylla F; Christo, Paulo P; DE Morais Fairaa, Christina

    2016-10-01

    Limitations in activities have been related to weakness of the upper limbs (UL), lower limbs (LL) and trunk muscles after stroke. Therefore, the measurement of strength after stroke becomes essential. The Modified Sphygmomanometer Test (MST) is an alternative method for the measurement of strength, since it is cheap and provides objective values. However, no studies have investigated the measurement properties of the MST in sub-acute stroke. To investigate the test-retest and inter-rater reliabilities and criterion-related validity of the MST for the measurement of strength of the UL, LL, and trunk muscles in subjects with sub-acute stroke, and verify whether the number of trials would affect the results. Diagnostic accuracy. Local community, out-patient clinics, and university laboratory. Sixty- five subjects with sub-acute stroke (62±14 years) participated of the present study. The strength of 36 muscular groups was measured with the MST and dynamometers (criterion standard). To investigate whether the number of trials would affect the results, analysis of variance was applied. For the test-retest and inter-rater reliabilities and criterion-related validity of the MST, intra-class correlation coefficients (ICC), Pearson correlation coefficients, and coefficients of determination were calculated. Similar results were found for all muscular groups and number of trials (0.01≤F≤0.14; 0.87≤p≤0.99) with significant and adequate values of test-retest (0.57≤ICC≥0.98) (exception: first trial of the non-paretic ankle dorsiflexors) and inter-rater (0.50≤ICC≥0.99) (exception: non-paretic ankle plantar flexors) reliabilities and validity (0.70≤r≥0.95; p≤0.001). The values obtained with the MST were good predictors of those obtained with the dynamometers (0.54≤r2≤0.90). In general, the MST showed adequate reliabilities and criterion-related validity for measuring strength of subjects with sub-acute stroke, and only one trial, after familiarization

  16. Effects on the Physical and Mechanical Properties of Porous Concrete for Plant Growth of Blast Furnace Slag, Natural Jute Fiber, and Styrene Butadiene Latex Using a Dry Mixing Manufacturing Process

    Directory of Open Access Journals (Sweden)

    Hwang-Hee Kim

    2016-01-01

    Full Text Available To evaluate the effects of industrial by-products materials on the performance of porous concrete for plant growth, this study investigated the physical, strength, and freeze/thaw resistances of porous concrete for plant growth, prepared by replacing cement with blast furnace slag powder at 60% by weight, and replacing natural stone aggregates with coarse blast furnace slag aggregates at rates of 0%, 20%, 40%, 60% and 100% by weight. In addition, the effects of adding natural jute fiber and styrene butadiene (SB latex to these concrete mixtures were evaluated. The void ratio, compressive strength, and freeze/thaw resistance of the samples were measured. With increasing replacement rate of blast furnace aggregates, addition of latex, and mixing of natural jute fiber the void ratio of the concrete was increased. Compressive strength decreased as the replacement rate of blast-furnace slag aggregates increased. The compressive strength decreased after 100 freeze/thaw cycles, regardless of the replacement rate of blast furnace slag aggregates or of the addition of natural jute fiber and latex. The addition of natural jute fiber and latex decreased the compressive strength after 100 freeze/thaw cycles. The test results indicate that the control mixture satisfied the target compressive strength of 10 MPa and the target void ratio of 25% at replacement rates of 0% and 20% for blast furnace aggregates, and that the mixtures containing latex satisfied the criteria up to an aggregate replacement rate of 60%. However, the mixtures containing natural jute fiber did not satisfy these criteria. The relationship between void ratio and residual compressive strength after 100 freeze/thaw cycles indicates that the control mixture and the mixtures containing jute fiber at aggregate replacement rates of 20% and 40% satisfied the target void ratio of 25% and the target residual compressive strength of over 80% after 100 freeze/thaw cycles. The mixtures containing

  17. Effects on the Physical and Mechanical Properties of Porous Concrete for Plant Growth of Blast Furnace Slag, Natural Jute Fiber, and Styrene Butadiene Latex Using a Dry Mixing Manufacturing Process.

    Science.gov (United States)

    Kim, Hwang-Hee; Kim, Chun-Soo; Jeon, Ji-Hong; Park, Chan-Gi

    2016-01-29

    To evaluate the effects of industrial by-products materials on the performance of porous concrete for plant growth, this study investigated the physical, strength, and freeze/thaw resistances of porous concrete for plant growth, prepared by replacing cement with blast furnace slag powder at 60% by weight, and replacing natural stone aggregates with coarse blast furnace slag aggregates at rates of 0%, 20%, 40%, 60% and 100% by weight. In addition, the effects of adding natural jute fiber and styrene butadiene ( SB) latex to these concrete mixtures were evaluated. The void ratio, compressive strength, and freeze/thaw resistance of the samples were measured. With increasing replacement rate of blast furnace aggregates, addition of latex, and mixing of natural jute fiber the void ratio of the concrete was increased. Compressive strength decreased as the replacement rate of blast-furnace slag aggregates increased. The compressive strength decreased after 100 freeze/thaw cycles, regardless of the replacement rate of blast furnace slag aggregates or of the addition of natural jute fiber and latex. The addition of natural jute fiber and latex decreased the compressive strength after 100 freeze/thaw cycles. The test results indicate that the control mixture satisfied the target compressive strength of 10 MPa and the target void ratio of 25% at replacement rates of 0% and 20% for blast furnace aggregates, and that the mixtures containing latex satisfied the criteria up to an aggregate replacement rate of 60%. However, the mixtures containing natural jute fiber did not satisfy these criteria. The relationship between void ratio and residual compressive strength after 100 freeze/thaw cycles indicates that the control mixture and the mixtures containing jute fiber at aggregate replacement rates of 20% and 40% satisfied the target void ratio of 25% and the target residual compressive strength of over 80% after 100 freeze/thaw cycles. The mixtures containing latex and aggregate

  18. The preparation of RVNRL using Malaysian-produced latexes

    International Nuclear Information System (INIS)

    Zin, W.M. bin W.; Mohid, N. bte; Hasan, J. bin; Noor, W.K.A. bte W.M.; Jaafar, Zulkifli

    1993-01-01

    This research project was carried out using latexes supplied by three of the suppliers in Malaysia. From the results of studies carried out in search of the best sensitiser for RVNRL preparation, the use of n-butyl acrylate (n-BA) as a sensitiser gave the most promising results. However, its use as a sensitiser is not universal to all latexes available in the country. The problem was overcome by using different formulations for different latexes. For the latex supplied by Golden Hope (Hytex), a combination of sensitisers i.e. n-BA plus 2-ethyl hexyl acrylate (2-EHA) with a 10% potassium hydroxide solution as the stabilizer, was required. Latex supplied by MARDEC (Matex), seemed to need only n-BA as the sensitiser. However, a stabilizer was still required and the use of a 10% KOH solution was found to be suitable. A large range of stabilizers and sensitisers were applicable to Guthrie latex. The use of n-BA as the sensitiser and potassium laurylic acid as the stabilizer seemed the most favourable formulation. All the results are discussed in the form of a correlation between dose and the tensile properties of RVNRL vulcanizates, equilibrium swelling ratio and standing time of the latex formulation. (author)

  19. The Synthesis and Modification of Nanosized Clickable Latex Particles

    KAUST Repository

    Almahdali, Sarah

    2013-05-01

    This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical properties of the latex can be adjusted to suit various environments due to the multiple functional groups present. For this research, styrene, pentafluorostyrene, azidomethyl styrene, pentafluorostyrene with azidomethyl styrene and pentafluorostyrene with styrene latexes were produced, and analyzed by dynamic light scattering. The latexes were synthesized using a miniemulsion polymerization technique found through this research. Potassium oleate and potassium 1,1,2,2,3,3,4,4-nonafluorobutane-1-sulfonate were used as surfactants during the miniemulsion polymerization reaction to synthesize pentafluorostyrene with azidomethyl styrene latex. Transmission electron microscopy data and dynamic light scattering data have been collected to analyze the structure of this latex, and it has been synthesized using a number of conditions, differing in reaction time, surfactant amount and sonication methods. We have also improved the solubility of the latex through a copper(I) catalyzed 1,3-dipolar azide-alkyne reaction, by clicking (polyethylene glycol)5000 onto the azide functional groups.

  20. The influence of radiolytic sensitizers in natural rubber latex vulcanization induced by ionizing radiation

    International Nuclear Information System (INIS)

    Guedes, S.M.L.; Souza, A. de

    1991-01-01

    This work made on radiation vulcanization of natural rubber latex process by gamma rays from 60 Co source and electron beam of 1.5 MeV, 25 m A by Dynamitron, instead of classic process using sulfur. The experiment was carried out to study the influence of sensitizers (C Cl 4 and n-butyl acrylate) and was reported the vulcanization dose for each sensitizers, related to maximum tensile strength. The results show the possibility to introduce the volatile sensitizer (n-butyl acrylate) instead of C Cl 4 (toxic) in industry applications. (author)

  1. Size effects of latex nanomaterials on lung inflammation in mice

    International Nuclear Information System (INIS)

    Inoue, Ken-ichiro; Takano, Hirohisa; Yanagisawa, Rie; Koike, Eiko; Shimada, Akinori

    2009-01-01

    Effects of nano-sized materials (nanomaterials) on sensitive population have not been well elucidated. This study examined the effects of pulmonary exposure to (latex) nanomaterials on lung inflammation related to lipopolysaccharide (LPS) or allergen in mice, especially in terms of their size-dependency. In protocol 1, ICR male mice were divided into 8 experimental groups that intratracheally received a single exposure to vehicle, latex nanomaterials (250 μg/animal) with three sizes (25, 50, and 100 nm), LPS (75 μg/animal), or LPS plus latex nanomaterials. In protocol 2, ICR male mice were divided into 8 experimental groups that intratracheally received repeated exposure to vehicle, latex nanomaterials (100 μg/animal), allergen (ovalbumin: OVA; 1 μg/animal), or allergen plus latex nanomaterials. In protocol 1, latex nanomaterials with all sizes exacerbated lung inflammation elicited by LPS, showing an overall trend of amplified lung expressions of proinflammatory cytokines. Furthermore, LPS plus nanomaterials, especially with size less than 50 nm, significantly elevated circulatory levels of fibrinogen, macrophage chemoattractant protein-1, and keratinocyte-derived chemoattractant, and von Willebrand factor as compared with LPS alone. The enhancement tended overall to be greater with the smaller nanomaterials than with the larger ones. In protocol 2, latex nanomaterials with all sizes did not significantly enhance the pathophysiology of allergic asthma, characterized by eosinophilic lung inflammation and Igs production, although latex nanomaterials with less than 50 nm significantly induced/enhanced neutrophilic lung inflammation. These results suggest that latex nanomaterials differentially affect two types of (innate and adaptive immunity-dominant) lung inflammation

  2. A Modified Constitutive Model for Tensile Flow Behaviors of BR1500HS Ultra-High-Strength Steel at Medium and Low Temperature Regions

    Science.gov (United States)

    Zhao, Jun; Quan, Guo-Zheng; Pan, Jia; Wang, Xuan; Wu, Dong-Sen; Xia, Yu-Feng

    2018-01-01

    Constitutive model of materials is one of the most requisite mathematical model in the finite element analysis, which describes the relationships of flow behaviors with strain, strain rate and temperature. In order to construct such constitutive relationships of ultra-high-strength BR1500HS steel at medium and low temperature regions, the true stress-strain data over a wide temperature range of 293-873 K and strain rate range of 0.01-10 s-1 were collected from a series of isothermal uniaxial tensile tests. The experimental results show that stress-strain relationships are highly non-linear and susceptible to three parameters involving temperature, strain and strain rate. By considering the impacts of strain rate and temperature on strain hardening, a modified constitutive model based on Johnson-Cook model was proposed to characterize flow behaviors in medium and low temperature ranges. The predictability of the improved model was also evaluated by the relative error (W(%)), correlation coefficient (R) and average absolute relative error (AARE). The R-value and AARE-value for modified constitutive model at medium and low temperature regions are 0.9915 & 1.56 % and 0.9570 & 5.39 %, respectively, which indicates that the modified constitutive model can precisely estimate the flow behaviors for BR1500HS steel in the medium and low temperature regions.

  3. Radiation vulcanization of natural rubber latex with low energy accelerator

    Energy Technology Data Exchange (ETDEWEB)

    Haque, Emdadul; Makuuchi, Keizo; Ikeda, Kenichi; Yoshii, Fumio; Kume Tamikazu [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment; Mitomo, Hiroshi [Gunma Univ., Faculty of Engineering, Department of Biological and Chemical Engineering, Kiryu, Gunma (Japan)

    2001-03-01

    The radiation vulcanization of natural rubber latex (RVNRL) with the recently installed electron beam (EB) pilot plant at Takasaki Radiation Chemistry Research Establishment, Takasaki, Japan has been discussed. The accelerating voltage and beam current of the plant are 250 kV and 10 mA respectively. The plant has a reaction vessel with the capacity of 18 liters latex to irradiate at a time. In order to obtain a suitable setting of experimental for RVNRL under EB of the plant the parameters such as irradiation time, defoamer concentration, volume of latex, beam current etc. are being optimized by varying the individual parameter at a constant set of the other variables. (author)

  4. Isolation and characterization of latex-specific promoters from Papaver somniferum L.

    OpenAIRE

    Raymond, Michelle Jean

    2004-01-01

    The pharmacologically important alkaloids morphine and codeine are found in latex of opium poppy (Papaver somniferum). Latex is harbored in laticifers, a specialized vascular cell-type. Isolation and characterization of latex-specific genes may provide a useful tool to metabolically engineer increased alkaloid production. Previous research in the Nessler laboratory identified genes that exhibit latex-specific gene expression. Latex-specific genes were an 2-oxoglutarate-dioxygense (DIOX), ...

  5. Comparative study on plant latex particles and latex coagulation in Ficus benjamina, Campanula glomerata and three Euphorbia species.

    Directory of Open Access Journals (Sweden)

    Georg Bauer

    Full Text Available Among latex-producing plants, mainly the latex of Hevea brasiliensis has been studied in detail so far, while comprehensive comparative studies of latex coagulation mechanisms among the more than 20,000 latex-bearing plant species are lacking. In order to give new insights into the potential variety of coagulation mechanisms, the untreated natural latices of five latex-bearing plants from the families Euphorbiaceae, Moraceae and Campanulaceae were visualised using Cryo-SEM and their particle size compared using the laser diffraction method. Additionally, the laticifers of these plants species were examined in planta via Cryo-SEM. Similar latex particle sizes and shape were found in Ficus benjamina and Hevea brasiliensis. Hence, and due to other similarities, we hypothesize comparable, mainly chemical, coagulation mechanisms in these two species, whereas a physical coagulation mechanism is proposed for the latex of Euphorbia spp. The latter mechanism is based on the huge amount of densely packed particles that after evaporation of water build a large surface area, which accelerates the coagulation procedure.

  6. Thermoresponsive latexes for fragrance encapsulation and release.

    Science.gov (United States)

    Popadyuk, N; Popadyuk, A; Kohut, A; Voronov, A

    2016-04-01

    To synthesize cross-linked latex particles protecting the encapsulated fragrance at ambient temperatures and facilitating the release of cargo at the temperature of the surface of the skin that varies in different regions of the body between 33.5 and 36.9°C. Poly(stearyl acrylate) (PSA), a polymer with long crystallizable alkyl side chains (undergoes order-disorder transitions at 45°C), was chosen as the main component of the polymer particles. As a result, new thermoresponsive polymer particles for fragrance encapsulation were synthesized and characterized, including assessing the performance of particles in triggered release by elevated temperature. To obtain network domains of various crystallinity, stearyl acrylate was copolymerized with dipropylene glycol acrylate caprylate (DGAC) (comonomer) in the presence of a dipropylene glycol diacrylate sebacate (cross-linker) using the miniemulsion process. Comonomers and a cross-linker were mixed directly in a fragrance during polymerization. Fragrance release was evaluated at 25, 31, 35 and 39°C to demonstrate a new material potential in personal/health care skin-related applications. Particles protect the fragrance from evaporation at 25°C. The fragrance release rate gradually increases at 31, 35 and 39°C. Two slopes were found on release plots. The first slope corresponds to a rapid fragrance release. The second slope indicates a subsequent reduction in the release rate. Crystalline-to-amorphous transition of PSA triggers the release of fragrances from cross-linked latex particles at elevated temperatures. The presence of the encapsulated fragrance, as well as the inclusion of amorphous fragments in the polymer network, reduces the particle crystallinity and enhances the release. Release profiles can be tuned by temperature and controlled by the amount of loaded fragrance and the ratio of comonomers in the feed mixture. © 2015 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

  7. Studied on Virgin Coconut Oil (VCO) and Olive Oil (OO) as an Alternative for Stabilizer of Radiation Vulcanized Natural Rubber Latex (RVNRL) Preparation

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Mohd Noorwadi Mat Lazim

    2016-01-01

    This paper presents the effects of virgin coconut oil (VCO) and olive oil (OO) as an alternative stabilizer in the radiation vulcanized natural rubber latex (RVNRL). Potassium laurite (KL) as a stabilizer considered as a control of RVNRL sample were compared to mixed ratio 1:1 KL: VCO and 1:1 KL: OO stabilizer formulation. Total solid content (TSC) and tensile strength (TS) results showed no significant different between the formulations. Mechanical stability time (MST) indicates higher stability of RVNRL with addition of VCO. The fatty acid composition in VCO indicate VCO was acting well as stabilizer for latex stabilizer formulation. (author)

  8. Cryo-SEM studies of latex/ceramic nanoparticle coating microstructure development.

    Science.gov (United States)

    Luo, Hui; Scriven, L E; Francis, Lorraine F

    2007-12-15

    Cryogenic scanning electron microscopy (cryo-SEM) was used to investigate microstructure development of composite coatings prepared from dispersions of antimony-doped tin oxide (ATO) nanoparticles (approximately 30 nm) or indium tin oxide (ITO) nanoparticles (approximately 40 nm) and latex particles (polydisperse, D(v): approximately 300 nm). Cryo-SEM images of ATO/latex dispersions as-frozen show small clusters of ATO and individual latex particles homogeneously distribute in a frozen water matrix. In contrast, cryo-SEM images of ITO/latex dispersions as-frozen show ITO particles adsorb onto latex particle surfaces. Electrostatic repulsion between negatively charged ATO and negatively charged latex particles stabilizes the ATO/latex dispersion, whereas in ITO/latex dispersion, positively charged ITO particles are attracted onto surfaces of negatively charged latex particles. These results are consistent with calculations of interaction potentials from past research. Cryo-SEM images of frozen and fractured coatings reveal that both ceramic nanoparticles and latex become more concentrated as drying proceeds; larger latex particles consolidate with ceramic nanoparticles in the interstitial spaces. With more drying, compaction flattens the latex-latex particle contacts and shrinks the voids between them. Thus, ceramic nanoparticles are forced to pack closely in the interstitial spaces, forming an interconnected network. Finally, latex particles partially coalesce at their flattened contacts, thereby yielding a coherent coating. The research reveals how nanoparticles segregate and interconnect among latex particles during drying.

  9. Incidence of latex harvesting technologies on agronomic and ...

    African Journals Online (AJOL)

    parameters and profitability of some rapid metabolic class clones of rubber ... of hormonal stimulation had no negative influence on the vegetative growth ..... yield (2597) was obtained with the control ..... metabolic energy of latex vessels as.

  10. Incidence of latex harvesting technologies on agronomic and ...

    African Journals Online (AJOL)

    Incidence of latex harvesting technologies on agronomic and physiological parameters and profitability of some rapid metabolic class clones of rubber tree ( Hevea brasiliensis ) in southwestern Côte d'Ivoire.

  11. The Synthesis and Modification of Nanosized Clickable Latex Particles

    KAUST Repository

    Almahdali, Sarah

    2013-01-01

    This research aims to add to the current knowledge available for miniemulsion polymerization reactions and to use this knowledge to synthesize multifunctional nanosized latex particles that have the potential to be used in catalysis. The physical

  12. PS-HEMA latex fractionation by sedimentation and colloidal crystallization

    Directory of Open Access Journals (Sweden)

    Cardoso André H.

    1999-01-01

    Full Text Available A poly(styrene-co-hydroxyethylmethacrylate latex underwent sedimentation under gravity followed by an spontaneous and extensive colloidal crystallization. It was then fractionated in three visually distinguishable layers. Latex aliquots layers were sampled at different heigths and the particles were characterized by PCS, microelectrophoresis, infrared spectra and analytical electron microscopy. The major fraction was opalescent and contained the colloidal crystals settled in the bottom of the liquid. Two other latex fractions were obtained, which differed in their chemical compositions, particle sizes and topochemical features from the self-arraying particles. Macrocrystallization of the fractionated latex yielded high quality crystals with a low frequency of defects, which confirms that particle chemical homogeneity is an important factor for particle self-arraying.

  13. Radiation vulcanization of natural rubber latex sensitized with commercial gases

    Energy Technology Data Exchange (ETDEWEB)

    Chirinos, H.; Lugao, A. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)

    2002-07-01

    The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)

  14. Radiation vulcanization of natural rubber latex sensitized with commercial gases

    International Nuclear Information System (INIS)

    Chirinos, H.; Lugao, A.

    2002-01-01

    The industrial activities using natural rubber latex are fully compatible with rural areas in Amazon and other places in Brazil, as well as in other tropical countries. However the classical sulfur vulcanization presents many occupational problems for the workers in rural areas. Radiation vulcanization of natural rubber latex is a much more friendly process as sulfur compounds are not needed for crosslinking, although chemicals as acrylate monomers, particularly multifunctional acrylates are still used as sensitizers for radiation processes. Two commercial gases, acetylene and butadiene, were selected as sensitizers for the radiation vulcanization of natural rubber latex instead of acrylates. These gases accelerate the crosslinking rates of the cure process and lower the radiation dose required to achieve vulcanization of natural rubber latex and improve the mechanical properties to reduce the tackiness of rubber goods. (author)

  15. Assessment of adverse reactions to latex gloves use among nurses ...

    African Journals Online (AJOL)

    ... to latex is a common problem among nurses and other health care workers. ... There was significant association between family history and occurrence of ... These effects may vary in severity from skin problems to anaphylactic shock.

  16. Synthesis and characterization of novel polyacid-stabilized latexes.

    Science.gov (United States)

    Yang, Pengcheng; Armes, S P

    2012-09-18

    A series of novel polyacid macromonomers based on 2-hydroxypropyl methacrylate (HPMA) were prepared by atom transfer radical polymerization (ATRP) via a two-step route. First, a range of well-defined PHPMA homopolymer precursors were synthesized by ATRP using a tertiary amine-functionalized initiator, 2-(dimethylamino)ethyl-2-bromoisobutyrylamide, and a CuCl/2, 2'-bipyridine (bpy) catalyst in alcoholic media at 50 °C. ATRP polymerizations were relatively slow and poorly controlled in pure isopropanol (IPA), especially when targeting higher degrees of polymerization (DP > 30). Improved control was achieved by addition of water: low polydispersity (M(w)/M(n) propyl methacrylate) (PSPMA) macromonomers by quaternizing the tertiary amine end-group with excess 4-vinylbenzyl chloride, followed by esterification of the pendent hydroxyl groups using excess succinic anhydride at 20 °C. These polyacid macromonomers were evaluated as reactive steric stabilizers for polystyrene latex synthesis under either aqueous emulsion polymerization or alcoholic dispersion polymerization conditions. Near-monodisperse polystyrene latexes were obtained via aqueous emulsion polymerization using 10 wt % PSPMA macromonomer (with respect to styrene monomer) with various initiators as evidenced by scanning electron microscopy, disk centrifuge photosedimentometry and light scattering studies. PSPMA macromomer concentrations as low as 1.0 wt % also produced near-monodisperse latexes, suggesting that these PSPMA macromonomers are highly effective stabilizers. Alcoholic dispersion polymerization of styrene conducted in various ethanol/water mixtures with 10 wt % PSPMA(50) macromonomer produced relatively large near-monodisperse latexes. Increasing the water content in such formulations led to smaller latexes, as expected. Control experiments conducted with 10 wt % PSPMA(50) homopolymer produced relatively large polydisperse latexes via emulsion polymerization and only macroscopic precipitates via

  17. Irradiation grafting of natural rubber latex with maleic anhydride and its compatibilization of poly(lactic acid)/natural rubber blends

    Science.gov (United States)

    Pongsathit, Siriwan; Pattamaprom, Cattaleeya

    2018-03-01

    Maleic anhydride (MA) is an interesting monomer to be grafted onto natural rubber(NR) due to its potential as a compatibilizer of hydrophobic rubbers and polymers with higher polarity. So far, radiation grafting of MA onto NR in latex state has not been reported. In this study, the grafting of NR with MA in latex state was investigated by exposing the latex to cobalt-60 gamma irradiation at a fixed MA content of 9% and a varied absorbed doses from 2 to 10 kGy. The FTIR spectrometer, 1H NMR spectrometer and gel content analysis have confirmed successful grafting of MA onto NR after irradiation. The grafted NRs were then used to increase the compatibility and the impact property of PLA/NR blends. It was found that the highest impact strength of the blends was achieved when the grafting was carried out at the absorbed dose of 4 kGy.

  18. Radioactive iodine (125I) labeling of latex particles

    International Nuclear Information System (INIS)

    Parikh, G.C.; Ho, C.K.

    1977-01-01

    The invention disclosed in this application is directed towards developing a radioiodination method which is applicable to the labeling of 2.02 micrometer (μm) and 0.37 micrometer (μm) diameter polyvinyltoluene latex particles that have been used as an immunoadsorbent. More particularly the overall method includes using an oxidation-reduction chemical reaction for tagging latex particles. Two methods are described. One, the hydrochloric acid method; and two, the nitric acid method

  19. Plant species composition alters the sign and strength of an emergent multi-predator effect by modifying predator foraging behaviour.

    Directory of Open Access Journals (Sweden)

    Andrew Wilby

    Full Text Available The prediction of pest-control functioning by multi-predator communities is hindered by the non-additive nature of species functioning. Such non-additivity, commonly termed an emergent multi-predator effect, is known to be affected by elements of the ecological context, such as the structure and composition of vegetation, in addition to the traits of the predators themselves. Here we report mesocosm experiments designed to test the influence of plant density and species composition (wheat monoculture or wheat and faba bean polyculture on the emergence of multi-predator effects between Adalia bipunctata and Chrysoperla carnea, in their suppression of populations of the aphid Metopolophium dirhodum. The mesocosm experiments were followed by a series of behavioural observations designed to identify how interactions among predators are modified by plant species composition and whether these effects are consistent with the observed influence of plant species composition on aphid population suppression. Although plant density was shown to have no influence on the multi-predator effect on aphid population growth, plant composition had a marked effect. In wheat monoculture, Adalia and Chrysoperla mixed treatments caused greater suppression of M. dirhodum populations than expected. However this positive emergent effect was reversed to a negative multi-predator effect in wheat and faba bean polyculture. The behavioural observations revealed that although dominant individuals did not respond to the presence of faba bean plants, the behaviour of sub-dominants was affected markedly, consistent with their foraging for extra-floral nectar produced by the faba bean. This interaction between plant composition and predator community composition on the foraging behaviour of sub-dominants is thought to underlie the observed effect of plant composition on the multi-predator effect. Thus, the emergence of multi-predator effects is shown to be strongly influenced by

  20. Immune response modulation by curcumin in a latex allergy model

    Directory of Open Access Journals (Sweden)

    Raju Raghavan

    2007-01-01

    Full Text Available Abstract Background There has been a worldwide increase in allergy and asthma over the last few decades, particularly in industrially developed nations. This resulted in a renewed interest to understand the pathogenesis of allergy in recent years. The progress made in the pathogenesis of allergic disease has led to the exploration of novel alternative therapies, which include herbal medicines as well. Curcumin, present in turmeric, a frequently used spice in Asia has been shown to have anti-allergic and inflammatory potential. Methods We used a murine model of latex allergy to investigate the role of curcumin as an immunomodulator. BALB/c mice were exposed to latex allergens and developed latex allergy with a Th2 type of immune response. These animals were treated with curcumin and the immunological and inflammatory responses were evaluated. Results Animals exposed to latex showed enhanced serum IgE, latex specific IgG1, IL-4, IL-5, IL-13, eosinophils and inflammation in the lungs. Intragastric treatment of latex-sensitized mice with curcumin demonstrated a diminished Th2 response with a concurrent reduction in lung inflammation. Eosinophilia in curcumin-treated mice was markedly reduced, co-stimulatory molecule expression (CD80, CD86, and OX40L on antigen-presenting cells was decreased, and expression of MMP-9, OAT, and TSLP genes was also attenuated. Conclusion These results suggest that curcumin has potential therapeutic value for controlling allergic responses resulting from exposure to allergens.

  1. Drying of latex films and coatings: Reconsidering the fundamental mechanisms

    DEFF Research Database (Denmark)

    Kiil, Søren

    2006-01-01

    The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast to previ......The two existing theories describing drying of latex films or coatings are reconsidered. Subsequently, a novel mathematical drying model is presented, the simulations of which can match and explain experimental drying rate data of two previous investigations with latex films. In contrast...... to previous model studies, but in agreement with observations, simulations suggest that during the falling rate period of the drying process of a latex film, a porous skin of partly coalesced latex particles is indeed formed, which limits transport of water vapour from the receding air-liquid interphase...... to the surface of the film. The value of the effective diffusion coefficient of water vapour in the dry and partly coalesced layer (7 x 10(-7) m(2)/s at 19-24 degrees C), the adjustable parameter of the model for the falling rate period, was found to be independent of initial wet film thickness (89-1322 mu m...

  2. In vitro Evaluation of Effect of Dental Bleaching on the Shear Bond Strength of Sapphire Orthodontics Brackets Bonded with Resin Modified Glass Ionomer Cement

    Directory of Open Access Journals (Sweden)

    Zainab M Kadhom

    2017-11-01

    Full Text Available Aim: This study aimed to assess the effect of various types of bleaching agents on the shear bond strength of sapphire brackets bonded to human maxillary premolar teeth using resin modified glass ionomer cement (RMGIC and to determine the site of bond failure. Materials and Methods: Thirty freshly extracted maxillary human premolars were selected and assigned into three equal groups, ten teeth in each. The first group was the control (unbleached group; the second group comprised teeth bleached with hydrogen peroxide group (HP 37.5% (in-office bleaching while the third group included teeth bleached with carbamide peroxide group (CP 16% (at-home bleaching. The teeth in the experimental groups were bleached and stored in water one day then bonded with sapphire brackets using RMGIC with the control group and left another day. De-bonding was performed using Instron universal testing machine. To determine the site of bond failure, both the enamel surface and bracket base of each tooth were examined under magnifying lens (20X of a stereomicroscope. Results: Results showed statistically highly significant difference in the shear bond strengths between control group and both of bleaching groups being low in the control group. Score III was the predominant site of bond failure in all groups. Conclusions: RMGIC provides adequate bond strength when bonding the sapphire brackets to bleached enamel; this bonding was strong enough to resist both the mechanical and masticatory forces. Most of the adhesive remained on the brackets, so it reduced the time required for removal of the bonding material’s remnants during enamel finishing and polishing.

  3. Troubleshooting for the observed problems in processing latex concentrate from natural resource

    International Nuclear Information System (INIS)

    Afreen, S; Haque, K R; Huda, M K

    2013-01-01

    Natural latex has special importance in the rubber industry for manufacturing different types of goods like gloves, balloons, male contraceptive and similar thin walled articles. This natural latex is much more sensitive a liquid to handle since it can easily become contaminated and thereby coagulated which makes it unfavourable for centrifuge and getting concentrate from it. Some other related measures also are included in consideration during the processing of concentrate latex from the natural raw latex. The problems that are being faced in a concentrate latex processing plant can be categorized in different groups like, problems related to the latex property, mechanical problems, electrical problems, handling and storage problems, transformation problems, problems related to environmental issues, etc. Among them, the most common and vital problems frequently observed in a concentrate latex processing plant are discussed here with a view to finding the measures for solution which will help to maintain the latex property in any latex processing plant.

  4. Properties and Characterization of Kenaf-Filled Natural Rubber Latex Foam

    Directory of Open Access Journals (Sweden)

    Ahmad Fikri Abdul Karim

    2015-12-01

    Full Text Available Kenaf powder was incorporated with natural rubber latex (NRL compound and foamed to make natural rubber latex foam (NRLF by using a well known technique called the Dunlop method. Different loadings of kenaf powder were added to NRL compound and was foamed to make NRLF. The mechanical properties, density, compression, thermal, and micro-structural characterization of control NRLF and kenaf incorporated NRLF were studied. Increasing content of kenaf reduced the tensile strength, elongation at break, and compressive strength of a NRLF. Modulus at 100% elongation and density of the NRLF increased with an increase in filler loading. Higher kenaf loading indicated higher elasticity of kenaf-filled NRLF, but the recovery percentage of kenaf-filled NRLF decreased with increasing kenaf loading. From thermogravimetric analysis (TGA result, an increase in the amount of kenaf loading from 1 to 7 phr increased the thermal stability of kenaf-filled NRLF. Morphological and micro-structural characterization performed by using scanning electron microscopy (SEM showed that kenaf powder filled up the micro-sized pores in the open cell structure of kenaf-filled NRLF.

  5. Properties of natural rubber/attapulgite composites prepared by latex compounding method: Effect of filler loading

    International Nuclear Information System (INIS)

    Muttalib, Siti Nadzirah Abdul; Othman, Nadras; Ismail, Hanafi

    2015-01-01

    This paper reports on the effect of filler loading on properties of natural rubber (NR)/attapulgite (ATP) composites. The NR/ATP composites were prepared by latex compounding method. It is called as masterbatch. The masterbatch was subsequently added to the NR through melt mixing process. The vulcanized NR/ATP composites were subjected to mechanical, swelling and morphological tests. All the results were compared with NR/ATP composites prepared by conventional system. The composites from masterbatch method showed better results compared to composites prepared by conventional method. They have higher tensile properties, elongation at break and tear strength. The images captured through scanning electron microscopy test revealed the improvement of tensile strength in masterbatch NR/ATP composites. It can be seen clearly that masterbatch NR/ATP have better filler dispersion compared to conventional method NR/ATP composites

  6. Properties of natural rubber/attapulgite composites prepared by latex compounding method: Effect of filler loading

    Energy Technology Data Exchange (ETDEWEB)

    Muttalib, Siti Nadzirah Abdul, E-mail: sitinadzirah.amn@gmail.com; Othman, Nadras, E-mail: srnadras@usm.my; Ismail, Hanafi, E-mail: ihanafi@usm.my [School of Materials and Mineral Resources Engineering, Engineering Campus, Universiti Sains Malaysia, Seri Ampangan, 14300 Nibong Tebal, Pulau Pinang (Malaysia)

    2015-07-22

    This paper reports on the effect of filler loading on properties of natural rubber (NR)/attapulgite (ATP) composites. The NR/ATP composites were prepared by latex compounding method. It is called as masterbatch. The masterbatch was subsequently added to the NR through melt mixing process. The vulcanized NR/ATP composites were subjected to mechanical, swelling and morphological tests. All the results were compared with NR/ATP composites prepared by conventional system. The composites from masterbatch method showed better results compared to composites prepared by conventional method. They have higher tensile properties, elongation at break and tear strength. The images captured through scanning electron microscopy test revealed the improvement of tensile strength in masterbatch NR/ATP composites. It can be seen clearly that masterbatch NR/ATP have better filler dispersion compared to conventional method NR/ATP composites.

  7. Physical-biopolymer characterization of polyhydroxybutyrate-co-hydroxyvalerate (PHBV) blended with natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Kuntanoo, K., E-mail: thip-kk@hotmail.com [Graduate School of Khon Kaen University, Khon Kaen, 40002 Thailand (Thailand); Promkotra, S., E-mail: sarunya@kku.ac.th [Department of Geotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand); Kaewkannetra, P., E-mail: paknar@kku.ac.th [Department of Biotechnology, Faculty of Technology, Khon Kaen University, Khon Kaen 40002 Thailand (Thailand)

    2015-03-30

    A biopolymer of polyhydroxybutyrate-co-hydroxyvalerate (PHBV) is blended with bio-based materials, natural rubber latex, to improve their microstructures. The various ratios between PHBV and natural rubber latex are examined to develop their mechanical properties. In general, physical properties of PHBV are hard, brittle and low flexible while natural rubber (NR) is presented itself as high elastic materials. Concentrations of the PHBV solution are constituted at 1%, 2% and 3% (w/v). The mixtures of their PHBV solutions to natural rubber latex are produced the blended films in three different ratios of 4:6, 5:5 and 6:4, respectively. They are characterized by appearance analyses which are the scanning electron microscope (SEM), universal testing machine (UTM) and differential scanning calorimetry (DSC). The SEM photomicrographs of the blended films and the controlled PHBV can provide the void distribution in the range of 12-14% and 19-21%, respectively. For mechanical properties of the blended films, the various elastic moduli of 1%, 2% and 3% (w/v) PHBV are the average of 773, 956 and 1,007 kPa, respectively. The tensile strengths of the blends increase with the increased concentrations of PHBV, similarly trend to the elastic modulus. The crystallization and melting behavior of unmixed PHBV and the blends are determined by DSC. Melting transition temperatures (T{sub m}) of the unmixed PHBV are stated two melting peak at 154°C and 173°C. Besides, the melting peaks of the blends alter in the range of 152-156°C and 168-171°C, respectively. According to morphology of the blends, the void distribution decreases twice compared to the unmixed PHBV. The results of mechanical properties and thermal analysis indicate that the blended PHBV can be developed their properties by more resilient and wide range of temperature than usual.

  8. Antibacterial activity of the latex of Argemone ochroleuca Sweet

    International Nuclear Information System (INIS)

    Saad A. Alamri; Mahmoud F. Moustafa

    2010-01-01

    To investigate the antibacterial effect of the crude latex of Argemone ochroleuca (A. ochroleuca) as antibacterial potential against a range of human pathogenic bacteria. This study was carried out at King Khalid University, Abha, Kingdom of Saudi Arabia from January to March 2010. Seventeen ml of fresh latex from A. ochroleuca Sweet was collected, and the antibacterial activity of crude and diluted latex were examined using one ml of standardized inoculum suspension, and using the agar diffusion method test against Bacillus subtilis, Enterobacter aerogenes, Micrococcus luteus, Escherichia coli, and Staphylococcus aureus. All inoculated plates were incubated aerobically at 290C for 48 hours. The diameter of the zones of inhibition was measured to the nearest mm. The crude latex of A. ochroleuca exhibited a potent antibacterial effect on all bacterial strains examined. The zones of inhibition against the tested bacteria were found in the range of 9.30 - 40.3 mm along with their respective minimum inhibitory concentration values 100 ul/ml. The observable inhibition on selected bacteria by latex of A. ochroleuca makes it a promising alternative as a potential source of natural antibacterial (Author).

  9. Respiratory and dermal symptoms in Thai nurses using latex products.

    Science.gov (United States)

    Supapvanich, C; Povey, A C; de Vocht, F

    2013-09-01

    Despite known health risks related to the use of powdered latex gloves (PLGs), they are still widely used in hospitals in developing countries due to the high cost of alternatives. To determine the prevalence of dermal and respiratory symptoms associated with latex glove use in nurses in Thailand and evaluate the influence of previously reported occupational risk factors in this population. A cross-sectional study in female nurses working in three Thai hospitals. Participants completed a questionnaire on demographics, occupational and personal history, use of latex products at work and dermal and respiratory symptoms attributed to occupational use of latex gloves. Of 899 nurses, 18% reported health effects attributed to the use of latex products. After adjustment for confounding, occupational risk factors associated with increased reporting of dermal symptoms included wearing more than 15 pairs of PLG per day (odds ratio (OR): 2.10, 95% confidence interval (CI): [1.32-3.34]), using chlorhexidine (OR: 2.07, 95% CI: [1.22-3.52]) and being an operating theatre nurse (OR: 2.46, 95% CI: [1.47-4.12]). Being a labour ward nurse (OR: 3.52, 95% CI: [1.26-9.85]) was the only factor associated with increased reporting of respiratory symptoms. Continuing use of PLGs in Thai nurses is associated with increased prevalence of dermal symptoms compared with data from developed countries. Measures to reduce such health effects are well established and should be considered. Additionally, replacement of chlorhexidine with an alternative detergent seems advisable.

  10. Interface and its effect on the interlaminate shear strength of novel glass fiber/hyperbranched polysiloxane modified maleimide-triazine resin composites

    International Nuclear Information System (INIS)

    Liu Ping; Guan Qingbao; Gu Aijuan; Liang Guozheng; Yuan Li; Chang Jianfei

    2011-01-01

    Interface is Key topic of developing advanced fiber reinforced polymeric composites. Novel advanced glass woven fabric (GF) reinforced composites, coded as GF/mBT, were prepared, of which the matrix resin was hyperbranched polysiloxane (HBPSi) modified maleimide-triazine (mBT) resin. The influence of the composition of the matrix on the interfacial nature of the GF/mBT composites were studied and compared with that of the composite based on GF and BT resin using contact angle, X-ray photoelectron spectroscopy (XPS), scanning electron microscope (SEM), and dielectric properties over wide frequency and temperature ranges. Results show that the interfacial nature of the composites is dependent on the chemistries of the matrices, mBT matrices have better interfacial adhesion with GF than BT resin owing to the formation of chemical and hydrogen bonds between mBT resin and GF; while in the case of mBT resins, the content of HBPSi also plays an important role on the interfacial feature and thus the macro-performance. Specifically, with increasing the content of HBPSi in the matrix, the interlaminate shear strength of corresponding composites significantly improves, demonstrating that better interfacial adhesion guarantees outstanding integrated properties of the resultant composites.

  11. Purification and biochemical characterization of asclepain c I from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S

    2004-08-01

    In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.

  12. Development of an efficient process for radiation vulcanization of natural rubber latex using hydroperoxide with sensitizer

    International Nuclear Information System (INIS)

    Siri-upathum, C.; Sonsuk, M.

    1996-01-01

    An attempt was made to reduce irradiation dose for radiation vulcanization of natural rubber latex. A promising method was to partially crosslink the latex by radiation vulcanization using n-butyl acrylate (n-BA) as sensitizer and t-butyl hydroperoxide (BHPO) as a co-sensitizer followed by redox vulcanization using residual BHPO as an oxidant and either fructose or tetra ethylene penta mine as reducing agents. It was found that the irradiation dose was reduced to 4 kGy with 5 phr n-BA as sensitizer and 0.1 phr BHPO as co-sensitizer. Successive crosslinking to full vulcanization was done by redox vulcanization using either 4 phr fructose at 60 degree C for 3 hours of 0.4 phr tetra-ethylene penta mine at room temperature for 1 hour. The rubber films obtained had tensile strength of about 25 MPa, modulus 300% of 0.9 MPa and crosslink density of about 1.5 x 10 19 crosslink/cm 3 . It was noted that the rubber film from the co-vulcanization was the average value of the values obtained by radiation vulcanization and redox vulcanization

  13. Science and technology of rubber reclamation with special attention to NR based waste latex products

    NARCIS (Netherlands)

    Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.

    2006-01-01

    A comprehensive overview of reclamation of cured rubber with special emphasis on latex reclamation is depicted in this paper. The latex industry has expanded over the years to meet the world demands for gloves, condoms, latex thread, etc. Due to the strict specifications for the products and the

  14. Morphology and film formation of poly(butyl methacrylate)-polypyrrole core-shell latex particles

    NARCIS (Netherlands)

    Huijs, F; Lang, J

    Core-shell latex particles made of a poly(butyl methacrylate) (PBMA) core and a thin polypyrrole (PPy) shell were synthesized by two-stage polymerization. In the first stage, PBMA latex particles were synthesized in a semicontinuous process by free-radical polymerization. PBMA latex particles were

  15. IMMEDIATE AND DELAYED HYPERSENSITIVITY REACTIONS TO LATEX GLOVES IN A DENTAL STUDENT. A case report.

    Directory of Open Access Journals (Sweden)

    Iliyana Stoeva

    2011-08-01

    Full Text Available The article presents a case of dental student with immediate and delayed hypersensitivity reaction to latex gloves. Symptoms appeared during the second year of regularly using of latex gloves. The student was with no history of allergies and no previous exposure to latex products.

  16. Trial production of low protein irradiated natural rubber latex by low energy electron beam in pilot scale

    International Nuclear Information System (INIS)

    Utama, Marga; Yoshii, F.; Kume, T.

    2006-01-01

    Three importance factors for producing low protein by low energy electron beam (250 keV/10 mA) irradiation in pilot scale (20 liters per bath) with 1,9-nonediol diacrylate (NDA) namely: maturation time of natural rubber latex before irradiation, treatment of irradiated natural rubber latex (INRL) before and after centrifugation, and standard irradiation method has been carried out. The results showed that the optimum irradiation time for producing INRL with 5 phr (part hundred ratio of rubber) of NDA as sensitize agent, and with the rotation speed of agitation 210 rpm (rotation per minutes) was between 20-30 minutes. By using this condition tensile strength of the INRL film was 26 MPa. The maturation of natural rubber latex before irradiation is the key for driving the quality of INRL. Water extractable protein content of INRL after leaching in 1% ammonia solution for 30 minutes at room temperature was around 47 μ/g, and after adding with 1 phr of PVA (poly vinyl alcohol) or 0.1 phr CMC (carboxy methyl cellulose) the water extractable protein content decrease less than 6 μ/g. (author)

  17. Effect of multiple alcohol-based hand rub applications on the tensile properties of thirteen brands of medical exam nitrile and latex gloves.

    Science.gov (United States)

    Gao, Pengfei; Horvatin, Matthew; Niezgoda, George; Weible, Robyn; Shaffer, Ronald

    2016-12-01

    Current CDC guidance for the disinfection of gloved hands during the doffing of personal protective equipment (PPE) following the care of a patient with Ebola recommends for multiple applications of alcohol-based hand rub (ABHR) on medical exam gloves. To evaluate possible effects of ABHR applications on glove integrity, thirteen brands of nitrile and latex medical exam gloves from five manufacturers and two different ABHRs were included in this study. A pair of gloves were worn by a test operator and the outside surfaces of the gloves were separately treated with an ABHR for 1-6 applications. Tensile strength and ultimate elongation of the gloves without any ABHR treatments (control gloves) and gloves after 1-6 ABHR applications were measured based on the ASTM D412 standard method. In general, tensile strength decreased with each ABHR application. ABHRs had more effect on the tensile strength of the tested nitrile than latex gloves, while ethanol-based ABHR (EBHR) resulted in lesser changes in tensile strength compared to isopropanol-based ABHR (IBHR). The results show that multiple EBHR applications on the latex gloves and some of the nitrile gloves tested should be safe for Ebola PPE doffing based on the CDC guidance. Appropriate hospital staff practice using ABHR treatment and doffing gloves is recommended to become more familiar with changes in glove properties.

  18. Shear bond strength evaluation of resin composite to resin-modified glass-ionomer cement using three different resin adhesives vs. glass-ionomer based adhesive

    Directory of Open Access Journals (Sweden)

    Mostafa Sadeghi

    2015-12-01

    Full Text Available Background: The clinical success of sandwich technique depends on the strength of resin-modified glass ionomer cement (RMGIC bonding to both dentin and resin composite. Therefore, the shear bond strength (SBS of resin composite bonded to RMGIC utilizing different resin adhesives versus a GIC-based adhesive was compared. Materials and methods: In this in vitro study, 84 holes (5×2 mm were prepared in acrylic blocks, randomly divided into seven groups (n=12 and filled with RMGIC (Light-Cured Universal Restorative, GC. In the Group I; no adhesive was applied on the RMGIC. In the Group II, non-etched and Group III was etched with phosphoric acid. In groups II and III, after rinsing, etch-and-rinse adhesive (OptiBond Solo Plus; in the Group IV; a two-step self-etch adhesive (OptiBond XTR and in Group V; a one-step self-etch (OptiBond All-in-One were applied on the cement surfaces. Group VI; a GIC-based adhesive (Fuji Bond LC was painted over the cement surface and cured. Group VII; the GIC-based adhesive was brushed over RMGIC followed by the placement of resin composite and co-cured. Afterward; resin composite (Point 4 cylinders were placed on the treated cement surfaces. The specimens were placed in 100% humidity at 37 ± 1°C and thermo cycled. The shear bond test was performed at a cross-head speed of 1 mm/min and calculated in MPa; the specimens were examined to determine mode of failure. The results were analyzed using one-way ANOVA and Tukey test. Results: The maximum (24.62±3.70 MPa and minimum (18.15±3.38 MPa SBS mean values were recorded for OptiBond XTR adhesive and the control group, respectively. The pairwise comparisons showed no significant differences between the groups that bonded with different adhesives. The adhesive failure was the most common failure mode observed. Conclusion: This study suggests that GIC-based adhesive could be applied over RMGIC as co-cure technique for sandwich restorations in lieu of employing the resin

  19. Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes.

    Science.gov (United States)

    Garnier, Jérôme; Warnant, Jérôme; Lacroix-Desmazes, Patrick; Dufils, Pierre-Emmanuel; Vinas, Jérôme; van Herk, Alex

    2013-10-01

    Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl acrylate as a hydrophobic monomer and acrylic acid (AA) and/or 2-acrylamido-2-methylpropane sulfonic acid (AMPS) as hydrophilic monomers. After characterizing the adsorption of these macro-RAFT agents at the cerium oxide surface by UV-visible spectrometry, emulsion copolymerization reactions of styrene and methyl acrylate were then carried out in the presence of the surface-modified nanoceria. Dynamic Light Scattering and cryo-Transmission Electron Microscopy were employed to confirm the hybrid structure of the final CeO2/polymer latexes, and proved that the presence of acrylic acid units in amphiphatic macro-RAFT agents enabled an efficient formation of hybrid structures, while the presence of AMPS units, when combined with AA units, resulted in a better distribution of cerium oxide nanoclusters between latex particles. Copyright © 2013 Elsevier Inc. All rights reserved.

  20. Effect of Ascorbic Acid on Shear Bond Strength of Orthodontic Brackets Bonded with Resin-modified Glass-ionomer Cement to Bleached Teeth

    Directory of Open Access Journals (Sweden)

    Behnam Khosravanifard

    2012-04-01

    Full Text Available Background and aims. Bleaching can considerably reduce shear bond strength (SBS of orthodontic brackets bonded with composite adhesives. Application of antioxidants is a method to reverse the negative effect of bleaching on compositeto-enamel bond. However, the efficacy of antioxidants in increasing the SBS of brackets bonded using resin-modified glassionomer cement (RMGIC has not been studied, which was the aim of this study. Materials and methods. Fifty freshly extracted human maxillary first premolars were bleached with 35% hydrogen peroxide (Pola Office Bleaching, SDI. Sodium ascorbate 10% was applied to the experimental specimens (n=25. All the specimens were etched with 37% phosphoric acid (Ivoclar/Vivadent and bonded using RMGIC (Fuji Ortho LC, GC. The specimens were subjected to incubation (37°C, 24h and thermocycling (1000 cycles, 5-55°C, dwell time = 1 min. The SBS was measured at 0.5 mm/min debonding crosshead speed. The adhesive remnant index (ARI was scored under ×10 magnification. Data were analyzed using Mann-Whitney U test, one- and independent-samples t-test, and Fisher’s exact test (α=0.05. Results. The mean SBS of experimental and control groups were 11.97 ± 4.49 and 7.7 ± 3.19 MPa, respectively. The difference was statistically significant (P=0.000 by t-test. SBS of both control (P=0.014 and experimental (P=0.000 groups were significantly higher than the minimum acceptable SBS of 6 MPa, according to one-sample t-test. Conclusion. Application of ascorbic acid can guarantee a strong bond when RMGIC is to be used. However, RMGIC might tolerate the negative effect of bleaching with minimum SA treatments (or perhaps without treatments, which deserves further studies.

  1. Polybutadiene latex particle size distribution analysis utilizing a disk centrifuge

    NARCIS (Netherlands)

    Verdurmen, E.M.F.J.; Albers, J.G.; German, A.L.

    1994-01-01

    Polybutadiene (I) latexes prepd. by emulsifier-free emulsion polymn. and having particle diam. 50-300 nm for both unimodal and bimodal particles size distributions were analyzed by the line-start (LIST) method in a Brookhaven disk centrifuge photosedimentometer. A special spin fluid was designed to

  2. Marine bacterial prodigiosin as dye for rubber latex, polymethyl ...

    African Journals Online (AJOL)

    Prodigiosin is known for its immunomodulatory, antibacterial, antimycotic, antimalarial, algicidal and anticancer activities. Here, we reported the evaluation of prodigiosin pigment as a dyeing agent in rubber latex, paper and polymethyl methacrylate (PMMA) so that it can be considered as an alternative to synthetic pigments.

  3. Pilot scale experiments on radiation vulcanization of NR latex

    Science.gov (United States)

    Ridwan, M.

    The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accomodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components : emulsification unit ( height : 650 mm, diameter 500 mm ), mixing unit ( height : 1900mm, diameter 1200 mm ) and vulcanization reactor ( height : 1800 mm, diameter 1300 mm ). The first two components are located outside shielded room while the third one-in irradiation room. The radiation vulcanization process is a much simpler energy saving process comparedto the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR Latex are comparable to those of sulfur vulcanized, and depend on many factors such as irradiation dose, sensitizer content, dry rubber content and storage time.

  4. Oil-Acrylic hybrid latexes as binders for waterborne coatings

    NARCIS (Netherlands)

    Hamersveld, E.M.S.; Es, van J.J.G.S.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.

    1999-01-01

    The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying

  5. Oil-acrylic hybrid latexes as binders for waterborne coatings

    NARCIS (Netherlands)

    Hamersveld, van E.M.S.; Es, van J.; German, A.L.; Cuperus, F.P.; Weissenborn, P.; Hellgren, A.C.

    1999-01-01

    The combination of the characteristics of oil, or alkyd, emulsions and acrylic latexes in a waterborne binder has been the object of various studies in the past. Strategies for combining the positive properties of alkyds, e.g. autoxidative curing, gloss and penetration in wood, with the fast drying

  6. The construction and commissioning of MINT's latex irradiator

    International Nuclear Information System (INIS)

    Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Taiman Kadni

    1996-01-01

    The construction and installation of MINT's automatic continuous latex irradiator is described. MINT cooperated with NUKEM to design the plant. Construction was done by local building consultants and local contractor. The installation of the plant includes local fabrication components and imported components. The plant is automatically controlled by a computer system. Features of plant is described

  7. Pilot scale experiments on radiation vulcanization of NR latex

    International Nuclear Information System (INIS)

    Ridwan, M.

    1985-01-01

    The potential of irradiated latex as raw material of commercial use is under testing on pilot plant scale in Indonesia which has 225 kCi Co-60 irradiation facility and can irradiate 1000 tonnes of centrifuged latex per annum. The facility was jointly designed by BATAN of Indonesia and JAERI of Japan and was jointly financed by UNDP/IAEA, Government of Japan and Government of Indonesia under UNDP/IAEA Regional Cooperative Agreement Project on Industrial Application of Isotopes and Radiation Technology. The facility is a water pool type and can accommodate 400 kCi Co-60. The Co-60 rack has two shapes, plate and cylindrical shapes. The plate shape source is used for natural rubber latex irradiation and the cylindrical one is used for other irradiation services. The vulcanization system consists of three major components: emulsification unit, mixing unit and vulcanization reactor. The first two components are located outside shielded room while the third one in irradiation room. The radiation vulcanization process is a much simpler energy saving process compared to the conventional thermal process which has two vulcanization steps before and after dipping. The physical and mechanical properties of irradiated NR latex are comparable to those of sulfur vulcanized. (author)

  8. Study of glucoamylase immobilization in butadiene nitrile latex membrane

    International Nuclear Information System (INIS)

    Miller, E.

    1992-01-01

    Attempts have been undetaken to immobilize glucoamylaze by means of butadiene nitrile latex in the presence of a chemical initiator and 60 Co γ-radiation. The activity, stability of conjugates in the membrane and permeability of oxygen in these membranes were determined. (author) 14 refs.; 5 figs

  9. Acetylcholinesterase Inhibitory and Antioxidant Properties of Euphorbiacharacias Latex

    Directory of Open Access Journals (Sweden)

    Francesca Pintus

    2013-03-01

    Full Text Available The aim of the present study was to evaluate the acetylcholinesterase inhibitory capacity and the antioxidant properties of extracts of Euphorbia characias latex, a Mediterranean shrub. We performed a new extraction method involving the use of the trichloroacetic acid. The extract showed high antioxidant activity, was rich in total polyphenolic and flavonoid content and exhibited substantial inhibition of acetylcholinesterase activity.

  10. LaTeX - Know what you are missing

    Directory of Open Access Journals (Sweden)

    Gunther Maier

    2016-11-01

    Full Text Available This article gives a brief introduction to \\LaTeX\\ and related tools. The aim is to give an overview, to demonstrate the flexibility and versatility of the software, and to assist the reader taking first steps using it. The article links to a number of valuable resources for further information.

  11. Latex allergy in an infant with acquired hydrocephalus | Ehiozw ...

    African Journals Online (AJOL)

    We report the case of a 3 month old male infant with acquired hydrocephalus undergoing ventriculo-peritoneal shunt insertion who developed wheals and suffered a respiratory arrest following contact with latex gloves. The need for anaesthetists to effectively diagnose and properly manage this rare clinical entity is ...

  12. Natural rubber latex: determination and interpretation of flow curves

    Directory of Open Access Journals (Sweden)

    Harrison Lourenço Corrêa

    2015-08-01

    Full Text Available AbstractAs consumers become more demanding, the importance grows of guaranteeing the quality of products. The employment of reliable testing techniques that assure the origin and characteristics of the inputs used by industry is a key factor in this respect. In the rubber processing industry, the most commonly used characterization tests include determination of the total solids and dry rubber content, mechanical stability, odor, color and presence of volatile compounds, among others. For the most part, these tests are sufficient for the latex transformation industry. However, in situations where there is a need to know the behavior of latex in reaction to the mechanical forces of machines (mixers, pumps, etc., other tests must be used. Rheological tests to determine viscoelastic data by means of plotting flow curves combined with the application of theoretical models can provide important details for characterization of different types of latex. This article presents the protocol employed by the Rheology and Image Laboratory of Rio de Janeiro State University (UERJ for the rheological study of Brazilian latex. The samples analyzed came from the state of São Paulo.

  13. Partial swelling of latex particles by two monomers

    NARCIS (Netherlands)

    Noel, E.F.J.; Maxwell, I.A.; German, A.L.

    1993-01-01

    The swelling of polymeric latex particles with solvent and monomer is of great importance for the emulsion polymn. process in regard to compn. drift and rate of polymn. For the monomer combination, Me acrylate-vinyl acetate, both satn. and partial swelling were detd. exptl. Theories for satn.

  14. Ten years incidence of natural rubber latex sensitization and symptoms in a prospective cohort of health care workers using non-powdered latex gloves 2000-2009.

    Science.gov (United States)

    Larese Filon, Francesca; Bochdanovits, Letizia; Capuzzo, Chiara; Cerchi, Roberto; Rui, Francesca

    2014-07-01

    To assess the incidence of sensitization and gloves-related symptoms in 10-year follow-up in a group of health care workers (9,660 person-years) using non-powdered latex gloves from 2000 to 2009 and to examine related factors. We studied 2,053 health care workers in Trieste Hospitals by means of skin prick test for latex extract, patch tests and medical examinations. We report the incidence of latex sensitization among workers using non-powdered latex gloves. The incidence of latex sensitization, rhinitis, asthma, urticaria, irritant and allergic contact dermatitis were 1.0; 0.12; 0.21; 0.72; 2.39 and 2.50 cases per 1,000 person-years, respectively. Respiratory symptoms and urticaria were positively related with latex sensitization (OR = 8.0; 95 % CL 1.27-48.6), with common allergic respiratory symptoms (OR = 4.19; 95 % CL 1.04-16.8) and with familial atopy (OR = 4.47; 95 % CL 1.1-17.9). The incidence of latex sensitization and latex-related symptoms were very low but subjects with allergic symptoms related to common allergens are at higher risk. The use of non-latex gloves is suggested for them.

  15. A test trial irradiation of natural rubber latex on large scale for the production of examination gloves in a production scale

    International Nuclear Information System (INIS)

    Devendra, R.; Kulatunge, S.; Chandralal, H.N.K.K.; Kalyani, N.M.V.; Seneviratne, J.; Wellage, S.

    1996-01-01

    Radiation Vulcanization of natural rubber latex has been developed extensively through various research and development programme. During these investigations many data was collected and from these data it was proved that radiation vulcanized natural rubber latex (RVNRL) can be used as a new material for industry (RVNRL symposium 1989; Makuuchi IAEA report). This material has been extensively tested in making of dipped goods and extruded products. However these investigations were confined only to laboratory experiments and these experiments mainly reflected material properties of RVNRL and only a little was observed about its behavior in actual production scale operation. The present exercise was carried out mainly to study the behavior of the material in production scale by irradiating latex on a large scale and producing gloves in a production scale plant. It was found that RVNRL can be used in conventional glove plants without making major alteration to the plant. Quality of the gloves that were produced using RVNRL is acceptable. It was also found that the small deviation of vulcanization dose will affect the crosslinking density of films. This will drastically reduce the tensile strength of the film. Crosslinking density or pre-vulcanized relax modulus (PRM) at 100% is a reliable property to control the pre vulcanization of latex by radiation

  16. Alergia látex-fruta Latex-fruit allergy

    Directory of Open Access Journals (Sweden)

    Flávia Andréia MARIN

    2002-01-01

    Full Text Available O látex está sendo considerado o alergênico do ano 2000, tendo em vista que inúmeros indivíduos, principalmente profissionais da área de saúde e pacientes submetidos a várias intervenções diagnósticas e terapêuticas, estão freqüentemente expostos aos alérgenos do látex, presentes em produtos de borracha natural. As manifestações clínicas conseqüentes às reações alérgicas de hipersensibilidade imediata vão desde rinite, urticária, conjuntivite, angioedema, asma, até anafilaxia. Estudos recentes estão demonstrando que pacientes alérgicos ao látex desenvolvem concomitantemente sensibilização a certos alimentos de origem vegetal, especialmente frutas como papaia, figo, banana, abacate, kiwi, pêssego, abacaxi, melão e castanha, acreditando-se numa provável ocorrência de reações cruzadas entre os alérgenos do látex e destas frutas. Faz-se, então, uma revisão sobre a alergia ao látex, em particular sobre os grupos de risco, incluindo a presença de reatividade cruzada entre o látex e as frutas.The latex is being considered the allergenic agent of the year 2000, taking into account that several individuals, mainly health care professionals, and patients who had undergone many diagnostic and therapeutic interventions, are frequently exposed to latex allergens, which are present in natural rubber latex products. The clinical manifestations, derived from allergic reactions of immediate hypersensitivity vary from since rhinitis, conjunctivitis, urticaria, angioedema, asthma, to anaphylaxis. Recent researches are demonstrating that patients allergic to latex develop concomitantly sensitization to certain vegetable foods, especially fruits like papaya, fig, banana, avocado, kiwi, peach, pineapple, melon and chestnut, and a probable occurrence of cross reaction between allergens of latex and of these fruits is believed. A review is made about latex allergy, in particular about risk groups, including the presence of

  17. Graft Copolymerization of Methyl Methacrylate Monomer onto Starch and Natural Rubber Latex Initiated by Gamma Irradiation

    Directory of Open Access Journals (Sweden)

    S. Iskandar

    2011-04-01

    Full Text Available To obtain the degradable plastic, the graft copolymerization of methyl methacrylate onto starch and natural rubber latex was conducted by a simultaneous irradiation technique. Gamma-ray from cobalt-60 source was used as the initiator. The grafted copolymer of starch-polymethyl methacrylate and the grafted copolymer of natural rubber-polymethyl methacrylate were mixed in the blender, and dried it in the oven. The dried grafted copolymer mixture was then molded using hydraulic press machine. The effect of irradiation dose, composition of the grafted copolymer mixture, film forming condition and recycle effect was evaluated. The parameters observed were tensile strength, gel fraction and soil burial degradability of grafted copolymer mixture. It was found that the tensile strength of grafted copolymer mixture increased by -ray irradiation. Increasing of the grafted copolymer of natural rubber-polymethyl methacrylate content, the gel fraction and tensile strength of the grafted copolymer mixture increased. The tensile strength of the grafted copolymer mixture was increased from 18 MPa to 23 MPa after recycled (film forming reprocessed 3 times. The grafted copolymer mixture was degraded completely after soil buried for 6 months

  18. Bond Characteristics of Macro Polypropylene Fiber in Cementitious Composites Containing Nanosilica and Styrene Butadiene Latex Polymer

    Directory of Open Access Journals (Sweden)

    Jae-Woong Han

    2015-01-01

    Full Text Available This study evaluated the bond properties of polypropylene (PP fiber in plain cementitious composites (PCCs and styrene butadiene latex polymer cementitious composites (LCCs at different nanosilica contents. The bond tests were evaluated according to JCI SF-8, in which the contents of nanosilica in the cement were 0, 2, 4, 6, 8, and 10 wt%, based on cement weight. The addition of nanosilica significantly affected the bond properties between macro PP fiber and cementitious composites. For PCCs, the addition of 0–2 wt% nanosilica enhanced bond strength and interface toughness, whereas the addition of 4 wt% or more reduced bond strength and interface toughness. The bond strength and interfacial toughness of LCCs also increased with the addition of up to 6% nanosilica. The analysis of the relative bond strength showed that the addition of nanosilica affects the bond properties of both PCC and LCC. This result was confirmed via microstructural analysis of the macro PP fiber surface after the bond tests, which revealed an increase in scratches due to frictional forces and fiber tearing.

  19. Application of radiation vulcanized natural rubber latex in Indonesia

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Wiwik Sofiarti; Razzak, M.T.

    1996-01-01

    The center has carried out R and D of Radiation Vulcanization Natural Rubber Latex (RVNRL) technology and introduced it to the industries since the inauguration and operation of the latex pilot plant in 1983. After years of experiences and the environmental consideration, n-butylacrylate (n-BA) has replaced CCI, as the sensitizer. Until now the introduction program shows that radiation vulcanized latex is more suitable for home industries than large industries. The obstacle of the program is the marketing of the dipped products. In spite of these problems, the introduction of this technology to the people in some undeveloped area of Java has supported the national program to improve their living standard. The problems of nitrosamine and protein allergic have turn up RVNRL to be the substitute of sulfur vulcanized latex in the future. The cooperation with a national condom manufacturer (PT Mitra Banjaran) has applied RVNRL for condom production in the large scale. Soft condoms with less probability of pinhole are obtained, but the technical problem is stickiness after pilling. Supply to a baby teat and a rubber thread manufacturer offers great advantages by not using any chemicals. In spite of the advantages, the problem of latex viscosity for dipping and the low modulus of elasticity of the threads arise. Through those input CAIR-BATAN is conducting the research and development in improving the crosslinking among the rubber particles that are supposed to be the reason of the stickiness and low modulus of elasticity. This effort is expected to be able to broaden the application of RVNRL, and it will be achieved only by the involvement of rubber chemist, rubber technologist, and radiation chemist

  20. Reliability of maximal isometric knee strength testing with modified hand-held dynamometry in patients awaiting total knee arthroplasty: useful in research and individual patient settings? A reliability study

    Directory of Open Access Journals (Sweden)

    Koblbauer Ian FH

    2011-10-01

    Full Text Available Abstract Background Patients undergoing total knee arthroplasty (TKA often experience strength deficits both pre- and post-operatively. As these deficits may have a direct impact on functional recovery, strength assessment should be performed in this patient population. For these assessments, reliable measurements should be used. This study aimed to determine the inter- and intrarater reliability of hand-held dynamometry (HHD in measuring isometric knee strength in patients awaiting TKA. Methods To determine interrater reliability, 32 patients (81.3% female were assessed by two examiners. Patients were assessed consecutively by both examiners on the same individual test dates. To determine intrarater reliability, a subgroup (n = 13 was again assessed by the examiners within four weeks of the initial testing procedure. Maximal isometric knee flexor and extensor strength were tested using a modified Citec hand-held dynamometer. Both the affected and unaffected knee were tested. Reliability was assessed using the Intraclass Correlation Coefficient (ICC. In addition, the Standard Error of Measurement (SEM and the Smallest Detectable Difference (SDD were used to determine reliability. Results In both the affected and unaffected knee, the inter- and intrarater reliability were good for knee flexors (ICC range 0.76-0.94 and excellent for knee extensors (ICC range 0.92-0.97. However, measurement error was high, displaying SDD ranges between 21.7% and 36.2% for interrater reliability and between 19.0% and 57.5% for intrarater reliability. Overall, measurement error was higher for the knee flexors than for the knee extensors. Conclusions Modified HHD appears to be a reliable strength measure, producing good to excellent ICC values for both inter- and intrarater reliability in a group of TKA patients. High SEM and SDD values, however, indicate high measurement error for individual measures. This study demonstrates that a modified HHD is appropriate to

  1. A novel arctigenin-containing latex glove prevents latex allergy by inhibiting type I/IV allergic reactions.

    Science.gov (United States)

    Wang, Yong-Xin; Xue, Dan-Ting; Liu, Meng; Zhou, Zheng-Min; Shang, Jing

    2016-03-01

    The present study aimed at developing a natural compound with anti-allergic effect and stability under latex glove manufacturing conditions and investigating whether its anti-allergic effect is maintained after its addition into the latex. The effects of nine natural compounds on growth of the RBL-2H3 cells and mouse primary spleen lymphocytes were determined using MTT assay. The compounds included glycyrrhizin, osthole, tetrandrine, tea polyphenol, catechin, arctigenin, oleanolic acid, baicalin and oxymatrine. An ELISA assay was used for the in vitro anti-type I/IV allergy screening; in this process β-hexosaminidase, histamine, and IL-4 released from RBL-2H3 cell lines and IFN-γ and IL-2 released from mouse primary spleen lymphocytes were taken as screening indices. The physical stability of eight natural compounds and the dissolubility of arctigenin, selected based on the in vitro pharnacodynamaic screening and the stability evaluation, were detected by HPLC. The in vivo pharmacodynamic confirmation of arctigenin and final latex product was evaluated with a passive cutaneous anaphylaxis (PCA) model and an allergen-specific skin response model. Nine natural compounds showed minor growth inhibition on RBL-2H3 cells and mouse primary spleen lymphocytes. Baicalin and arctigenin had the best anti-type I and IV allergic effects among the natural compounds based on the in vitro pharmacodynamic screening. Arctigenin and catechin had the best physical stability under different manufacturing conditions. Arctigenin was the selected for further evaluation and proven to have anti-type I and IV allergic effects in vivo in a dose-dependent manner. The final product of the arctigenin-containing latex glove had anti-type I and IV allergic effects in vivo which were mainly attributed to arctigenin as proved from the dissolubility results. Arctigenin showed anti-type I and IV allergic effects in vitro and in vivo, with a good stability under latex glove manufacturing conditions

  2. LOL2 and LOL5 loci control latex production by laticifer cells in Euphorbia lathyris.

    Science.gov (United States)

    Castelblanque, Lourdes; Balaguer, Begoña; Marti, Cristina; Orozco, Marianela; Vera, Pablo

    2018-06-07

    Laticifers are specialized plant cells capable of indefinite elongation that ramify extensively and are responsible for latex biosynthesis and accumulation. However, the mechanisms underlying laticifer cell differentiation, growth and production of latex remain largely unknown. In a search for mutants showing enhanced accumulation of latex we identified two LOT OF LATEX (LOL) loci in Euphorbia lathyris. lol2 and lol5 mutants show enhanced production of latex contained within laticifer cells. The recessive lol2 mutant carries increased biosynthesis of the plant hormone jasmonoyl-isoleucine (JA-Ile) and therefore establishes a genetic link between jasmonic acid (JA) signaling and latex production in laticifers. Instead, heightened production of latex in lol5 plants obeys to enhanced proliferation of laticifer cells. Phylogenetic analysis of laticifer-expressed genes in E. lathyris and in two other latex-bearing species, Euphorbia corallioides and Euphorbia palustris, allowed the identification of canonical JA responsive elements present in the gene promoter regions of laticifer marker genes. Moreover, we identified that the hormone JA functions not as a morphogen for laticifer differentiation but as a trigger for the fill out of laticifers with latex and the associated triterpenoids. The identification of LOL loci represents a further step towards the understanding of mechanisms controlling latex production in laticifer cells. No claim to original US Government works New Phytologist © 2018 New Phytologist Trust.

  3. Mechanical and Physical Studies on Different Doses of Radiation Pre vulcanized Natural Rubber Latex (RVNRL)

    International Nuclear Information System (INIS)

    Syuhada Ramli; Sofian Ibrahim; Muhammad Saiful Omar; Mohd Noorwadi Mat Lazim; Khairul Hisyam Mohamed Yusof; Najib Mohammmad Zakey; Hafizuddin Maseri

    2014-01-01

    RVNRL mixture of 12 kGy (RVNRL12) and 25 kGy (RVNRL25) at different blending ratios were prepared by stirring the mixture using a magnetic stirrer RVNRL at a speed of 1-3 rpm overnight to get the dough consistency. RVNRL12 with RVNRL25 attendance at a ratio of 90:10, 80:20, 70:30, 60:40 and 50:50 investigated. The study of physical and mechanical properties of 12/ 25 blends RVNRL performed on film samples prepared by immersion method coagulant. RVNRL25 result of the addition of the mixture RVNRL12 showed an increase in tensile strength mixture ratio of 90:10 RVNRL12 / RVNRL25 and tensile strength are declining at a ratio higher RVNRL25 content. Increase the tensile strength was found to increase due to the impact of lower doses of dough RVNRL12 and RVNRL25. This shows that blending RVNRL lower doses help improve the physical properties of latex due to exposure dose exceeding the dose required RVNRL. (author)

  4. Osmotic de-swelling and swelling of latex dispersions

    International Nuclear Information System (INIS)

    Bonnet-Gonnet, Cecile

    1993-01-01

    This research thesis reports the comparison of, on the one hand, direct measurements of de-swelling resistance of latex dispersions obtained by osmotic pressure with, on the other hand, predictions made by models of electrostatic interactions. This resistance is explained in the case of sulphate-stabilised polystyrene particles (direct repulsion between charged particles), and in the case of copolymer (ps-pba) particles covered by an amphiphilic polymer (interactions between surface macromolecules and polymers). The study of de-swelling and swelling cycles highlights the existence of thresholds beyond which the concentrated dispersion has some cohesion. This irreversibility can be modelled by a Van der Waals attraction. The role of hydrophobic forces in latex destabilisation is studied [fr

  5. Extractable protein of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Upul, R.M.; Makuuchi, K.; Yoshii, F.; Kume, T.

    2000-01-01

    A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)

  6. [Anaphylactic reaction to latex during spinal anesthesia: a case report].

    Science.gov (United States)

    Ueda, Narumi; Kitamura, Rie; Wakamori, Takeshi; Nakamura, Kumi; Konishi, Keisuke

    2008-05-01

    A 46-year-old man, with a history of atopic dermatitis and bronchial asthma, underwent surgery for an inguinal hernia. Forty-three minutes subsequent to spinal anesthesia, the patient complained suddenly of dyspnea with wheezing. Blood pressure decreased and skin eruption was observed on his chest. Postoperative laboratory tests revealed high IgE concentration, and a skin test confirmed an allergy to latex. The patient's allergic reaction was easily overlooked because of his history of bronchial asthma and the possibility that the hypotension was caused by the high spinal anesthesia. Latex allergy should be considered in any suspicious case presenting with these symptoms during surgery. After recovery, a skin test should be used to confirm the allergy to avoid repeated allergic episodes.

  7. Extractable protein content of radiation vulcanized natural rubber latex films

    International Nuclear Information System (INIS)

    Ma'zam Md Said; Wan Manshol Wan Zin

    1996-01-01

    The effects of processing conditions on extractable protein content of coagulant dipped radiation vulcanized natural rubber latex films have been investigated. Drying of wet-gel of radiation vulcanized latex films even at a relatively low temperature of 70 degree C resulted in increases of extractable protein content of the films. The extractable protein content is dependent upon both the temperature and time of drying of wet-gel deposit. Wet-gel leaching of film alone is not adequate to reduce the extractable protein content of films to low levels. Combination of wet-gel leaching, post-leaching, a dip in corn starch slurry, followed by drying at a low temperature of 70 degree C reduces the extractable protein content of films to very low levels

  8. Extractable protein of radiation vulcanized natural rubber latex

    Energy Technology Data Exchange (ETDEWEB)

    Soebianto, Y.S. [Center for Research and Development of Isotopes and Radiation Technology, BATAN, Jakarta (Indonesia); Upul, R.M. [Rubber Research Institute of Sri Lanka, Ratmalana (Sri Lanka); Makuuchi, K.; Yoshii, F.; Kume, T. [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment

    2000-03-01

    A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) as much as 3 phr in three different processes: added to RVNRL, added to re-centrifuged RVNRL, and added to RVNRL followed by centrifugation. The protein content was determined by enhanced BCA method, and identified by SDS-PAGE analysis. Addition of WSP followed by centrifugation reduces EP up to the minimum protein detection, and shortens the leaching time to 20-30 min. SDS-PAGE analysis confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The molecular weight of WSP dictates the efficiency of protein removal. (author)

  9. The efficacy of modified direct lateral versus posterior approach on gait function and hip muscle strength after primary total hip arthroplasty at 12months follow-up

    DEFF Research Database (Denmark)

    Rosenlund, Signe; Broeng, Leif; Overgaard, Søren

    2016-01-01

    -spatial parameters and range of motion. Isometric maximal hip muscle strength in abduction, flexion and extension was also tested. FINDINGS: Post-operatively, no between-group difference in gait function was observed. However, both hip abductor and flexor muscle strength improved more in the posterior approach group......BACKGROUND: The lateral and the posterior approach are the most commonly used procedures for total hip arthroplasty. Due to the detachment of the hip abductors, lateral approach is claimed to cause reduced hip muscle strength and altered gait pattern. However, this has not been investigated...... in a randomised controlled trial. The aim was to compare the efficacy of total hip arthroplasty performed by lateral or posterior approach on gait function and hip muscle strength up to 12months post-operatively. We hypothesised that posterior approach would be superior to lateral approach. METHODS: Forty...

  10. A latex metabolite benefits plant fitness under root herbivore attack

    OpenAIRE

    Huber, M.; Epping, J.; Gronover, C.S.; Fricke, J.; Aziz, Z.; Brillatz, T.; Swyers, M.; Köllner, T.G.; Vogel, H.; Hammerbacher, A.; Triebwasser-Freese, D.; Robert, C.A.M.; Verhoeven, K.; Preite, V.; Gershenzon, J.

    2016-01-01

    Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major n...

  11. Radiation vulcanised natural rubber latex (RVNRL) market and challenges

    International Nuclear Information System (INIS)

    Wan Manshol Wan Zin; Najib Mohamad Zakey; Chai Chee Keong

    2000-01-01

    RVNRL has the required properties and proven useful for the manufacturing of examination gloves, balloons and finger cots at industrial scale. To date only RVNRL finger cots are available in the market. Problems and challenges for the market of other products are identified. Further success in the on going research activities will be the reference for more applications of RVNRL in the relevant industry to produce natural rubber latex products of more competitive values

  12. Minimizing surgical skin incision scars with a latex surgical glove.

    Science.gov (United States)

    Han, So-Eun; Ryoo, Suk-Tae; Lim, So Young; Pyon, Jai-Kyung; Bang, Sa-Ik; Oh, Kap-Sung; Mun, Goo-Hyun

    2013-04-01

    The current trend in minimally invasive surgery is to make a small surgical incision. However, the excessive tensile stress applied by the retractors to the skin surrounding the incision often results in a long wound healing time and extensive scarring. To minimize these types of wound problems, the authors evaluated a simple and cost-effective method to minimize surgical incision scars based on the use of a latex surgical glove. The tunnel-shaped part of a powder-free latex surgical glove was applied to the incision and the dissection plane. It was fixed to the full layer of the dissection plane with sutures. The glove on the skin surface then was sealed with Ioban (3 M Health Care, St. Paul, MN, USA) to prevent movement. The operation proceeded as usual, with the retractor running through the tunnel of the latex glove. It was possible to complete the operation without any disturbance of the visual field by the surgical glove, and the glove was neither torn nor separated by the retractors. The retractors caused traction and friction during the operation, but the extent of damage to the postoperative skin incision margin was remarkably less than when the operation was performed without a glove. This simple and cost-effective method is based on the use of a latex surgical glove to protect the surgical skin incision site and improve the appearance of the postoperative scar. This journal requires that authors assign a level of evidence to each article. For a full description of these Evidence-Based Medicine ratings, please refer to the Table of Contents or the online Instructions to Authors www.springer.com/00266 .

  13. The criteria and the design of MINT's latex irradiator

    International Nuclear Information System (INIS)

    Razali Hamzah; Muhd Khairi Muhd Said; Muhd Ariff Hamzah; Wan Manshol Wan Zin; Wan Abd Hadi Wan Abu Bakar; Muhd Noor Muhd Yunus

    1996-01-01

    The demand for RVNRL is continually on the upsurge and the present irradiation technique at the present SINAGAMA plant is not sufficient and practical to meet the demand. A number of conceptual designs were evolved to design according to the requirements of cost-effective and highly efficient plant. The number of options are described. In 1994 MINT work with NUKEM to build an automatic continuous latex irradiation plant

  14. The polymerization of aniline in polystyrene latex particles

    Czech Academy of Sciences Publication Activity Database

    Blinova, Natalia V.; Reynaud, S.; Roby, F.; Trchová, Miroslava; Stejskal, Jaroslav

    2010-01-01

    Roč. 160, 15/16 (2010), s. 1598-1602 ISSN 0379-6779 R&D Projects: GA AV ČR IAA400500905; GA ČR GA203/08/0686; GA ČR GA202/09/1626 Institutional research plan: CEZ:AV0Z40500505 Keywords : polyaniline * polystyrene latex * polyaniline-polystyrene composite Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.871, year: 2010

  15. Comparative evaluation of tensile bond strength and microleakage of conventional glass ionomer cement, resin modified glass ionomer cement and compomer: An in vitro study.

    Science.gov (United States)

    Rekha, C Vishnu; Varma, Balagopal; Jayanthi

    2012-07-01

    The purpose of this study was to evaluate and compare the tensile bond strength and microleakage of Fuji IX GP, Fuji II LC, and compoglass and to compare bond strength with degree of microleakage exhibited by the same materials. Occlusal surfaces of 96 noncarious primary teeth were ground perpendicular to long axis of the tooth. Preparations were distributed into three groups consisting of Fuji IX GP, Fuji II LC and Compoglass. Specimens were tested for tensile bond strength by mounting them on Instron Universal Testing Machine. Ninety-six primary molars were treated with Fuji IX GP, Fuji II LC, and compoglass on box-only prepared proximal surface. Samples were thermocycled, stained with dye, sectioned, and scored for microleakage under stereomicroscope. ANOVA and Bonferrani correction test were done for comparisons. Pearson Chi-square test and regression analysis were done to assess the association between the parameters. Compoglass showed highest tensile strength and Fuji II LC showed least microleakage. There was a significant difference between the three groups in tensile strength and microleakage levels. The correlation between tensile strength and microleakage level in each group showed that there was a significant negative correlation only in Group 3. Fuji II LC and compoglass can be advocated in primary teeth because of their superior physical properties when compared with Fuji IX GP.

  16. Comparative evaluation of tensile bond strength and microleakage of conventional glass ionomer cement, resin modified glass ionomer cement and compomer: An in vitro study

    Directory of Open Access Journals (Sweden)

    C Vishnu Rekha

    2012-01-01

    Full Text Available Aim: The purpose of this study was to evaluate and compare the tensile bond strength and microleakage of Fuji IX GP, Fuji II LC, and compoglass and to compare bond strength with degree of microleakage exhibited by the same materials. Materials and Methods: Occlusal surfaces of 96 noncarious primary teeth were ground perpendicular to long axis of the tooth. Preparations were distributed into three groups consisting of Fuji IX GP, Fuji II LC and Compoglass. Specimens were tested for tensile bond strength by mounting them on Instron Universal Testing Machine. Ninety-six primary molars were treated with Fuji IX GP, Fuji II LC, and compoglass on box-only prepared proximal surface. Samples were thermocycled, stained with dye, sectioned, and scored for microleakage under stereomicroscope. ANOVA and Bonferrani correction test were done for comparisons. Pearson Chi-square test and regression analysis were done to assess the association between the parameters. Results: Compoglass showed highest tensile strength and Fuji II LC showed least microleakage. There was a significant difference between the three groups in tensile strength and microleakage levels. The correlation between tensile strength and microleakage level in each group showed that there was a significant negative correlation only in Group 3. Conclusion: Fuji II LC and compoglass can be advocated in primary teeth because of their superior physical properties when compared with Fuji IX GP.

  17. CDNA library from the Latex of Hevea brasiliensis

    Directory of Open Access Journals (Sweden)

    Wilaiwan Chotigeat

    2010-12-01

    Full Text Available Latex from Hevea brasiliensis contains 30-50% (w/w of natural rubber (cis-1,4-polyisoprene, the important rawmaterial for many rubber industries. We have constructed a cDNA library from the latex of H. brasiliensis to investigate theexpressed genes and molecular events in the latex. We analyzed 412 expressed sequence tags (ESTs. More than 90% of theEST clones showed homology to previously described sequences in public databases. Functional classification of the ESTsshowed that the largest category were proteins of unknown function (30.1%, 11.4% of ESTs encoded for rubber synthesisrelatedproteins (RS and 8.5% for defense or stress related proteins (DS. Those with no significant homology to knownsequences (NSH accounted for 8.7%, primary metabolism (PM and gene expression and RNA metabolism were 7.8% and6.6%, respectively. Other categories included, protein synthesis-related proteins (6.6%, chromatin and DNA metabolism(CDM 3.9%, energy metabolism (EM 3.4%, cellular transport (CT 3.2%, cell structure (CS 3.2%, signal transduction (ST2.2%, secondary metabolism (SM 1.7%, protein fate (PF 2.2%, and reproductive proteins (RP 0.7%.

  18. Identification and characterization of Euphorbia nivulia latex proteins.

    Science.gov (United States)

    Badgujar, Shamkant B; Mahajan, Raghunath T

    2014-03-01

    The protein profile of latex of Euphorbia nivulia Buch.-Ham. is established. Three new proteins viz., Nivulian-I, II and III have been purified to homogeneity from the latex. The relative molecular masses of Nivulian-I, II and III are 31,486.985, 43,670.846 and 52,803.470 Da respectively. Nivulian-I is a simple type of protein while Nivulian-II and III are glycoproteins. Peptide mass fingerprint analysis revealed peptides of these proteins match with Tubulin alpha-1 chain of Eleusine indica, Maturase K of Banksia quercifolia and hypothetical protein of Zea mays respectively. Tryptic digestion profile of Nivulian-I, II and III, infer the exclusive nature of latex origin proteins and may be new and are additive molecules in the dictionaries of phytoproteins or botany. This is the first of its kind, regarding characterization and validation of Nivulian-I, II and III with respect to peptide sequencing. Copyright © 2013 Elsevier B.V. All rights reserved.

  19. Efficacy of protection by latex gloves during orthodontic therapy.

    Science.gov (United States)

    Doll, G M; Zentner, A; Balan, R; Sergl, H G

    2000-01-01

    The wearing of gloves during orthodontic or dental treatment is generally indicated for reasons of hygiene and protection against infection. This study was aimed at determining the extent and localization of perforations caused by the various orthodontic treatment techniques and interrupting the infection barrier. The impermeability was tested by means of a water retention test according to European standard EN 455, Part 1, performed on 1600 Centramed (Centramed, Koblenz), Tekmedic and SafeEx non-sterile disposable latex gloves (both by Safe Med, Switzerland) and Safe Gan latex gloves with an additional acrylate coating (also by Safe Med). The perforation rate in unused gloves was between 0.5% and 7.5%, rising on average to 11% with increasing use. 36% of the total number of lesions resulted from handling removable appliances, and 57% from handling fixed appliances, especially when replacing arch wires and elastics. Most lesions were in the thumb, index finger and palm region. Only 18% of the defects were noticed by the dentists themselves. The gloves worn by beginners in their first year of postgraduate orthodontic training had about twice as many defects as those worn by qualified orthodontists. When patients with an increased risk of infection are to be treated, additional hand disinfection measures should be taken and 2 pairs of gloves worn in view of the relatively unreliable protection offered by commercially available latex gloves.

  20. Extractable protein of radiation vulcanized natural rubber latex

    International Nuclear Information System (INIS)

    Soebianto, Y.S.; Ratnayake, U.M.; Makuuchi, Keizo; Yoshii, Fumio; Kume, Tamikazu

    2000-01-01

    Protein remained in the latex products are reported to cause serious allergy. A new method to reduce the protein level in the latex products by irradiation is reported. Water soluble protein (WSP) solution (10%) was added into radiation vulcanized NR latex (RVNRL) in three different processes. The amount of WSP was 3 phr. It was only added to RVNRL (standard), added to re-centrifuged RVNRL (pre-centrifugation), and added to RVNRL followed by centrifugation (post-centrifugation). The protein content was determined by enhanced BCA method, and identified by SDS-PAGE. Extractable protein (EP) from the rubber has been reduced up to the minimum protein detection by combining WSP addition and centrifugation. Short leaching time (20-30 min.) can be achieved after the combine treatment, and SDS-PAGE confirms the reduction of soluble protein in the serum phase, and disappearance of protein bands in the rubber extract. Protein-WSP interaction produces water soluble complex, and removed by centrifugation. The efficiency of protein removal by WSP depends on its molecular weight of WSP which relates to its water solubility. (author)

  1. Histamine mediates the pro-inflammatory effect of latex of Calotropis procera in rats

    Directory of Open Access Journals (Sweden)

    Yatin M. Shivkar

    2003-01-01

    Full Text Available Introduction: Calotropis procera is known to produce contact dermatitis and the latex of this plant produces intense inflammation when injected locally. However, the precise mode of its pro-inflammatory effect is not known. In present study we have pharmacologically characterized the inflammation induced by latex of C. procera in a rat paw edema model and determined the role of histamine in latex-induced inflammation.

  2. Associations Between Diabetes and Both Cardiovascular Disease and All-Cause Mortality Are Modified by Grip Strength: Evidence From UK Biobank, a Prospective Population-Based Cohort Study.

    Science.gov (United States)

    Celis-Morales, Carlos A; Petermann, Fanny; Hui, Li; Lyall, Donald M; Iliodromiti, Stamatina; McLaren, James; Anderson, Jana; Welsh, Paul; Mackay, Daniel F; Pell, Jill P; Sattar, Naveed; Gill, Jason M R; Gray, Stuart R

    2017-12-01

    Grip strength and diabetes are predictors of mortality and cardiovascular disease (CVD), but whether these risk factors interact to predispose to adverse health outcomes is unknown. This study determined the interactions between diabetes and grip strength and their association with health outcomes. We undertook a prospective, general population cohort study by using UK Biobank. Cox proportional hazards models were used to explore the associations between both grip strength and diabetes and the outcomes of all-cause mortality and CVD incidence/mortality as well as to test for interactions between diabetes and grip strength. A total of 347,130 UK Biobank participants with full data available (mean age 55.9 years, BMI 27.2 kg/m 2 , 54.2% women) were included in the analysis, of which 13,373 (4.0%) had diabetes. Over a median follow-up of 4.9 years (range 3.3-7.8 years), 6,209 died (594 as a result of CVD), and 4,301 developed CVD. Participants with diabetes were at higher risk of all-cause and CVD mortality and CVD incidence. Significant interactions ( P strength. Similar results were observed for all-cause mortality and CVD incidence. Risk of adverse health outcomes among people with diabetes is lower in those with high grip strength. Low grip strength may be useful to identify a higher-risk subgroup of patients with diabetes. Intervention studies are required to determine whether resistance exercise can reduce risk. © 2017 by the American Diabetes Association.

  3. Controlling adsorption of albumin with hyaluronan on silica surfaces and sulfonated latex particles.

    Science.gov (United States)

    Berts, Ida; Fragneto, Giovanna; Porcar, Lionel; Hellsing, Maja S; Rennie, Adrian R

    2017-10-15

    Polysaccharides are known to modify binding of proteins at interfaces and this paper describes studies of these interactions and how they are modified by pH. Specifically, the adsorption of human serum albumin on to polystyrene latex and to silica is described, focusing on how this is affected by hyaluronan. Experiments were designed to test how such binding might be modified under relevant physiological conditions. Changes in adsorption of albumin alone and the co-adsorption of albumin and hyaluronan are driven by electrostatic interactions. Multilayer binding is found to be regulated by the pH of the solution and the molecular mass and concentration of hyaluronan. Highest adsorption was observed at pH below 4.8 and for low molecular mass hyaluronan (≤150kDa) at concentrations above 2mgml -1 . On silica with grafted hyaluronan, albumin absorption is reversed by changes in solvent pH due to their strong electrostatic attraction. Albumin physisorbed on silica surfaces is also rinsed away with dilute hyaluronan solution at pH 4.8. The results demonstrate that the protein adsorption can be controlled both by changes of pH and by interaction with other biological macromolecules. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Latex agglutination test (LAT) for the diagnosis of typhoid fever.

    Science.gov (United States)

    Sahni, Gopal Shankar

    2013-06-01

    The efficacy of latex agglutination test in the rapid diagnosis of typhoid fever was studied and the result compared with that of blood culture. This study included 80 children suffering from typhoid fever, among which 40 were confirmed by blood culture isolation and 40 had possible typhoid fever based on high Widal's titre (a four-fold rise in the titre of antibody to typhi "O" and "H" antigen was considered as a positive Widal's test result). Eighty children, 40 with febrile illness confirmed to be other than typhoid and 40 normal healthy children were used as negative controls. The various groups were: (i) Study group ie, group I had 40 children confirmed by culture isolation of Salmonella typhi(confirmed typhoid cases). (ii) Control groups ie, (a) group II with 40 febrile controls selected from paediatrics ward where cause other than S typhi has been established, (b) group III with 40 afebrile healthy controls that were siblings of the children admitted in paediatric ward for any reason with no history of fever and TAB vaccination in the last one year, and (c) group IV with 40 children with high Widal's titre in paired sera sample. Widal's test with paired sera with a one week interval between collections were done in all 40 patients. Latex aggtutination test which could detect 900 ng/ml of antigen as observed in checker board titration, was positive in all 40 children from group I who had positive blood culture and in 30 children from group IV who had culture negative and had high Widal's titre positive. Latex agglutination test was positive in 4 children in group II and none in group III. Using blood culture positive cases as true positive and children in groups II and III as true negative, the test had a sensitivity of 100% and specificity of 96%. Latex agglutination test was found to be significantly sensitive (100%) and specific (96%) and could detect 75% more cases in group IV (possible typhoid cases). Thus latex agglutination test can be used for rapid

  5. A study on effect of ATH on Euphorbia coagulum modified polyester banana fiber composite

    Science.gov (United States)

    Kumari, Sanju; Rai, Bhuvneshwar; Kumar, Gulshan

    2018-02-01

    Fiber reinforced polymer composites are used for building and structural applications due to their high strength. In conventional composites both the binder and the reinforcing fibers are synthetic or either one of the material is natural. In the present study coagulum of Euphorbia royleana has been used for replacing polyester resinas binder in polyester banana composite. Euphorbia coagulum (driedlatex) is rich in resinous mass (60-80%), which are terpenes and polyisoprene (10-20%). Effect of varying percentage of coagulum content on various physico-mechanical properties of polyester-banana composites has been studied. Since banana fiber is sensitive to water due to presence of polar group, banana composite undergoes delamination and deterioration under humid condition. Alkali treated banana fiber along with coagulum content has improved overall mechanical properties and reduction in water absorption. The best physico-mechanical properties have been achieved on replacing 40% of polyester resin by coagulum. An increase of 50% in bending strength, 30% bending modulus and 45% impact strength as well as 68% decrease in water absorption was observed. Incorporation of 20% ATH as flame retardant in coagulum modified banana polyester composite enhanced limiting oxygen index from 20.6 to 26.8% and smoke density reduced up to 40%. This study presents the possibility of utilization of renewable materials for environmental friendly composite development as well as to find out alternative feedstock for petroleum products. Developed Euphorbia latex modified banana polyester composites can have potential utility in hardboard, partition panel, plywood and automotive etc.

  6. Evaluation of Flexural Strength of Polymethyl Methacrylate modified with Silver Colloidal Nanoparticles subjected to Two Different Curing Cycles: An in vitro Study.

    Science.gov (United States)

    Munikamaiah, Ranganath L; Jain, Saket K; Pal, Kapil S; Gaikwad, Ajay

    2018-03-01

    Silver colloidal nanoparticles have been incorporated into acrylic resins to induce antimicrobial properties. However, as additives, they can influence the mechanical properties of the final product. Mechanical properties are also dependent on different curing cycles. The aim of this study was to evaluate flexural strength of a denture base resin incorporated with different concentrations of silver colloidal nanoparticles subjected to two different curing cycles. Lucitone 199 denture base resin was used into which silver colloidal nanoparticles were incorporated at 0.5 and 5% by polymer mass. Specimens devoid of nanoparticles were used as controls. A total of 60 specimens were fabricated and divided into two groups. Each group was divided into three subgroups consisting of 10 specimens each. The specimens were fabricated according to American Dental Association (ADA) specification No. 12 and tested for flexural strength using universal testing machine. Silver colloidal nanoparticle incorporation at 0.5% concentration increased the mean flexural strength in both curing cycles by 7.5 and 4.4%, respectively, when compared with the control group. The study suggested that the mean flexural strength value of 0.5% silver colloidal nanoparticles in denture base resin was above the value of the control group both in short and long curing cycles, which makes it clinically suitable as a denture base material. However, at 5% concentration, the statistically significant amount of decrease in flexural strength compared with the value of control group both in short and long curing cycles gives it a questionable prognosis. The specimens incorporated with the antimicrobial agent 0.5% silver colloidal nanoparticles and processed by long curing cycles showed significant increase in its flexural strength compared with the control group, which makes it clinically suitable as a denture base material.

  7. A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.

    Directory of Open Access Journals (Sweden)

    Meret Huber

    2016-01-01

    Full Text Available Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg. decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha, and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.

  8. A Latex Metabolite Benefits Plant Fitness under Root Herbivore Attack.

    Science.gov (United States)

    Huber, Meret; Epping, Janina; Schulze Gronover, Christian; Fricke, Julia; Aziz, Zohra; Brillatz, Théo; Swyers, Michael; Köllner, Tobias G; Vogel, Heiko; Hammerbacher, Almuth; Triebwasser-Freese, Daniella; Robert, Christelle A M; Verhoeven, Koen; Preite, Veronica; Gershenzon, Jonathan; Erb, Matthias

    2016-01-01

    Plants produce large amounts of secondary metabolites in their shoots and roots and store them in specialized secretory structures. Although secondary metabolites and their secretory structures are commonly assumed to have a defensive function, evidence that they benefit plant fitness under herbivore attack is scarce, especially below ground. Here, we tested whether latex secondary metabolites produced by the common dandelion (Taraxacum officinale agg.) decrease the performance of its major native insect root herbivore, the larvae of the common cockchafer (Melolontha melolontha), and benefit plant vegetative and reproductive fitness under M. melolontha attack. Across 17 T. officinale genotypes screened by gas and liquid chromatography, latex concentrations of the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G) were negatively associated with M. melolontha larval growth. Adding purified TA-G to artificial diet at ecologically relevant concentrations reduced larval feeding. Silencing the germacrene A synthase ToGAS1, an enzyme that was identified to catalyze the first committed step of TA-G biosynthesis, resulted in a 90% reduction of TA-G levels and a pronounced increase in M. melolontha feeding. Transgenic, TA-G-deficient lines were preferred by M. melolontha and suffered three times more root biomass reduction than control lines. In a common garden experiment involving over 2,000 T. officinale individuals belonging to 17 different genotypes, high TA-G concentrations were associated with the maintenance of high vegetative and reproductive fitness under M. melolontha attack. Taken together, our study demonstrates that a latex secondary metabolite benefits plants under herbivore attack, a result that provides a mechanistic framework for root herbivore driven natural selection and evolution of plant defenses below ground.

  9. Nitrogen removal from concentrated latex wastewater by land treatment

    Directory of Open Access Journals (Sweden)

    Vikanda Thongnuekhang

    2004-05-01

    Full Text Available Most of the concentrated latex factories in the South of Thailand discharge treated wastewater that contains high level of nitrogen to a nearby river or canals leading to a water pollution problem. A study of land treatment system was conducted to treat and utilize nitrogen in treated wastewater from the concentrated latex factory. The experimental pilot-scale land treatment system was constructed at the Faculty of Engineering, Prince of Songkla University, Hat Yai Campus. It consisted of water convolvulus (Ipomea aquatica, I. Reptans, tropical carpet grass (Axonopus compresus (Swartz Beav. and control unit (no plantation. The treated wastewater from the stabilization pond system of the selected concentrated latex factoryin Songkhla was used to irrigate each experimental unit. Influent and effluent from the experimental units were analyzed for TKN, NH3-N, Org-N, NO3 --N, NO2 --N, BOD5, sulfate, pH and EC. The land treatment system resulted a high removal efficiency for nitrogen. Tropical carpet grass provided higher removal efficiency than other units for all parameters. The removal efficiency of water convolvulus and control unit were not significantly different. The average removal efficiency of TKN, NH3-N, Org-N, BOD5 and sulfate for tropical carpet grass unit were 92, 97, 61, 88 and 52%, for water convolvulus unit were 75, 80, 43, 41 and 30%, and for control unit were 74, 80, 41, 31 and 28%, respectively. Mass balance of nitrogen transformation was conducted. It revealed that plant uptake was the major mechanism for nitrogen removal in land treatment.

  10. Are rate of perceived exertion and feelings of pleasure/displeasure modified in elderly women undergoing 8 week of strength training of prescribe intensity?

    OpenAIRE

    Benites, Mariana L.; Alves, Ragami C.; Ferreira, Sandro S.; Follador, Lucio; da Silva, Sergio G.

    2016-01-01

    [Purpose] The aim of the present study was to verify the rate of perceived exertion and feelings of pleasure/displeasure in elderly women, who did normally perform physical exercises, following eight weeks of strength training in a constant routine. [Subjects and Methods] Eleven sedentary women were subjected to anthropometric assessment. The maximum load (100%) for each used in this study was determined by performing a test to determined the 1RM for each of them according to the protocol of ...

  11. Prevalence of Allergy to Natural Rubber Latex and Potential Cross Reacting Food in Operation Room Staff in Shiraz Hospitals -2006

    OpenAIRE

    H Nabavizade; R Amin

    2007-01-01

    Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descr...

  12. Laboratory evaluation of a simple and rapid latex agglutination assay for the serodiagnosis of typhoid fever

    NARCIS (Netherlands)

    Abdoel, Theresia H.; Pastoor, Rob; Smits, Henk L.; Hatta, Mochammad

    2007-01-01

    A latex agglutination assay for the serodiagnosis of typhoid fever was evaluated on samples collected from patients with clinical suspicion of typhoid fever in South Sulawesi, Indonesia, where the disease is endemic. The latex assay is very easy to use, gives a rapid result and may be used as a

  13. Involvement of Ethylene in the Latex Metabolism and Tapping Panel Dryness of Hevea brasiliensis

    Science.gov (United States)

    Putranto, Riza-Arief; Herlinawati, Eva; Rio, Maryannick; Leclercq, Julie; Piyatrakul, Piyanuch; Gohet, Eric; Sanier, Christine; Oktavia, Fetrina; Pirrello, Julien; Kuswanhadi; Montoro, Pascal

    2015-01-01

    Ethephon, an ethylene releaser, is used to stimulate latex production in Hevea brasiliensis. Ethylene induces many functions in latex cells including the production of reactive oxygen species (ROS). The accumulation of ROS is responsible for the coagulation of rubber particles in latex cells, resulting in the partial or complete stoppage of latex flow. This study set out to assess biochemical and histological changes as well as changes in gene expression in latex and phloem tissues from trees grown under various harvesting systems. The Tapping Panel Dryness (TPD) susceptibility of Hevea clones was found to be related to some biochemical parameters, such as low sucrose and high inorganic phosphorus contents. A high tapping frequency and ethephon stimulation induced early TPD occurrence in a high latex metabolism clone and late occurrence in a low latex metabolism clone. TPD-affected trees had smaller number of laticifer vessels compared to healthy trees, suggesting a modification of cambial activity. The differential transcript abundance was observed for twenty-seven candidate genes related to TPD occurrence in latex and phloem tissues for ROS-scavenging, ethylene biosynthesis and signalling genes. The predicted function for some Ethylene Response Factor genes suggested that these candidate genes should play an important role in regulating susceptibility to TPD. PMID:26247941

  14. Isotactic polypropylene/carbon nanotube composites prepared by latex technology: Electrical conductivity study

    NARCIS (Netherlands)

    Grossiord, N.; Wouters, M.E.L.; Miltner, H.E.; Lu, K.; Loos, J.; Van Mele, B.; Koning, C.E.

    2010-01-01

    Several series of nanocomposites were prepared using a latex-based process, the main step of which consisted of mixing an aqueous suspension of exfoliated carbon nanotubes (CNTs) and a polymer latex. In the present work, a systematic study on the electrical properties of fully amorphous (polystyrene

  15. NR based curred latex material reclaimed with 2,2'-dibenzamidodiphenyldisulphide in truck tyre tread compound

    NARCIS (Netherlands)

    Rajan, V.V.; Dierkes, Wilma K.; Joseph, R.; Noordermeer, Jacobus W.M.

    2006-01-01

    It is observed that reclamation of natural rubber latex based rubber using 2,2'-dibenzamidodiphenyldisulphide as reclaiming agent is an optional methodology for recycling of waste latex rubber (WLR). For progressive replacement of virgin natural rubber by the reclaim, two alternatives curing system

  16. Thermodynamics of swelling of latex particles with two monomers: a sensitivity analysis

    NARCIS (Netherlands)

    Maxwell, I.A.; Noel, E.F.J.; Schoonbrood, H.A.S.; German, A.L.

    1993-01-01

    A sensitivity anal. is performed to det. at what conditions the simplified model for swelling of latex particles by two monomers or two solvents is valid. This model proposes that, inter alia, the fractions of two monomers in the latex particles and in the monomer droplets are equal. The model is a

  17. Towards anti-corrosion coatings from surfactant-free latexes based on maleic anhydride containing polymers

    NARCIS (Netherlands)

    Soer, W.J.; Ming, W.; Koning, C.E.; Benthem, van R.A.T.M.

    2008-01-01

    We report on the film formation of surfactant-free, artificial latexes based on copolymers containing maleic anhydride. Different metallic substrates, such as aluminum, steel and magnesium alloys, were coated with three different latexes. A commercial polyester based coating was used as a

  18. Residual monomer reduction in polymer latex products by extraction with supercritical carbon dioxide

    NARCIS (Netherlands)

    Aerts, M.; Meuldijk, J.; Kemmere, M.F.; Keurentjes, J.T.F.

    2011-01-01

    Extraction of residual monomer from a latex product with supercritical carbon dioxide ((sc)CO2) in a column was studied. Operating conditions were chosen at 35¿°C and 100 bar. For reducing the residual styrene level in a polystyrene latex from 104 ppm to 100¿ppm and from 104 ppm to 10¿ppm, a

  19. Elements of the LaTeX system for the development of large publications

    DEFF Research Database (Denmark)

    Andersen, Esben Sloth

    This document presents gives a quick overview over the LATEX system from the viewpoint of the production of books and complex papers. Thereby it provides the starting point for the author's selection of a set of LATEX packages and the development of related commands....

  20. Comparative evaluation of Type 1 latex hypersensitivity in patients with chronic urticaria, rubber factory workers and healthy control subjects

    NARCIS (Netherlands)

    Piskin, Gamze; Akyol, Aynur; Uzar, Hatice; Tulek, Necla; Boyvat, Ayse; Gurgey, Erbak

    2003-01-01

    Latex hypersensitivity manifests itself most commonly with contact urticaria. In this study, we investigated the frequency of latex hypersensitivity as a possible aetiological factor in patients with chronic urticaria (CU) and compared latex hypersensitivity of CU patients (n = 50) with that of

  1. A Reappraisal of Online Mathematics Teaching Using LaTeX

    Directory of Open Access Journals (Sweden)

    Eamon Costello

    2009-12-01

    Full Text Available The mathematics language LaTeX is often seen outside of academic circles as a legacy technology that is awkward to use. MathML - a verbose language designed for data-exchange, and to be written and understood by machines - is sometimes by contrast seen as something that will aid online mathematics and lack of browser support for it bemoaned. However LaTeX can already do many of the things that MathML might promise. LaTeX is here proposed as a language from which small fragments, with concise syntax, can be used by people to easily create and share mathematical expressions online. The capability to embed fragments of LaTeX code in online discussions is described here and its impact on a group of educators and learners evaluated. Here LaTeX is posited as a useful tool for facilitating asynchronous, online, collaborative learning of mathematics.

  2. A study of using polythiol compounds and 2-ethyl-hexyl-acrylate with carbon tetrachloride as sensitizers for radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Polsuksiri, C.

    1989-01-01

    Experiments on using 3 different compounds of polythiol and an acrylate as sensitizer for radiation vulcanization were conducted. It was found that 1,4 butane diol propane tris-3-mercapto propionate showed the tendency to be a good sensitizer. The tensile strength of the rubber film prepared from the irradiated latex was found to be 14 MPa at sensitizer concentration of 1 phr and radiation dose of 45 kGy. As for 2-ethyl hexyl acrylate (2EHA), the maximum tensile strength of rubber film was found to be 23 MPa at concentration of 3 phr and radiation dose of 35 kGy. The mixture of 2 EHA and CCl 4 at various ratio was also used as sensitizer. The optimum ratio was found to be 5:1 at concentration of 6 phr and radiation dose of 15 kGy. The maximum tensile strength was as high as 25 MPa. The study also revealed that the radiation vulcanized latex with crosslink density of about 18x10 18 C.L./cm 3 would give the rubber film of highest tensile strength

  3. Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.

    Science.gov (United States)

    Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S

    2009-05-04

    To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.

  4. Cost evaluation of radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Makuuchi, K.

    2003-01-01

    Cost of radiation vulcanized NR latex was evaluated. The plant would be built in an existing dipping factory in an industrial area in a Southeast Asian country. One thousands dry tons of NR latex are vulcanized with a low energy electron accelerator. The electron accelerator is a self-shielding low energy type. The maximum accelerating voltage is 300 kV and the output power is 10 kW. The total construction cost of the plant is $400,000 including electron accelerator and other equipments. Costs of raw materials and utilities are $1.165 and $0.023 per one kg of product, respectively. The fixed costs of the plant consist of labor costs, labor overhead, maintenance, plant overhead, depreciation, and bank interest. It is $0.190/kg of product. The company overhead for operation including company management, R and D and insurance is $0.044/kg of product. Thus, the total production cost is estimated to be $1.422/kg of product. (author)

  5. Biological safety evaluation of the modified urinary catheter

    Energy Technology Data Exchange (ETDEWEB)

    Kowalczuk, Dorota, E-mail: dorota.kowalczuk@umlub.pl [Department of Medicinal Chemistry, Medical University of Lublin, Jaczewskiego 4, 20-090 Lublin (Poland); Przekora, Agata; Ginalska, Grazyna [Department of Biochemistry and Biotechnology, Medical University of Lublin, Chodzki 1, 20-093 Lublin (Poland)

    2015-04-01

    The purpose of this study was to evaluate in vitro safety of the novel tosufloxacin (TOS)-treated catheters with the prolonged antimicrobial activity. The test samples of silicone latex catheter were prepared by the immobilization of TOS on chitosan (CHIT)-coated catheter by means of covalent bonds and non-covalent interactions. Each step of the modification process of catheter surface was observed using ATR–Fourier transform infrared spectroscopy. In vitro cytotoxicity of the modified and unmodified catheters was assessed by direct and indirect tests in accordance with ISO standards using green monkey kidney (GMK) cell line. The MTT, lactate dehydrogenase activity (LDH), WST-8, Sulforhodamine B (SRB) test results and microscopic observation clearly indicated that unmodified silicone latex catheters decrease cell metabolic activity, act as a cytotoxic agent causing cell lysis and induce cell death through necrotic or apoptotic process. We suggest that chitosan coat with TOS immobilized limits leaching of harmful agents from silicone latex material, which significantly enhances survivability of GMK cells and therefore is quite a good protection against the cytotoxic effect of this material. - Highlights: • Characterization of the novel antimicrobial urinary catheters • Monitoring of the catheter modification by FTIR analysis • Confirmation of high cytotoxicity of latex-based catheter used in urological practice • Chitosan-coated and tosufloxacin-treated catheter is less toxic than the untreated one. • The proposed surface modification protects cells against latex-induced death.

  6. Improved mechanical and functional properties of elastomer/graphite nanocomposites prepared by latex compounding

    International Nuclear Information System (INIS)

    Yang Jian; Tian Ming; Jia Qingxiu; Shi Junhong; Zhang Liqun; Lim Szuhui; Yu Zhongzhen; Mai Yiuwing

    2007-01-01

    The facile latex approach has been adopted to finely incorporate graphite nanosheets into elastomeric polymer matrix to obtain high-performance elastomeric nanocomposites with improved mechanical properties and functional properties. Scanning electron microscopy, transmission electron microscopy and X-ray diffraction experiments show that the nanostructures of the final nanocomposites exhibit a high degree of exfoliation and intercalation of graphite in the nitrile-butadiene rubber (NBR) matrix. Mechanical and dynamic-mechanical tests demonstrate that the NBR/graphite nanocomposites possess greatly increased elastic modulus and tensile strength, and desirably strong interfaces. The unexpected self-crosslinking of elastomer/graphite nanocomposites was discovered and then verified by oscillating disc rheometry and equilibrium swelling experiments. After critically examining various polymer types by X-ray photoelectron spectroscopy, electron spin resonance and Fourier transform infrared spectroscopy, a radical initiation mechanism was proposed to explain the self-crosslinking reaction. These NBR/graphite nanocomposites possess significantly improved wear resistance and gas barrier properties, and superior electrical/thermal conductivity. Such versatile functional properties make NBR nanocomposites a promising new class of advanced materials

  7. Improved mechanical and functional properties of elastomer/graphite nanocomposites prepared by latex compounding

    Energy Technology Data Exchange (ETDEWEB)

    Yang Jian [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Tian Ming [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Jia Qingxiu [Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China); Shi Junhong [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Zhang Liqun [Key Laboratory for Nano-materials, Beijing University of Chemical Technology, Ministry of Education of China, Beijing 100029 (China); Key Laboratory on Preparation and Processing of Novel Polymer Materials, Beijing University of Chemical Technology, Beijing 100029 (China)], E-mail: zhanglq@mail.buct.edu.cn; Lim Szuhui; Yu Zhongzhen [Centre for Advanced Materials Technology (CAMT), School of Aerospace, Mechanical and Mechatronic Engineering (J07), University of Sydney, Sydney, NSW 2006 (Australia); Mai Yiuwing [Centre for Advanced Materials Technology (CAMT), School of Aerospace, Mechanical and Mechatronic Engineering (J07), University of Sydney, Sydney, NSW 2006 (Australia)], E-mail: y.mai@usyd.edu.au

    2007-10-15

    The facile latex approach has been adopted to finely incorporate graphite nanosheets into elastomeric polymer matrix to obtain high-performance elastomeric nanocomposites with improved mechanical properties and functional properties. Scanning electron microscopy, transmission electron microscopy and X-ray diffraction experiments show that the nanostructures of the final nanocomposites exhibit a high degree of exfoliation and intercalation of graphite in the nitrile-butadiene rubber (NBR) matrix. Mechanical and dynamic-mechanical tests demonstrate that the NBR/graphite nanocomposites possess greatly increased elastic modulus and tensile strength, and desirably strong interfaces. The unexpected self-crosslinking of elastomer/graphite nanocomposites was discovered and then verified by oscillating disc rheometry and equilibrium swelling experiments. After critically examining various polymer types by X-ray photoelectron spectroscopy, electron spin resonance and Fourier transform infrared spectroscopy, a radical initiation mechanism was proposed to explain the self-crosslinking reaction. These NBR/graphite nanocomposites possess significantly improved wear resistance and gas barrier properties, and superior electrical/thermal conductivity. Such versatile functional properties make NBR nanocomposites a promising new class of advanced materials.

  8. Vulcanization of polybutadiene latex induced by 60Co γ-rays irradiation

    International Nuclear Information System (INIS)

    Liu Yuguang; Huang Yudong; Hou Jing; Gao Deyu; Zhang Xuequan

    2007-01-01

    Fully vulcanized polybutadiene rubber particles (FVBR) were prepared by polybutadiene latex (PBL) vulcanization induced by 60 Co γ-rays irradiation, and the effect of absorbed dose on crosslinking behavior was studied. Mean diameter, diameter distribution and morphology of the particles in the PBL irradiated at different doses as well as in the FVBR were characterized by laser particle analyzer and AFM. The crosslinking effect on the mechanical properties of the films, by casting from PBL at different doses correspondingly, was evaluated by mechanical and dynamic mechanical analysis (DMA) respectively. The results showed that the diameter and swelling property decreased with absorbed dose, while crosslink density and gel fraction increased. Moreover, the decrease of the tensile strength and elongation at break, the increase of the hardness in shore A and young's modulus (E), and the increase of storage modulus (E') and narrowing of loss tangent peak (Tan 8) were all accounted for the increment of crosslinking. The Charlesby-Pinner equation fits well with the PBL vulcanization in the range of absorbed doses from 0 to 200kGy. (authors)

  9. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    Energy Technology Data Exchange (ETDEWEB)

    Nomura, Toshiyuki, E-mail: nomura@chemeng.osakafu-u.ac.jp; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro [Osaka Prefecture University, Department of Chemical Engineering (Japan)

    2015-02-15

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway.

  10. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    Science.gov (United States)

    Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro

    2015-02-01

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote's lack of an endocytotic pathway.

  11. Cytotoxicity of functionalized polystyrene latex nanoparticles toward lactic acid bacteria, and comparison with model microbes

    International Nuclear Information System (INIS)

    Nomura, Toshiyuki; Kuriyama, Yuta; Tokumoto, Hayato; Konishi, Yasuhiro

    2015-01-01

    The cytotoxicity and colloidal behavior of surface-functionalized polystyrene latex (PSL) nanoparticles (NPs) (nominal diameter: 100 nm) toward a model gram positive bacterium Lactococcus lactis JCM 5805 were examined. Nearly all the L. lactis cells exposed to the negatively charged PSL NPs survived because the surface of the bacterial cell was charged negatively, and the NPs therefore hardly adhere to the cell surface. In contrast, the positively charged PSL NPs adhered to the L. lactis cell surface but were not entrapped within the cell, and cell death subsequently occurred. The bacterial growth curves after the toxic NP exposure suggested that NP toxicity did not affect the specific growth phase, but did affect lag time. These results indicated that the cells were damaged by the cell disruption that resulted from the adhesion of the NPs to the cell surface. Finally, the cytotoxicity of the toxic, positively charged PSL NPs toward L. lactis was compared with that displayed toward a model gram negative bacterium Escherichia coli and a model eukaryote Saccharomyces cerevisiae. The cytotoxic behaviors of NPs on L. lactis and E. coli were similar, and depended not on the bacterial surface structure, but rather the environmental ionic strength. In contrast, the cytotoxicity of the prokaryote bacteria was higher than that toward the model eukaryote S. cerevisiae. The difference between the NP sensitivities of the prokaryote and eukaryote resulted from the prokaryote’s lack of an endocytotic pathway

  12. Molluscicidal effect of Euphorbia umbellata (Pax Bruyns latex on Biomphalaria glabrata, Schistosoma mansoni host snail

    Directory of Open Access Journals (Sweden)

    Luciana Patrícia Lima Alves Pereira

    2017-12-01

    Full Text Available ABSTRACT Euphorbia umbellata (Pax Bruyns is an easily cultivated shrub, with occurrence in the tropical regions of the American and African continents. Chemical studies have revealed that the latex of this plant is rich in terpene compounds, which are highly toxic to snails Biomphalaria glabrata (Basommatophora: Planorbidae. The aim of this study was to evaluate the chemical composition and molluscicidal activity of the latex produced by E. umbellata, as well as the safety of its application in aquatic environments. The concentration of latex that killed 90% of the exposed snails after 24 h exposure (LC90 was 3.69 mg/L. Toxicity bioassays using Danio rerio (zebrafish revealed that these animals were less susceptible to latex than planorbids. However, it is important to perform other toxicity tests to ensure the feasibility of using latex to control populations of mollusks that contribute to schistosomiasis transmission. A phytochemical screening performed with the E. umbellata latex identified the triterpenoid and coumarin class. Further studies are warranted to isolate, identify, and test the active compounds of E. umbellata latex in B. glabrata.

  13. Synthesis and characterization of fluorinated polyacrylate latex emulsified with novel surfactants.

    Science.gov (United States)

    Zhang, Cuifeng; Xu, Tingting; Bao, Zhongbin; Chen, Lijun

    2017-01-01

    The fluorinated polyacrylate latex were successfully prepared with semi- continuous seeded emulsion polymerization of butyl acrylate (BA), methyl methacrylate (MMA) and hexafluorobutyl methacrylate (HFMA) which was initiated with potassium persulfate (KPS) initiator and emulsified with the novel mixed surfactants of sodium lauryl glutamate (SLG) and alkylphenol ethoxylates (OP-10). The structure of the resultant latex was confirmed by Fourier transform infrared spectroscopy (FTIR). The particle size of the latex was measured by Zetatrac dynamic light scattering detector. The film of latex was tested by differential scanning calorimetry (DSC), thermogravimetric analysis (TGA) and contact angle (CA). The optimum conditions of preparing the novel fluorinated polyacrylate latex are optimized and the results are as follows: the amount of emulsifiers is 4.0%; mass ratio of SLG to OP-10 is 1:1, the amount of the initiator is 0.6%. The mass ratio of MMA to BA is 1:1 and the amount of HFMA is 7.0%. In this case, the conversion is high and the polymerization stability is good. In addition, the water resistance and thermal properties of the latex films were improved significantly in comparison with the film of the latex prepared without the fluorinated monomer.

  14. Plant latex: a promising antifungal agent for post harvest disease control.

    Science.gov (United States)

    Sibi, G; Wadhavan, Rashmi; Singh, Sneha; Shukla, Abhilasha; Dhananjaya, K; Ravikumar, K R; Mallesha, H

    2013-12-01

    Bioactive compounds from plant latex are potential source of antifungic against post harvest pathogens. Latex from a total of seven plant species was investigated for its phytochemical and antifungal properties. Six fungi namely Aspergillus fumigatus, A. niger, A. terreus, F. solani, P. digitatum and R. arrhizus were isolated from infected fruits and vegetables and tested against various solvent extracts of latex. Analysis of latex extracts with phytochemical tests showed the presence of alkaloids, flavonoids, glycosides, phenols, saponins, steroids, tannins and terpenoids. Antifungal assay revealed the potential inhibitory activity of petroleum ether extracts against the postharvest fungal isolates. Various degree of sensitivity was observed irrespective of plant species studied with A. terreus and P. digitatum as the most susceptible ones. F. solani and A. fumigatus were moderately sensitive to the latex extracts tested. Among the plants, latex of Thevetia peruviana (75.2%) and Artocarpus heterophyllus (64.8%) were having potential antifungal activity against the isolates followed by Manilkara zapota (51.1%). In conclusion, use of plant latex makes interest to control postharvest fungal diseases and is fitting well with the concept of safety for human health and environment.

  15. Aggregation and charging of sulfate and amidine latex particles in the presence of oxyanions.

    Science.gov (United States)

    Sugimoto, Takuya; Cao, Tianchi; Szilagyi, Istvan; Borkovec, Michal; Trefalt, Gregor

    2018-08-15

    Electrophoretic mobility and time resolved light scattering are used to measure the effect on charging and aggregation of amidine and sulfate latex particles of different oxyanions namely, phosphate, arsenate, sulfate, and selenate. In the case of negatively charged sulfate latex particles oxyanions represent the coions, while they represent counterions in the case of the positively charged amidine latex. Repulsive interaction between the sulfate latex surface and the coions results in weak ion specific effects on the charging and aggregation. On the other hand the interaction of oxyanions with the amidine latex surface is highly specific. The monovalent dihydrogen phosphate ion strongly adsorbs to the positively charged surface and reverses the charge of the particle. This charge reversal leads also to the restabilization of the amidine latex suspension at the intermediate phosphate concentrations. In the case of dihydrogen arsenate the adsorption to amidine latex surface is weaker and no charge reversal and restabilization occurs. Similar differences are seen between the sulfate and selenate analogues, where selenate adsorbs more strongly to the surface as compared to the sulfate ion and invokes charge reversal. The present results indicate that ion specificity is much more pronounced in the case of counterions. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. High speed cinematography of the initial break-point of latex condoms during the air burst test.

    Science.gov (United States)

    Stube, R; Voeller, B; Davidhazy, A

    1990-06-01

    High speed cinematography of latex condoms inflated to burst under standard (ISO) conditions reveals that rupture of the condom typically is initiated at a small focal point on the shank of the condom and then rapidly propagates throughout the condom's surface, often ending with partial or full severance of the condom at its point of attachment to the air burst instrument. This sequence of events is the reverse of that sometimes hypothesized to occur, where initiation of burst was considered to begin at the attachment point and to constitute a testing method artifact. This hypothesis of breakage at the attachment point, if true, would diminish the value of the air burst test as a standard for assessing manufacturing quality control as well as for condom strength measurements and comparisons.

  17. Synthesis and Properties of High Strength Thin Film Composites of Poly(ethylene Oxide and PEO-PMMA Blend with Cetylpyridinium Chloride Modified Clay

    Directory of Open Access Journals (Sweden)

    Mohammad Saleem Khan

    2015-01-01

    Full Text Available Ion-conducting thin film composites of polymer electrolytes were prepared by mixing high MW poly(ethylene oxide (PEO, poly(methyl methacrylate (PMMA as a polymer matrix, cetylpyridinium chloride (CPC modified MMT as filler, and different content of LiClO4 by using solution cast method. The crystallinity, ionic conductivity (σ, and mechanical properties of the composite electrolytes and blend composites were evaluated by using XRD, AC impedance, and UTM studies, respectively. The modification of clay by CPC showed enhancement in the d-spacing. The loading of clay has effect on crystallinity of PEO systems. Blend composites showed better mechanical properties. Young’s modulus and elongation at break values showed increase with salt and clay incorporation in pure PEO. The optimum composition composite of PEO with 3.5 wt% of salt and 3.3 wt% of CPMMT exhibited better performance.

  18. Comparing the level of dexterity offered by latex and nitrile SafeSkin gloves.

    Science.gov (United States)

    Sawyer, Jo; Bennett, Allan

    2006-04-01

    An increase in the occurrence of latex allergy has been concurrent with the increasing use of latex gloves by laboratory and healthcare workers. In recent years nitrile gloves have been used to replace latex gloves to prevent latex allergy. Nitrile gloves offer a comparable level of protection against chemical and biological agents and are more puncture resistant. However, if manual dexterity is compromised by nitrile gloves to a greater degree than latex then this may increase the risk of sharps injuries. The Purdue pegboard test, which measures both gross and fine finger dexterity, was used to test the dexterity levels of two glove types used at HPA CEPR; Kimberly-Clark SafeSkin nitrile and latex laboratory gloves. There was a statistically significant 8.6% increase in fine finger dexterity provided by latex compared with nitrile SafeSkin laboratory gloves but no difference in gross dexterity between the glove types. There was no significant relationship between glove dexterity and age or gender. The selection of glove size was influenced by the digit length of participants. Moreover, those with longer, thinner fingers appeared to have an advantage when using nitrile SafeSkin gloves. The level of dexterity provided by latex and nitrile SafeSkin gloves for tasks on a gross dexterity level are comparable and health workers will benefit from the non-allergenic properties of nitrile. For tasks requiring fine finger dexterity nitrile SafeSkin gloves may impede dexterity. Despite this, the degree of restriction appears to have a negligible impact on safety in this study when compared with the risk of latex sensitization and subsequent allergy. In addition to glove material, working practices must also take into account glove size, fit, grip and thickness, as these factors can all influence dexterity.

  19. Glove powder's carrying capacity for latex protein: analysis using the ASTM ELISA test.

    Science.gov (United States)

    Beezhold, D; Horton, K; Hickey, V; Daddona, J; Kostyal, D

    2003-01-01

    Glove donning powders carry latex proteins and disperse them into the workplace environment. We have used the ASTM D6499 ELISA to quantify the amount of latex antigen bound to and carried by glove powders. We could differentiate between a small amount of protein actually bound to the powders and a larger amount carried by the powder. Enhanced binding of a major allergen, Hev b 5, to the starch powders was demonstrated by Western blot. The D6499 ELISA is able to measure total latex antigen, soluble and powder bound, simultaneously without the need to centrifuge the samples.

  20. Optical response of a flat metallic surface coated with a monolayer array of latex spheres

    International Nuclear Information System (INIS)

    Shi Lei; Liu Xiaohan; Yin Haiwei; Zi Jian

    2010-01-01

    We report on the fabrication, characterization and simulation of a structure consisting of a flat metallic surface coated with a monolayer array of latex spheres. This structure shows interesting optical response: over flat metallic surfaces a series of reflection minima appear in reflection spectra. Numerical simulations revealed that the structure can support two types of surface modes: surface plasmon-polaritons bound at the metallic surface and guided modes confined to the array of latex spheres, or their hybrids. Both experimental and theoretical results indicated that these surface modes show well-defined band structures due to the introduced periodicity by the monolayer array of latex spheres.

  1. Measurement of filtration efficiency of Nuclepore filters challenged with polystyrene latex nanoparticles: experiments and modeling

    International Nuclear Information System (INIS)

    Ling, Tsz Yan; Wang Jing; Pui, David Y. H.

    2011-01-01

    Membrane filtration has been demonstrated to be effective for the removal of liquid-borne nanoparticles (NPs). Such technique can be applied to purify and disinfect drinking water as well as remove NPs in highly pure chemicals used in the industries. This study aims to study the filtration process of a model membrane filter, the Nuclepore filter. Experiments were carried out using standard filtration tools and the nanoparticle tracking analysis (NTA) technique was used to measure particle (50–500 nm) concentration upstream and downstream of the filter to determine the filtration efficiency. The NTA technique has been calibrated using 150-nm polystyrene latex particles to determine its accuracy of particle concentration measurement. Measurements were found reliable within a certain concentration limit (about 10 8 –10 10 particles/cm 3 ), which is dependent on the camera settings during the measurement. Experimental results are comparable with previously published data obtained using the aerosolization method, validating the capability of the NTA technique. The capillary tube model modified from that developed for aerosol filtration was found to be useful to represent the experimental results, when a sticking coefficient of 0.15 is incorporated. This suggests that only 15% of the particle collisions with the filter results in successful attachment. The small sticking coefficient found can be explained by the unfavorable surface interactions between the particles and the filter medium.

  2. Flow cytometric quantitation of phagocytosis in heparinized complete blood with latex particles and Candida albicans

    Directory of Open Access Journals (Sweden)

    Jesús M. Egido

    1997-12-01

    Full Text Available We report a rapid method for the flow cytometric quantitation of phagocytosis in heparinized complete peripherial blood (HCPB, using commercially available phycoerythrin-conjugated latex particles of 1µm diameter. The method is faster and shows greater reproducibility than Bjerknes' (1984 standard technique using propidium iodide-stained Candida albicans, conventionally applied to the leukocytic layer of peripherial blood but here modified for HCPB. We also report a modification of Bjerknes' Intracellular Killing Test to allow its application to HCPB.Se da cuenta de un método rápido para la cuantización del flujo citométrico de la fagocitosis en sangre periférica completamente heparinizada (HCPB, mediante la utilización de partículas de látex phycoerythrin-conjugadas de 1µm de diámetro disponibles comercialmente. El método es más rápido y presenta mayor reproducibilidad que la técnica estandar de Bjerknes' (1984 utilizando propidium iodide-teñida Candida albicans, aplicada convencionalmente a la capa leucocitica de sangre periférica pero modificada por HCPB. Tambien damos cuenta de una modificación de Bjerknes' Intracellular Killing Test para permitir su aplicación a HCPB.

  3. Long-term clearance of inhaled magnetite and polystyrene latex from the lung: a comparison

    Energy Technology Data Exchange (ETDEWEB)

    Schlesinger, R.B.; Halpern, M.; Lippmann, M. (New York Univ., NY (USA). Inst. of Environmental Medicine)

    1982-01-01

    As part of a larger study evaluating the applicability of a magnetic detection technique for monitoring lung retention of inhaled particles, simultaneous radiological measurements of the retention of magnetite and polystyrene latex particles in four donkeys were performed. The radiometric measurements were performed using a scintillation detector series modified for separation of the higher energy ..gamma..-emissions of /sup 59/Fe and /sup 85/Sr. In all animals, after 24 hr post-exposure, both polystyrene and magnetite exhibited a relatively rapid phase for 80 days (Tsub(1/2) = 15-22 days) which, in three donkeys, was clearly followed by a slower phase (Tsub(1/2) = 42-173 days); activity levels after 80 days in the fourth donkey were too low to permit determination of clearance rate. During the second phase, a deviation in pattern was clearly observed between the two aerosols, the polystyrene being cleared consistently faster than the magnetite. It is suggested that this deviation implies that, beginning at this time, there were functional differences between the dominant clearance mechanisms for the two aerosols. Exactly what these mechanisms were, or whether the difference was attributable to specific differences in particle characteristics, could not be determined.

  4. Long-term clearance of inhaled magnetite and polystyrene latex from the lung: a comparison

    International Nuclear Information System (INIS)

    Schlesinger, R.B.; Halpern, M.; Lippmann, M.

    1982-01-01

    As part of a larger study evaluating the applicability of a magnetic detection technique for monitoring lung retention of inhaled particles, simultaneous radiological measurements of the retention of magnetite and polystyrene latex particles in four donkeys were performed. The radiometric measurements were performed using a scintillation detector series modified for separation of the higher energy γ-emissions of 59 Fe and 85 Sr. In all animals, after 24 hr post-exposure, both polystyrene and magnetite exhibited a relatively rapid phase for 80 days (Tsub(1/2) = 15-22 days) which, in three donkeys, was clearly followed by a slower phase (Tsub(1/2) = 42-173 days); activity levels after 80 days in the fourth donkey were too low to permit determination of clearance rate. During the second phase, a deviation in pattern was clearly observed between the two aerosols, the polystyrene being cleared consistently faster than the magnetite. It is suggested that this deviation implies that, beginning at this time, there were functional differences between the dominant clearance mechanisms for the two aerosols. Exactly what these mechanisms were, or whether the difference was attributable to specific differences in particle characteristics, could not be determined. (U.K.)

  5. Validation for radiation sterilization of surgical latex glove

    International Nuclear Information System (INIS)

    Liu Degui

    2002-01-01

    Objective: To determine the optimal radiation mode for sterilization of surgical latex gloves. Methods: The dose distribution in the product loads inside radiation container was measured in different radiation mode. Results: Data of dose distribution in the product load in different radiation mode were obtained. Conclusion: At pre-set height of source working position and within pre-determined dwelling time of each irradiation container staying at the irradiation position, the delivered dose can meet the customers requirement by the radiation mode that, in the half cycle of radiation process, turns the horizontal middle layers of the product to the upper or lower layers, and the upper and lower layers to the middle layers

  6. A New Prenylated Xanthone from Latex of Garcinia cowa Roxb.

    Directory of Open Access Journals (Sweden)

    Zhi Na

    2013-05-01

    Full Text Available A new prenylated xanthone, 1,6-dihydroxy-3,7-dimethoxy-2-(3,7-dimethyloct-2,6-dienyl xanthone (3-O-methylcowaxanthone (1, together with four known xanthones, cowaxanthone (2, 7-O-methylgarcinone (3, α-mangostin (4 and γ-mangostin (5 were isolated from the latex of Garcinia cowa. The structure of compound 1 was elucidated on the basis of spectroscopic data interpretation, including 1D and 2D NMR and HREIMS. The cytotoxic activitiy of 1 against five human cancer cell lines, HL-60, SMMC-7721, A-549, MCF-7 and SW480, was evaluated, but it was inactive (IC 50>40μM.

  7. Purification of papain from fresh latex of Carica papaya

    Directory of Open Access Journals (Sweden)

    Rubens Monti

    2000-01-01

    Full Text Available In the present study we wish to report a method of crystallizing papain from fresh papaya latex which gave higher yields than previously reported. This method does not involve the use of sulphydryl reagents. The papain thus obtained is practically pure and shows a single band when submitted to electrophoresis on polyacrylamide gel, and is identical to the papain obtained by other methods. In routine enzymatic assays, specific activity was measured using Z-gly-pNP and BAEE as substrates. Papain crystallized by this method, without the use of high concentrations of salts or thiol-containing substances such as cysteine and dithiothreitol, is obtained in the form of a complex with natural inhibitors existent in latex which can be removed by dialysis.No presente trabalho apresenta-se um método de cristalização da papaína oriunda do látex fresco de mamão, o qual apresenta uma alta produtividade em relação aos métodos previamente descritos. A metodologia aqui descrita não envolve o uso de reagentes sulfidrílicos, a papaína foi obtida de forma praticamente pura, apresentando uma simples banda quando submetida a eletroforese, e com propriedades idênticas àquelas obtidas por outros métodos. A atividade específica foi determinada utilizando Z-gly-pNP e BAEE como substrato. A papaína obtida por essa metodologia, sem uso de substâncias tais como cisteína e ditiotreitol, apresenta-se na forma de um complexo com inibidores naturais, os quais podem ser removidos por diálise.

  8. Investigation of non-isocyanate urethane functional latexes and carbon nanofiller/epoxy coatings

    Science.gov (United States)

    Meng, Lei

    This dissertation consists of two parts. In the first part, a new class of non-isocyanate urethane methacrylates was synthesized and the effect of the new monomers on the urethane functional latex was investigated. The second part focused on a comparison of carbon nanofillers in inorganic/organic epoxy coating system for anticorrosive applications. A new class of non-isocyanate urethane methacrylates (UMAs) monomers was synthesized through an environmentally friendly non-isocyanate pathway. The kinetics of seeded semibatch emulsion polymerization of UMAs with methyl methacrylate (MMA) and butyl acrylate (BA) was monitored. The particle size and morphology were investigated by dynamic light scattering (DLS), ultrasound acoustic attenuation spectroscopy (UAAS) and transmission electron microscopy (TEM). The minimum film formation temperature (MFFT), mechanical and viscoelastic properties were studied. It was found that the emulsion polymerization processes all proceeded via Smith-Ewart control, leading to the uniform morphology and particle size. The glass transition temperature (Tg) and the mechanical properties of poly(MMA/BA/UMA) decreased with the increasing chain length of urethane methacrylate monomers due to the increasing flexibility of side chains. Without the effect of Tg, lower MFFT and improved mechanical properties were observed from urethane functional latexes. The improved mechanical properties were due to the increasing particle interaction by forming hydrogen bonding. Furthermore, the effect of urethane functionality in terms of the polymer composition, the location and the concentration was investigated by the batch, single-stage and two-stage semibatch polymerization of 2-[(butylcarbamoyl)oxy]ethyl methacrylate (BEM) with MMA and BA. The core-shell and homogeneous structures were evaluated by TEM, differential scanning calorimetry (DSC), and solid state nuclear magnetic resonance (SS-NMR). The compositional drift was observed from the batch

  9. Evaluation of apparent viscosity of Para rubber latex by diffuse reflection near-infrared spectroscopy.

    Science.gov (United States)

    Sirisomboon, Panmanas; Chowbankrang, Rawiphan; Williams, Phil

    2012-05-01

    Near-infrared spectroscopy in diffuse reflection mode was used to evaluate the apparent viscosity of Para rubber field latex and concentrated latex over the wavelength range of 1100 to 2500 nm, using partial least square regression (PLSR). The model with ten principal components (PCs) developed using the raw spectra accurately predicted the apparent viscosity with correlation coefficient (r), standard error of prediction (SEP), and bias of 0.974, 8.6 cP, and -0.4 cP, respectively. The ratio of the SEP to the standard deviation (RPD) and the ratio of the SEP to the range (RER) for the prediction were 4.4 and 16.7, respectively. Therefore, the model can be used for measurement of the apparent viscosity of field latex and concentrated latex in quality assurance and process control in the factory.

  10. Proceedings of the international symposium on radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Machi, Sueo

    1990-01-01

    The First International Symposium on Radiation Vulcanization of Natural Rubber Latex (RVNRL) was held from 26 to 28 July 1989 at Tokyo and Takasaki. In these proceedings, thirty six papers presented at the Symposium are compiled. Main topics are commercial application of RVNRL, characterization of NR latex and vulcanization, properties of radiation vulcanized NR latex, development of sensitizers, mechanism of RVNRL, RVNRL with electron beams, and new Co-60 irradiator for RVNRL. Absence of nitrosamines and low cytotoxicity of radiation vulcanized NR latex are recognized as the remarkable advantages of RVNRL. The radiation vulcanization process for the production of protective rubber gloves for radioactive contamination was presented as the first commercial success in RVNRL. It was reported that various kinds of rubber articles for medical uses have being developed in West Germany. A sensitizer system consisting of n-butyl acrylate and t-butyl hydroperoxide was found to reduce the vulcanization dose to 8 kGy. (author)

  11. Latex glove sensitivity amongst diagnostic imaging healthcare personnel: a self-reporting investigation

    International Nuclear Information System (INIS)

    Healy, Jan; Brennan, Patrick C.; Bowden, Julie Anne

    2003-01-01

    The use of latex gloves has risen dramatically among healthcare workers resulting in an increase in the number of workers experiencing reactions to gloves. Little evidence of reactions among Irish healthcare workers is available. The current, self-reporting study investigated the prevalence to latex gloves amongst four professional groups within three Diagnostic Imaging Departments. Prevalence is similar to that demonstrated elsewhere with 18.3% of individuals expressing latex associated symptoms. Symptoms included itching and redness of hands, dry cracked skin, soreness of eyes and upper respiratory tract complaints. These results indicate that latex hypersensitivity is a real problem amongst Irish healthcare workers. This preliminary work provides the basis of a much larger controlled study currently being planned

  12. Effect of gamma radiation dose and sensitizer on the physical properties of irradiated natural rubber latex

    International Nuclear Information System (INIS)

    Komgrit, R.; Thawat, C.; B, Tripob; Wirach, T.

    2009-07-01

    Full text: The vulcanization of natural rubber latex can be induced by gamma radiation, which enhances cross-linking within the rubber matrix. The purpose of this research is to investigate the effect of gamma radiation dose and sensitizers on the physical properties of irradiated natural rubber. Three sensitizers n-butyl acrylate (n-B A), tetrachloroethylene (C 2 Cl 4 ) and trichloromethane (CHCl 3 ) were mixed with natural rubber latex before irradiation with gamma ray dose varied from 14 to 22 kGy. Results showed that the mixture of three sensitizers with specific ratios effectively induced the cross-linking of natural rubber latex. The cross-linking ratio and improved physical properties increased with increasing gamma dose. Therefore, the mixture ratios of n-B A, C 2 Cl 4 and CHCl 3 have shown to be a critical parameter in the vulcanization of natural rubber latex by gamma radiation

  13. A LaTeX graphics routine for drawing Feynman diagrams

    International Nuclear Information System (INIS)

    Levine, M.J.S.

    1990-01-01

    FEYNMAN is a LaTeX macropackage which allows the user to construct a versatile range of Feynman diagrams within the text of a document. Diagrams of publication quality may be drawn with relative ease and rapidity. (orig.)

  14. Polylactide/Montmorillonite Hybrid Latex as a Barrier Coating for Paper Applications

    Directory of Open Access Journals (Sweden)

    Davide Bandera

    2016-03-01

    Full Text Available We developed a paper coating for the potential application in food packaging based on polylactide and montmorillonite. It is applied to the paper in the form of a stable, water-based latex with a solid content of 25–28 wt %. The latex is prepared from a commercially available polylactide, surfactants, montmorillonite, a plasticizer, chloroform (to be removed later and water by an emulsion/solvent evaporation procedure. This coating formulation is applied to the paper substrate by bar-coating, followed by hot-pressing at 150 °C. The coated papers achieved up to an 85% improvement in water vapor transmission rates when compared to the pristine papers. The coating latex is prepared from inexpensive materials and can be used for a solvent-free coating process. In addition, the ingredients of the latex are non-toxic; thus, the coated papers can be safely used for food packaging.

  15. Formation of Defect-Free Latex Films on Porous Fiber Supports

    KAUST Repository

    Lively, Ryan P.; Mysona, Joshua A.; Chance, Ronald R.; Koros, William J.

    2011-01-01

    a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions

  16. Radiation vulcanization of natural rubber latex (NRL) using low energy electron beam accelerator

    International Nuclear Information System (INIS)

    Feroza Akhtar; Keizo Makuuchi; Fumio Yoshii

    1996-01-01

    The electron beam induced vulcanization of natural rubber latex has been studied using low energy Electron Beam (EB) accelerators of 300, 250 and 175 keV ne latex was irradiated in a special type stainless steel reaction reactor with a stirrer at the bottom of the reactor. From the results it was found that 300 and 250 keV accelerators could effectively vulcanize NRL. But accelerator of 175 keV is too low energy to vulcanize the latex. At the same time a drum type irradiator where thin layer of NRL was irradiated by accelerator, was used for vulcanization of NRL. This type of irradiator also showed good physical properties of vulcanized latex. The effects of beam current and stirrer speed on vulcanization were studied

  17. Prevalence of Allergy to Natural Rubber Latex and Potential Cross Reacting Food in Operation Room Staff in Shiraz Hospitals -2006

    Directory of Open Access Journals (Sweden)

    H Nabavizade

    2007-07-01

    Full Text Available Introduction & Objective: Allergic reactions to natural rubber latex have increased during past 10 years especially among health care workers and patients with high exposure to latex allergens. Allergic reaction to latex is related to many diseases like occupational asthma. This study was performed to determine the prevalence of allergy to natural rubber latex and potential cross reacting food in operation room staff in Shiraz hospitals. Materials & Methods: In this cross-sectional descriptive study five hundred eighty operation room staff of ten private and state hospitals in Shiraz completed latex allergy questionnaire. They were questioned about personal history and previous history of latex sensitivity, symptoms of latex reactivity and about other allergies particularly to foods that may cross react with latex. Informed consent was obtained and skin prick testing was performed with natural rubber latex. Skin prick tests were done with three potentially cross reacting food (banana, Kiwi, and potato. The obtained data were analyzed with SPSS software and Chi-square test. Results: Among the 580 operation room workers 104 (17.9 % of participants were positive to latex skin test. We found a significant association between positive skin test to latex in operation room staff and atopy, urticaria and food allergy. Positive skin test to latex related to positive kiwi skin test (p<0.05. The prevalence did not vary by sex, age, education, surgical and non surgical glove users, history of contact dermatitis or smoking status. Conclusion: Latex allergy has a high prevalence in personnel of operation room. Evaluation of present symptom and prediction of future disease necessitate screening test in individuals at risk.

  18. Latex allergy and occupational asthma in health care workers: adverse outcomes.

    OpenAIRE

    Amr, Sania; Bollinger, Mary E.

    2004-01-01

    The prevalence of natural rubber latex (NRL) allergy has been estimated to be 5-18% in health care workers, and latex exposure has been one of the leading causes of occupational asthma in the last several years. We present the cases of two nurses who developed sensitivity to NRL, both with dermatologic symptoms and respiratory symptoms that included asthma. They were referred to the University of Maryland for evaluation of their allergies, then for occupational and environmental consults. The...

  19. Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3

    International Nuclear Information System (INIS)

    Dessouki, A.M.; Taher, N.H.; El-Nahas, H.H.

    1996-01-01

    The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the ζ potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs

  20. Preparation of composites of national rubber latex (NRL) - portland cement mould. Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    Dessouki, A M; Taher, N H; El-Nahas, H H [National Center for Radiation Research and Technology, Atomic Energy Athority, Cairo (Egypt)

    1996-03-01

    The aim of this study is to prepare some polymeric mould using national rubber latex (NRL) - portland cement composites based on a delayed- action mechanism. Factors affecting the preparation process such as concentration, mixing percentage, additives and their effect on what is regarded as a delayed action coacervant combination was studied. Composites of national latex (NRL) - portland cement would were prepared as two separate parts. The stabilized natural rubber latex (NRL) 100 parts with hydroxy ethyl cellulose (HEC) 2 parts as stabilizer and a delayed - action coacervant (sodium meta silicate as a delaying agent) 5 parts on one hand and the dry blend of cement 65 parts soluble in 65 parts of water as a paste on the other hand were mixed thoroughly on site. (HEC) was added to the rubber latex to prevent the coagulation of the rubber latex with the electrolyte (sodium meta silicate) present in the rubber mixture. Two kinds of stabilization occurred in the rubber part, namely steric stabilization and the stabilization against electrolyte. The effect of delayed - action coacervant (sodium meta silicate) on the initial setting time of rubber - cement mould showed that the molding process did not occur at sodium meta silicate concentration less than 2.66 parts per 100 parts of rubber latex (phr), and the optimum concentration used was 5% parts of rubber latex. It was observed that addition of a delaying agent (Sodium meta silicate) to the rubber part enhanced the delaying mechanism in the time needed for the molding process, while the addition of the delaying agent to the cement part did not have any effect on retardation of the molding process. Chemical coacervants function mainly by reducing the {zeta} potential which is associated with the electrical double layer surrounding the latex particle. This reduction may brought about in at least three distinct ways which take place in the system studied. 5 figs., 3 tabs.

  1. About morphology in ethylene-propylene(-diene) copolymers-based latexes

    NARCIS (Netherlands)

    Tillier, D.L.; Meuldijk, J.; Hoehne, G.W.H.; Frederik, P.M.; Regev, O.; Koning, C.E.

    2005-01-01

    Coatings and engineering plastics often require high impact strength. This property can be achieved with tougheners. For the present paper, core-shell impact modifiers were synthesized using ethylene–propylene copolymers (EPM), ethylene–propylene-diene copolymers (EPDM) or a mixture of both types

  2. Deposition behavior of polystyrene latex particles on solid surfaces during migration through an artificial fracture in a granite rock sample

    International Nuclear Information System (INIS)

    Chinju, Hirofumi; Tanaka, Satoru; Kuno, Yoshio

    2001-01-01

    The deposition behavior of colloids during transport through heterogeneous media was observed by conducting column experiments to study migration of polystyrene latex particles (diameter=309 nm) through columns packed with artificially fractured granite rock (length=300 and 150 mm). The experiments were conducted under conditions of different ionic strengths and flow rates. The results were similar to those for colloid deposition in columns packed with glass beads reported previously; the colloid breakthrough curves showed three stages, characterized by different rates of change in the concentration of effluent. Colloid deposition on the fracture surfaces was described by considering strong and weak deposition sites. Scanning Electron Microscopy (SEM) observations indicated the existence of strong and weak sites on the fracture surfaces regardless of mineral composition. The observations also showed that the strong deposition sites tended to exist on surface irregularities such as cracks or protrusions. The degree of colloid deposition increased with increasing ionic strength and decreasing flow rate. The dependencies on ionic strength and flow rate agreed qualitatively with the DLVO theory and the previous experimental results, respectively. (author)

  3. Soybean oil in water-borne coatings and latex film formation study by AC impedance

    Science.gov (United States)

    Jiratumnukul, Nantana

    Conventional coalescing agents such as butyl cellosolve, butyl carbitol, and TexanolRTM are widely use in the latex coatings industry to facilitate film formation at ambient temperature. Coalescent aids are composed of solvents with low evaporation rates. After water evaporates, coalescent aids would help soften polymer molecules and form continuous films, then gradually evaporates from the film. Coalescent aids, therefore, are considered as volatile organic compounds (VOC), which are of environmental concern. The main purpose of this research project was to prepare a fatty acid glycol ester from soybean oil and glycol (polyols). The soybean oil glycol ester can be used as a coalescent aid in latex paint formulation. The soybean oil glycol ester not only lowered the minimum film formation temperature of latex polymers and continuous film formed at ambient temperature, but also after it has facilitated film formation, does not substantially evaporate, but becomes part of the film. Soybean oil glycol esters, therefore, can reduce the VOC levels and facilitate film formation of latex paints. In the second part of this research AC-Impedance was used to investigate the efficiency of soybean oil coalescent aid in latex film formation relative to the conventional ones. The coating resistance showed that the efficiency of film formation was increased as a function of dry time. The coating resistance also exhibited the effect of soybean oil ester in latex film formation in the same fashion as a conventional coalescent aid, TexanolRTM.

  4. Preparation of novel film-forming armoured latexes using silica nanoparticles as a pickering emulsion stabiliser.

    Science.gov (United States)

    Shiraz, Hana; Peake, Simon J; Davey, Tim; Cameron, Neil R; Tabor, Rico F

    2018-05-15

    Film-forming polymer latex particles of diameter acrylate (BA) as co-monomers, potassium persulphate (KPS) as an initiator and a commercially available colloidal nano-silica (Ludox®-TM40). It was found that pH control before polymerisation using methacrylic acid (MAA) facilitated the formation of armoured latexes, and mechanistic features of this process are discussed. An alternative, more robust protocol was developed whereby addition of vinyltriethoxysilane (VTES) to control wettability resulted in latexes completely armoured in colloidal nano-silica. The latexes were characterised using SEM, cryo-TEM and AFM imaging techniques. The mechanism behind the adsorption was investigated through surface pressure and contact angle measurements to understand the factors that influence this irreversible adsorption. Results indicate that nanoparticle attachment (but intriguingly not latex size) is dependent on particle wettability, providing new insight into the formation of nanoparticle-armoured latexes, along with opportunities for further development of diversely functionalized inorganic/organic polymer composite particles. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Capacitance Regression Modelling Analysis on Latex from Selected Rubber Tree Clones

    International Nuclear Information System (INIS)

    Rosli, A D; Baharudin, R; Hashim, H; Khairuzzaman, N A; Mohd Sampian, A F; Abdullah, N E; Kamaru'zzaman, M; Sulaiman, M S

    2015-01-01

    This paper investigates the capacitance regression modelling performance of latex for various rubber tree clones, namely clone 2002, 2008, 2014 and 3001. Conventionally, the rubber tree clones identification are based on observation towards tree features such as shape of leaf, trunk, branching habit and pattern of seeds texture. The former method requires expert persons and very time-consuming. Currently, there is no sensing device based on electrical properties that can be employed to measure different clones from latex samples. Hence, with a hypothesis that the dielectric constant of each clone varies, this paper discusses the development of a capacitance sensor via Capacitance Comparison Bridge (known as capacitance sensor) to measure an output voltage of different latex samples. The proposed sensor is initially tested with 30ml of latex sample prior to gradually addition of dilution water. The output voltage and capacitance obtained from the test are recorded and analyzed using Simple Linear Regression (SLR) model. This work outcome infers that latex clone of 2002 has produced the highest and reliable linear regression line with determination coefficient of 91.24%. In addition, the study also found that the capacitive elements in latex samples deteriorate if it is diluted with higher volume of water. (paper)

  6. Latex Rubber Gloves as a Sampling Dosimeter Using a Novel Surrogate Sampling Device.

    Science.gov (United States)

    Sankaran, Gayatri; Lopez, Terry; Ries, Steve; Ross, John; Vega, Helen; Eastmond, David A; Krieger, Robert I

    2015-01-01

    Pesticide exposure during harvesting of crops occurs primarily to the workers' hands. When harvesters wear latex rubber gloves for personal safety and hygiene harvesting reasons, gloves accumulate pesticide residues. Hence, characterization of the gloves' properties may be useful for pesticide exposure assessments. Controlled field studies were conducted using latex rubber gloves to define the factors that influence the transfer of pesticides to the glove and that would affect their use as a residue monitoring device. A novel sampling device called the Brinkman Contact Transfer Unit (BCTU) was constructed to study the glove characteristics and residue transfer and accumulation under controlled conditions on turf. The effectiveness of latex rubber gloves as sampling dosimeters was evaluated by measuring the transferable pesticide residues as a function of time. The validation of latex rubber gloves as a residue sampling dosimeter was performed by comparing pesticide transfer and dissipation from the gloves, with the turf transferable residues sampled using the validated California (CA) Roller, a standard measure of residue transfer. The observed correlation (Pearson's correlation coefficient R(2)) between the two methods was .84 for malathion and .96 for fenpropathrin, indicating that the BCTU is a useful, reliable surrogate tool for studying available residue transfer to latex rubber gloves under experimental conditions. Perhaps more importantly, these data demonstrate that latex gloves worn by workers may be useful quantifiable matrices for measuring pesticide exposure.

  7. Enhanced protein adsorption and patterning on nanostructured latex-coated paper.

    Science.gov (United States)

    Juvonen, Helka; Määttänen, Anni; Ihalainen, Petri; Viitala, Tapani; Sarfraz, Jawad; Peltonen, Jouko

    2014-06-01

    Specific interactions of extracellular matrix proteins with cells and their adhesion to the substrate are important for cell growth. A nanopatterned latex-coated paper substrate previously shown to be an excellent substrate for cell adhesion and 2D growth was studied for directed immobilization of proteins. The nanostructured latex surface was formed by short-wavelength IR irradiation of a two-component latex coating consisting of a hydrophilic film-forming styrene butadiene acrylonitrile copolymer and hydrophobic polystyrene particles. The hydrophobic regions of the IR-treated latex coating showed strong adhesion of bovine serum albumin (cell repelling protein), fibronectin (cell adhesive protein) and streptavidin. Opposite to the IR-treated surface, fibronectin and streptavidin had a poor affinity toward the untreated pristine latex coating. Detailed characterization of the physicochemical surface properties of the latex-coated substrates revealed that the observed differences in protein affinity were mainly due to the presence or absence of the protein repelling polar and charged surface groups. The protein adsorption was assisted by hydrophobic (dehydration) interactions. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. A semi-grand canonical Monte Carlo simulation model for ion binding to ionizable surfaces: proton binding of carboxylated latex particles as a case study.

    Science.gov (United States)

    Madurga, Sergio; Rey-Castro, Carlos; Pastor, Isabel; Vilaseca, Eudald; David, Calin; Garcés, Josep Lluís; Puy, Jaume; Mas, Francesc

    2011-11-14

    In this paper, we present a computer simulation study of the ion binding process at an ionizable surface using a semi-grand canonical Monte Carlo method that models the surface as a discrete distribution of charged and neutral functional groups in equilibrium with explicit ions modelled in the context of the primitive model. The parameters of the simulation model were tuned and checked by comparison with experimental titrations of carboxylated latex particles in the presence of different ionic strengths of monovalent ions. The titration of these particles was analysed by calculating the degree of dissociation of the latex functional groups vs. pH curves at different background salt concentrations. As the charge of the titrated surface changes during the simulation, a procedure to keep the electroneutrality of the system is required. Here, two approaches are used with the choice depending on the ion selected to maintain electroneutrality: counterion or coion procedures. We compare and discuss the difference between the procedures. The simulations also provided a microscopic description of the electrostatic double layer (EDL) structure as a function of pH and ionic strength. The results allow us to quantify the effect of the size of the background salt ions and of the surface functional groups on the degree of dissociation. The non-homogeneous structure of the EDL was revealed by plotting the counterion density profiles around charged and neutral surface functional groups. © 2011 American Institute of Physics

  9. Latex Imaging by Environmental STEM: Application to the Study of the Surfactant Outcome in Hybrid Alkyd/Acrylate Systems

    OpenAIRE

    Faucheu , Jenny; Chazeau , Laurent; Gauthier , Catherine; Cavaille , Jean-Yves; Goikoetxea , Monika; Minari , Roque; Asua , Jose M.

    2009-01-01

    International audience; Among other uses. latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase, However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this loca...

  10. The physicochemical quality and meat microstructure of post laying hen with addition of Biduri (Calotropis gigantea) latex extract

    Science.gov (United States)

    Nuhriawangsa, A. M. P.; Hertanto, B. S.; Kartikasari, L. R.; Swastike, W.; Cahyadi, M.; Rasid, S.

    2018-01-01

    The objective of this study was to evaluate the effect of extract level of Biduri latex on the meat quality of laying hens. The materials of this research were Biduri latex and thigh meat from hens strain Lohman. The latex was tapped from a young tissue stem and centrifuged for its supernatant. Meats were smeared with latex, punctured and incubated for 30 minutes. Concentrations of latex were 0, 3, 6 and 9% from the weight of meat (w/w). The variables were water, dissolved protein, crude fat content, tenderness and microstructure of meat. The statistical analysis method using ANOVA and if there was a mean difference, Duncan test was used. Descriptive analysis was used for microstructures of meat by comparing its hydrolysis conditions. The study showed that fat had significant difference (P meat structure. The fat content increased with addition of 3% latex. The value of dissolved protein increased but tenderness decreased by addition extract of 6% latex. The addition of Biduri latex extract showed that hydrolysis in the microstructure of meat. The addition of 6% latex was the best meat quality.

  11. Latex imaging by environmental STEM: application to the study of the surfactant outcome in hybrid alkyd/acrylate systems.

    Science.gov (United States)

    Faucheu, Jenny; Chazeau, Laurent; Gauthier, Catherine; Cavaillé, Jean-Yves; Goikoetxea, Monika; Minari, Roque; Asua, José M

    2009-09-01

    Among other uses, latexes are a successful alternative to solvent-borne binders for coatings. Efforts are made to produce hybrid nanostructured latexes containing an acrylic phase and an alkyd phase. However, after the film-forming process, the surfactant used to stabilize these latexes remains in the film, and its location can have a drastic effect on the application properties. Among the processing parameters, the alkyd hydrophobicity can strongly influence this location. This article aims at the imaging of these surfactant molecules in two hybrid latexes with different hydrophobicity level of the alkyd resin. A first part of this paper is dedicated to the understanding of the contrast provided by the surfactant in environmental STEM imaging of latexes. Then, the influence of surfactant-polymer affinity on the surfactant location after film-forming of those hybrid alkyd/acrylate latexes is studied by this technique. It is shown that in the hybrid latex with an alkyd shell (obtained with the most hydrophilic resin), the surfactant molecules tend to remain buried in the alkyd phase. Conversely, in the hybrid latex with an acrylate shell (in the case of the most hydrophobic resin), the surfactant molecules tend to gather into islands like in pure acrylate latex films.

  12. Ciprofloxacin release using natural rubber latex membranes as carrier.

    Science.gov (United States)

    Dias Murbach, Heitor; Jaques Ogawa, Guilherme; Azevedo Borges, Felipe; Romeiro Miranda, Matheus Carlos; Lopes, Rute; Roberto de Barros, Natan; Guedes Mazalli, Alexandre Vinicius; Gonçalves da Silva, Rosângela; Ferreira Cinman, José Luiz; de Camargo Drago, Bruno; Donizetti Herculano, Rondinelli

    2014-01-01

    Natural rubber latex (NRL) from Hevea brasiliensis is easily manipulated, low cost, is of can stimulate natural angiogenesis and cellular adhesion, is a biocompatible, material and presents high mechanical resistance. Ciprofloxacin (CIP) is a synthetic antibiotic (fluoroquinolone) used in the treatment of infection at external fixation screws sites and remote infections, and this use is increasingly frequent in medical practice. The aim of this study was to develop a novel sustained delivery system for CIP based on NRL membranes and to study its delivery system behavior. CIP was found to be adsorbed on the NRL membrane, according to results of energy dispersive X-ray spectroscopy. Results show that the membrane can release CIP for up to 59.08% in 312 hours and the mechanism is due to super case II (non-Fickian). The kinetics of the drug release could be fitted with double exponential function X-ray diffraction and Fourier transform infrared (FTIR) spectroscopy shows some interaction by hydrogen bound, which influences its mechanical behavior.

  13. Improving of Water Resistance of Asphalt Concrete Wearing Course Using Latex-Bitumen Binder

    Directory of Open Access Journals (Sweden)

    Siswanto Henri

    2017-01-01

    Full Text Available It is well known that presence of water in a bituminous mix is a critical factor which can lead to premature failure of flexible pavements. This requires solutions one of which is to formulate an asphalt mix that has a high resistance to moisture and one way to do this is to mix latex with the asphalt mix. The purpose of this experimental study was to investigate the effect of water on Marshall stability of asphalt concrete wearing course (ACWC made with a latex-bitumen binder. Latex-bitumen was mixed with aggregate and four levels of latex content were investigated in this study, namely, 0%, 2%, 4% and 6% respectively by weight of asphalt. Wet procces was used in the blending of mixtures. The procedure used to obtain the optimum binder contents conformed to the Marshall procedure (SNI 06-2489-1991. Six Marshall specimens at optimum binder content were prepared for each binder mix investigated. Three of six specimens from each group were tested under Marshall standards. The remaining specimens were tested by immersion in a bath at 60°C for 24 hours. The Marshall index of retained stability was used to evaluate the effect of water on the Marshall stability of ACWC. The results indicated that the addition of up to 4% latex to ACWC mix increased the retained Marshall stability, whereas the addition of latex above 4% decreased the retained stability of the mixture. The addition of 4% CRM significantly improved the retained stability of the mixture and was the best latex – ACWC mix.

  14. Changes in chemical permeation of disposable latex, nitrile, and vinyl gloves exposed to simulated movement.

    Science.gov (United States)

    Phalen, Robert N; Le, Thi; Wong, Weng Kee

    2014-01-01

    Glove movement can affect chemical permeation of organic compounds through polymer glove products. However, conflicting reports make it difficult to compare the effects of movement on chemical permeation through commonly available glove types. The aim of this study was to evaluate the effect of movement on chemical permeation of an organic solvent through disposable latex, nitrile, and vinyl gloves. Simulated whole-glove permeation testing was conducted using ethyl alcohol and a previously designed permeation test system. With exposure to movement, a significant decrease (p ≤ 0.001) in breakthrough time (BT) was observed for the latex (-23%) and nitrile gloves (-31%). With exposure to movement, only the nitrile glove exhibited a significant increase (p ≤ 0.001) in steady-state permeation rate (+47%) and cumulative permeation at 30 min (+111%). Even though the nitrile glove provided optimum chemical resistance against ethyl alcohol, it was most affected by movement. With exposure to movement, the latex glove was an equivalent option for overall worker protection, because it was less affected by movement and the permeation rate was lower than that of the nitrile glove. In contrast, the vinyl glove was the least affected by movement, but did not provide adequate chemical resistance to ethyl alcohol in comparison with the nitrile and latex gloves. Glove selection should take movement and polymer type into account. Some glove polymer types are less affected by movement, most notably the latex glove in this test. With nitrile gloves, at least a factor of three should be used when attempting to assign a protection factor when repetitive hand motions are anticipated. Ultimately, the latex gloves outperformed nitrile and vinyl in these tests, which evaluated the effect of movement on chemical permeation. Future research should aim to resolve some of the observed discrepancies in test results with latex and vinyl gloves.

  15. Effect of the strain-induced melt activation (SIMA) process on the tensile properties of a new developed super high strength aluminum alloy modified by Al-5Ti-1B grain refiner

    Energy Technology Data Exchange (ETDEWEB)

    Haghparast, Amin [School of Mechanical Engineering, College of Engineering, University of Tehran, Tehran (Iran, Islamic Republic of); Nourimotlagh, Masoud [Young Researchers Club, Dareshahr Branch, Islamic Azad university (Iran, Islamic Republic of); Alipour, Mohammad, E-mail: Alipourmo@ut.ac.ir [School of Metallurgy and Materials Engineering, University of Tehran, Tehran (Iran, Islamic Republic of)

    2012-09-15

    In this study, the effect of Al-5Ti-1B grain refiners and modified strain-induced melt activation process on an Al-Zn-Mg-Cu alloy was studied. The optimum level of Ti was found to be 0.1 wt.%. The specimens subjected to deformation ratio of 40% (at 300 Degree-Sign C) and various heat treatment times (10-40 min) and temperature (550-600 Degree-Sign C) regimes were characterized in this study. Reheating condition to obtain a fine globular microstructure was optimized. Microstructural examinations were conducted by optical and scanning electron microscopy coupled with an energy dispersive spectrometry. The optimum temperature and time in strain-induced melt activation process are 575 Degree-Sign C and 20 min, respectively. T6 heat treatment including quenching to room temperature and aging at 120 Degree-Sign C for 24 h was employed to reach to the maximum strength. Significant improvements in mechanical properties were obtained with the addition of grain refiner combined with T6 heat treatment. After the T6 heat treatment, the average tensile strength increased from 283 MPa to 587 and 332 MPa to 617 for samples refined with 2 wt.% Al-5Ti-1B before and after strain-induced melt activation process and extrusion process, respectively. Ultimate strength of Ti-refined specimens without SIMA process has a lower value than globular microstructure specimens after SIMA and extrusion process. - Highlights: Black-Right-Pointing-Pointer The effect of Al-5Ti-1B on the aluminum alloy produced by SIMA process was studied. Black-Right-Pointing-Pointer Al-5Ti-1B is an effective in reducing the grain and reagent fine microstructure. Black-Right-Pointing-Pointer Reheating condition to obtain a fine globular microstructure was optimized. Black-Right-Pointing-Pointer The optimum temperature and time in SIMA process are 575 Degree-Sign C and 20 min respectively. Black-Right-Pointing-Pointer UTS of globular structure specimens have a more value than Ti-refined specimens.

  16. Measurements of dispersion forces between colloidal latex particles with the atomic force microscope and comparison with Lifshitz theory

    Energy Technology Data Exchange (ETDEWEB)

    Elzbieciak-Wodka, Magdalena; Ruiz-Cabello, F. Javier Montes; Trefalt, Gregor; Maroni, Plinio; Borkovec, Michal, E-mail: michal.borkovec@unige.ch [Department of Inorganic and Analytical Chemistry, University of Geneva, Sciences II, 30, Quai Ernest-Ansermet, 1205 Geneva (Switzerland); Popescu, Mihail N. [Ian Wark Research Institute, University of South Australia, Mawson Lakes, SA 5095 (Australia)

    2014-03-14

    Interaction forces between carboxylate colloidal latex particles of about 2 μm in diameter immersed in aqueous solutions of monovalent salts were measured with the colloidal probe technique, which is based on the atomic force microscope. We have systematically varied the ionic strength, the type of salt, and also the surface charge densities of the particles through changes in the solution pH. Based on these measurements, we have accurately measured the dispersion forces acting between the particles and estimated the apparent Hamaker constant to be (2.0 ± 0.5) × 10{sup −21} J at a separation distance of about 10 nm. This value is basically independent of the salt concentration and the type of salt. Good agreement with Lifshitz theory is found when roughness effects are taken into account. The combination of retardation and roughness effects reduces the value of the apparent Hamaker constant and its ionic strength dependence with respect to the case of ideally smooth surfaces.

  17. Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L

    Science.gov (United States)

    McCay, Steven; Mahlberg, Paul

    1973-01-01

    Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590

  18. Latex allergy: new insights to explain different sensitization profiles in different risk groups.

    Science.gov (United States)

    Peixinho, C; Tavares-Ratado, P; Tomás, M R; Taborda-Barata, L; Tomaz, C T

    2008-07-01

    Differences in latex allergen sensitization profiles have been described between children subjected to repetitive surgical interventions and health care workers (HCW). 'Major' allergens for patients with spina bifida are Hev b 1, 3 and 7, while for HCW, 'major' allergens are Hev b 2, 5, 6.01 and 13. The reason for these differential sensitization profiles is currently unknown. To investigate latex allergen profiles on internal and external surfaces of natural rubber latex gloves. Eighty-two samples of commonly used surgical gloves (41 glove brands) were used for analysis. Specific allergen levels of Hev b 1, 3, 5 and 6.02 on both surfaces of the gloves were quantified using an enzyme immunometric assay, a FITkit (FIT Biotech, Tampere, Finland). Differences in allergen levels were observed between internal and external surfaces of all glove types. Concentrations of Hev b 1 and Hev b 3 were significantly higher on external surfaces, while internal surfaces had higher allergen levels of Hev b 5 and Hev b 6.02. Analysis of surgical and examination gloves, powdered and nonpowdered gloves also showed that the content of Hev b 5 and Hev b 6.02 was significantly higher on internal surfaces while that of Hev b 1 and Hev b 3 was higher on external surfaces. Our study showed different allergen profiles on internal and external surfaces of natural rubber latex gloves. These results may suggest a relationship between latex allergen localization and sensitization routes in different risk groups.

  19. Color Spectrum Properties of Pure and Non-Pure LATEX in Discriminating Rubber Clone Series

    International Nuclear Information System (INIS)

    Noor Aishah Khairuzzaman; Hadzli Hashim; Nina Korlina Madzhi; Noor Ezan Abdullah; Faridatul Aima Ismail; Ahmad Faiz Sampian; Azhana Fatnin Che Will

    2015-01-01

    A study of color spectrum properties for pure and non-pure latex in discriminating rubber clone series has been presented in this paper. There were five types of clones from the same series being used as samples in this study named RRIM2002, RRIM2007, RRIM2008, RRIM2014, and RRIM3001. The main objective is to identify the significant color spectrum (RGB) from pure and non-pure latex that can discriminate rubber clone series. The significant information of color spectrum properties for pure and non-pure latex is determined by using spectrometer and Statistical Package for the Social Science (SPSS). Visible light spectrum (VIS) is used as a radiation light of the spectrometer to emit light to the surface of the latex sample. By using SPSS software, the further numerical analysis of color spectrum properties is being conducted. As the conclusion, blue color spectrum for non-pure is able to discriminate for all rubber clone series whereas only certain color spectrum can differentiate several clone series for pure latex. (author)

  20. Status RVNRL in German latex industry and its introduction to the European market

    International Nuclear Information System (INIS)

    Bez, W.

    1996-01-01

    Reasons to look for an alternative crosslinking system avoiding sulphur curing was the restrictive policy of the German Health Authorities concerning nitrosamines. It was concluded that radiation curing offers further advantages . By avoiding the accelerators, type IV allergy is excluded, cytotoxicity is minimised to a very low level, films have better clarity and when thoroughly leached higher electrical resistance. Treatment of waste give no SO sub 2 emissions by burning, no Zinc in the ashes and possibly better microbial degradation. A development was carried out to irradiate natural latex by electron beam with a Dynamitron equipment. It was found trimethylolpropanetrimethacrylate to be a suitable sensitizer. Because of to high prices this development was interrupted. For future application trials and efforts to introduce RVNRL in the market gamma ray radiated natural latex either from Batan, Indonesia or MINT, Malaysia are used. Mainly dipped goods were produce, but radiated natural latex has shown good results in other processes. During discussions with customers it has proved necessary to establish specifications for RVNRL. A serious problem using natural latex for the production of medical devices is the type I allergy. Attempts are made to dip surgical gloves, leach them thoroughly and control extractable proteins were reduced to the very low level of 6.5 μg/g. Out of 18 patients sensitive to natural latex protein wearing gloves made from RVNRL only six have shown a positive response. That means RVNRL could help to solve the protein allergy problem. Further developments on this line are scheduled

  1. Labbtex: Toolbox para generación de informes en LATEX para Matlab

    Directory of Open Access Journals (Sweden)

    José Luis Almazán Gárate

    2012-10-01

    Full Text Available En este artículo se presenta el software desarrollado por el Equipo H3lite dentro del Departamento de Ingeneniería Civil. Transportes de la Escuela de Ingenieros de Caminos, Canales y Puertos de la Universidad Politécnica de Madrid para la generación de informes enLATEX mediante el software Matlab® y la integración en sus rutinas, Labbtex.La librería Labbtex proporciona un marco flexible para mezclar texto y código Matlab® para la generación automática de documentos. Un rchivo fuente simple contiene el texto de documentación y el código Matlab, al correr la aplicación se genera un documento final LATEX que contiene el texto, gráficos y tablas indicados con el formato de un documento LATEX. El código Matlab genera un documento LATEX usando la sintaxis. Así, LATEX (para composición de texto de alta calidad y Matlab® (para cálculo matemático pueden usarse simultáneamente. Esto permite la generación de informes en tiempo real con un uso de recursos mínimo.

  2. Silver nanoparticles delivery system based on natural rubber latex membranes

    International Nuclear Information System (INIS)

    Guidelli, Éder José; Kinoshita, Angela; Ramos, Ana Paula; Baffa, Oswaldo

    2013-01-01

    The search for new materials for biomedical applications is extremely important. Here, we present results on the performance of a silver nanoparticles delivery system using natural rubber latex (NRL) as the polymeric matrix. Our aim was to obtain an optimized wound dressing by combining materials with potential healing action. The synthesis of silver nanoparticles and their characterization by UV–Vis spectroscopy, transmission electron microscopy, zeta potential, dynamic light scattering, and Fourier transform infrared spectroscopy (FTIR) are depicted. The NRL membranes are good matrix for silver nanoparticles and allow for their gradual release. The release of 30 nm silver nanoparticles by the NRL membranes depends on their mass percentage in NRL membranes. The total concentration of AgNP released by the NRL membranes was calculated. The AgNP attached to the cis-isoprene molecules in the NRL matrix remain attached to the membrane (∼0.1 % w/w). So, only the AgNP bound to the non-rubber molecules are released. FTIR spectra suggest that non-rubber molecules, like aminoacids and proteins, associated with the serum fraction of the NRL may be attached to the surfaces of the released nanoparticles, thereby increasing the release of such molecules. The released silver nanoparticles are sterically stabilized, more stable and well dispersed. Because the serum fraction of the NRL is responsible for the angiogenic properties of the matrix, the silver nanoparticles could increment the angiogenic properties of NRL. This biomaterial has desirable properties for the fabrication of a wound dressing with potential healing action, since it combines the angiogenic and antibacterial properties of the silver nanoparticles with the increased angiogenic properties of the NRL.Graphical AbstractThe AgNP attached to the cis-isoprene molecules remain in the NRL matrix and only the AgNP bound to the non-rubber molecules (NRL serum fraction) are released. The released AgNP are sterically

  3. Silver nanoparticles delivery system based on natural rubber latex membranes

    Energy Technology Data Exchange (ETDEWEB)

    Guidelli, Eder Jose, E-mail: ederguidelli@gmail.com [Universidade de Sao Paulo/FFCLRP-DF (Brazil); Kinoshita, Angela [Universidade do Sagrado Coracao (Brazil); Ramos, Ana Paula [Universidade de Sao Paulo/FFCLRP-DQ (Brazil); Baffa, Oswaldo [Universidade de Sao Paulo/FFCLRP-DF (Brazil)

    2013-04-15

    The search for new materials for biomedical applications is extremely important. Here, we present results on the performance of a silver nanoparticles delivery system using natural rubber latex (NRL) as the polymeric matrix. Our aim was to obtain an optimized wound dressing by combining materials with potential healing action. The synthesis of silver nanoparticles and their characterization by UV-Vis spectroscopy, transmission electron microscopy, zeta potential, dynamic light scattering, and Fourier transform infrared spectroscopy (FTIR) are depicted. The NRL membranes are good matrix for silver nanoparticles and allow for their gradual release. The release of 30 nm silver nanoparticles by the NRL membranes depends on their mass percentage in NRL membranes. The total concentration of AgNP released by the NRL membranes was calculated. The AgNP attached to the cis-isoprene molecules in the NRL matrix remain attached to the membrane ({approx}0.1 % w/w). So, only the AgNP bound to the non-rubber molecules are released. FTIR spectra suggest that non-rubber molecules, like aminoacids and proteins, associated with the serum fraction of the NRL may be attached to the surfaces of the released nanoparticles, thereby increasing the release of such molecules. The released silver nanoparticles are sterically stabilized, more stable and well dispersed. Because the serum fraction of the NRL is responsible for the angiogenic properties of the matrix, the silver nanoparticles could increment the angiogenic properties of NRL. This biomaterial has desirable properties for the fabrication of a wound dressing with potential healing action, since it combines the angiogenic and antibacterial properties of the silver nanoparticles with the increased angiogenic properties of the NRL.Graphical AbstractThe AgNP attached to the cis-isoprene molecules remain in the NRL matrix and only the AgNP bound to the non-rubber molecules (NRL serum fraction) are released. The released AgNP are

  4. Natural rubber latex: past, present and future in Latin America

    International Nuclear Information System (INIS)

    Lugao, A.B.; Miranda, A.; Mindrisz, A.C.; Andrade e Silva, L.G. de

    1996-01-01

    The origin of the Hevea braziliensis tree was the Amazonian region in South America, particularly the Brazilian jungle. The rubber expansion at the end of 9th century brought prosperity and determined the borders of Amazonian countries. In spite of that, the Brazilian government has failed in establishing a successful policy for improving the NR production in the jungle. However, rubber plantations were successfully introduced recently near marginal areas of the humid forest in the Amazon due to the absence of the fungus Microcyclos ulei. Both, extraction of wild rubber and plantation have a key role in the maintenance of the forest health. The market for dipping products is small but is growing very fast and is expected to follow this pattern as the sanitary conditions are improved by the health authority. The history of the Brazilian NR products industry is contemporary and is based on the policy of market protection and on the lack of investments due to extremely high interest rates. As a result, the industry was not competitive. It was concluded that, in order to cope with the future challenge, the industry is required to invest in very modern technologies to produce first class goods with international acceptance. Latin America would follow the world trend for nitrosamine and protein free products. The radiation vulcanization of natural rubber latex could prove itself as a profitable solution and not only a quality solution. It was also concluded that both wild rubber and rubber plantations in Brazil have their future coupled with the future of a regional dipping industry. Moreover, the buildup of the dipping industry will be beneficial to the protection of the humid forest and the recovery of degraded areas

  5. Extractable proteins from electron beam (EB) irradiated natural rubber (NR) latex

    International Nuclear Information System (INIS)

    Feroza Akhtar; Fumio Yoshii; Keizo Makuuchi

    1996-01-01

    The protein assay of natural rubber latex (NRL) vulcanized by low energy electron beam (EB, 300 keV, 30 mA) has been carried out using Bicinchoninic acid (BCA) reagent. Extractable protein in irradiated latex film was determined by measuring the absorption of colored solution at 562 nm using UV spectrometer. The effect of various radiation doses on the extractable protein content of NRL was investigated. It was ,found that the quantities of extractable protein increases with radiation dose. When compared with ,gamma-ray irradiated samples the same trend was observed. Electron beam irradiated latex films are leached in 1% (ammonia water for various lengths of time. From the results it was established that within 2 hours of leaching in ammonia water most of the extractable protein (96%) were removed from rubber film

  6. Extraction and comparison of proteins from natural rubber latex by conventional and ionizing radiation methods

    International Nuclear Information System (INIS)

    Rogero, Sizue O.; Spencer, Patrick J.; Campos, Vania E.; Lusvarghi, Fabio M.; Higa, Olga Z.

    1997-01-01

    Several proteins in natural rubber latex (NRL) have been assigned to be significant allergens. It is known that proteins submitted to ionizing radiation suffer denaturation and immunochemical modification resulting in low antigenic reactivity. The aim of this study was to extract and compare water extractable proteins from NRL films vulcanized by conventional and by ionizing radiation methods. SDS-polyacrylamide gel electrophoresis (SDS--PAGE) and high pressure liquid chromatography (HPLC) showed a diffuse protein band of about 14 KDa, which we believe is rubber elongation factor (REF), in both eluates, but smaller in latex film vulcanized by ionizing radiation. REF has been suggested to be a major latex allergen. These data suggest that ionizing radiation vulcanization could be an useful method for the production of NRL goods with low antigenicity. (author). 8 refs., 2 figs., 1 tab

  7. Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury, E-mail: jackalvesribeiro@gmail.com [Laboratorio de Engenharia e Biomaterial (BioEngLab), Faculdade Gama, Universidade de Brasilia (UnB), DF (Brazil); Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria [Universidade do Estado do Rio Grande do Norte (UERN), Mossoro, RN (Brazil)

    2017-05-15

    The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)

  8. Development assessment of natural latex membranes: a new proposal for the treatment of amblyopia

    International Nuclear Information System (INIS)

    Ribeiro, Jaqueline Alves; Rosa, Suelia Rodrigues Fleury; Leite, Cicilia Raquel Maia; Vasconcelos, Claudio Lopes; Soares, Joao Maria

    2017-01-01

    The ophthalmic dysfunction amblyopia, commonly known as lazy eye, is characterized by decreased vision in one eye due to improper development in childhood. The aim of this study was to obtain and characterize natural rubber membranes and to assess their utility as an eye film capable of altering the passage of light. The latex membranes were produced using the Van Gogh method and the deposition technique and were analyzed by physical and chemical methods to determine the properties of latex in natura and of natural rubber membranes. The materials were characterized by X-ray diffractometry, scanning electron microscopy, thermogravimetry, differential scanning calorimetry, analysis of water sorption and light crossing analysis. We report here a new approach to the treatment of patients with amblyopia using latex membranes. (author)

  9. Isolation rubber latex binary composites consisting of cotton and poly-N, N-dimethyl-N, N-diallilammony chloride

    Directory of Open Access Journals (Sweden)

    J. Cornejo Tueros

    2012-01-01

    Full Text Available The paper discusses the application of rubber from latex binary coagulating agent consisting of cotton - textile waste and polymeric quaternary ammonium salts. The influence on the process of extracting rubber from latex flow coagulating agent temsperatury and concentration of the dispersed phase.

  10. Production Of Hollow Toy Product From Radiation Pre vulcanized Natural Rubber Latex (RVNRL) By Using Casting And Moulding Technique

    International Nuclear Information System (INIS)

    Mohd Noorwadi Mat Lazim; Sofian Ibrahim; Muhammad Saiful Omar

    2013-01-01

    Hollow toy products are very synonym to the child from the age of months since it able to stimulating each of their sense such as sight, hearing, taste, touch and smell. Most of hollow toy products are made from natural rubber latex by using moulding and casting technique. The moulding and casting technique is a manufacturing process by pored liquid latex into a mould, which contain cavity of the desired shape. The mould made from plaster of Paris able to absorbs water from latex meanwhile the presence of calcium ions from plaster of Paris will tend to diffuse into latex thus promote formation of deposit on surface of cavity mould. To improve the quality and safety of hollow toy product made from latex, Radiation Pre vulcanized Natural Rubber Latex (RVNRL) has been identified to be used because it can fulfill the standard requirement for latex and also due to its special abilities such as lower modulus (soft latex products), nitrosamines free, low in nitrosatables, free from chemical accelerators induced allergies and better biodegradability. This paper identify the problem appears from the process of making hollow toy products from RVNRL by using moulding and casting technique. (author)

  11. Preliminary study of semi-refined carrageenan (SRC) as secondary gelling agent in natural rubber (NR) latex foam

    Science.gov (United States)

    Norhazariah, S.; Azura, A. R.; Azahari, B.; Sivakumar, R.

    2017-12-01

    Semi-refined carrageenan (SRC) product is considerably cheaper and easier to produce as a natural polysaccharide, which was utilized in food and other product application. However, the application in latex is limited. The aim of this work is to evaluate the SRC produced from low industrial grade seaweed (LIGS) in the latex foam application. The FTIR spectra showed the SRC produced as kappa type carrageenan with lower sulfur content compared to native LIGS. NR latex foam is produced by using the Dunlop method with some modifications. The effect of SRC loading as a secondary gelling agent in NR latex foam is investigated. The density and morphology of the NR latex foam with the addition of the SRC are analyzed. NR latex foam density increased with SRC loading and peaked at 1.8 phr SRC. The addition of SRC has induced the bigger cell size compared to the cell size of the control NR latex foam, as shown in the optical micrograph. It can be concluded that SRC LIGS could be acted as secondary gelling agent in NR latex foam.

  12. Deproteinised natural rubber latex grafted poly(dimethylaminoethyl methacrylate) - poly(vinyl alcohol) blend membranes: Synthesis, properties and application.

    Science.gov (United States)

    Jayadevan, Janisha; Alex, Rosamma; Gopalakrishnapanicker, Unnikrishnan

    2018-02-01

    Natural rubber latex was initially deproteinised (DNRL) and then subjected to physicochemical modifications to make high functional membranes for drug delivery applications. Initially, DNRL was prepared by incubating with urea, sodiumdodecylsulphate and acetone followed by centrifugation. The deproteinisation was confirmed by CHN analysis. The DNRL was then chemically modified by grafting (dimethylaminoethyl methacrylate) onto NR particles by using a redox initiator system viz; cumene hydroperoxide/tetraethylenepentamine, followed by dialysis for purification. The grafting was confirmed by dynamic light scattering, Fourier transform infrared spectroscopy and nuclear magnetic resonance spectroscopy. The grafted system was blended with a hydrophilic adhesive polymer PVA and casted into membranes. The membranes after blending showed enhanced mechanical properties with a threshold concentration of PVA. The moisture uptake, swelling and water contact angle experiments indicated an increased hydrophilicity with an increased PVA content in the blend membranes. The grafted DNRL possessed significant antibacterial property which has been found to be retained in the blended form. A notable decrease in cytotoxicity was observed for the modified DNRL membranes than the bare DNRL membranes. The in-vitro drug release studies using rhodamine B as a model drug, confirmed the utility of the prepared membranes to function as a drug delivery matrix. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Improving the stability of coal slurries. Quarterly progress report, June 15-September 15, 1986. [Adsorption of gum tragacanth on polystyrene latex

    Energy Technology Data Exchange (ETDEWEB)

    Fogler, H.S.

    1986-01-01

    Our earlier study has shown that hydrocolloids such as gum tragacanth (GT) are effective in stabilizing coal-water slurries by the steric stabilization mechanism and also possibly by electrostatic stabilization mechanism. In this study, polystyrene latex has been chosen as the model system for coal-water slurries because of its monodispersity and its well established surface properties. The studies of the effects of ionic strength and pH on adsorption isotherms indicate that the adsorption of GT is probably hydrophobic rather than electrostatic or hydrogen-bonding. The value of pK was measured to be 2.95, from which the relation between the stability factor and the degree of dissociation of GT in the solution was obtained. Combining the results from the adsorption study and the measurement of stability factor at various pH, it was found that the stability factor significantly changes with pH even with the same amount of GT adsorbed. This indicates that the steric layer thickness or the conformation of GT on the surface of latex varies with pH. Binding studies on coal-water slurries were also carried out before and after acid leach, and the results indicate that the metal oxides on the coal surface, such as Al/sub 2/O/sub 3/ and SiO/sub 2/, may be responsible for the adsorption with GT. 7 refs., 9 figs.

  14. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    International Nuclear Information System (INIS)

    Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko

    2016-01-01

    Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH_2)_1_1OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and

  15. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    Energy Technology Data Exchange (ETDEWEB)

    Määttänen, Anni, E-mail: anni.maattanen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Ihalainen, Petri, E-mail: petri.ihalainen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Törngren, Björn, E-mail: bjorn.torngren@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Rosqvist, Emil, E-mail: emil.rosqvist@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Pesonen, Markus, E-mail: markus.pesonen@abo.fi [Physics, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland); Peltonen, Jouko, E-mail: jouko.peltonen@abo.fi [Laboratory of Physical Chemistry, Faculty of Science and Engineering, Center for Functional Materials, Åbo Akademi University, Porthaninkatu 3, 20500, Turku (Finland)

    2016-02-28

    Graphical abstract: - Highlights: • Transparent self-supported latex films were fabricated by a peel-off process. • Various template substrates were used for creating e.g. hierarchically structured latex films. • Ultra-thin and semi-transparent conductive gold electrodes were evaporated on the latex films.Electrochemical experiments were carried out to verify the applicability of the electrodes. - Abstract: Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV–vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH{sub 2}){sub 11}OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal

  16. Effect of rootstock on the scion of Hevea brasiliensis through metabolic analysis of latex samples by 1H NMR

    Directory of Open Access Journals (Sweden)

    Eduardo Sanches Pereira do Nascimento

    2011-01-01

    Full Text Available In this study, the effect of rootstock on grafting through metabolomic analysis of latex (Hevea brasiliensis samples was verified by 1H nuclear magnetic resonance (NMR and multivariate data analysis. Sixteen metabolites present in the latex cytosol were characterized by NMR. PCA analysis showed that the latex samples of the RR and GR groups can be differentiated. The GR group samples present a metabolic profile similar to the RR group samples, while the RG group is in an intermediate position between RR and GG groups. Sucrose and formate contributed greatly to the separation obtained by PCA, presenting a good correlation between the results. 1H NMR was an efficient technique to differentiate latex samples from different types of rootstocks and grafting and in the future could be used to predict rubber production by latex analysis.

  17. The evolution and use of a personal LaTeX metapackage

    DEFF Research Database (Denmark)

    Andersen, Esben Sloth

    This document defines and describes esameta.sty and its variant esametaps.sty. They are personal LATEX packages that largely consist of calls of other packages. These 'metapackages' are selected to help the development of the author's complex book and paper projects-but some of his decisions migh...... be of more general relevance. The use of the LATEX system of 'literate programming' and the testing the compatibility of new commands and packages with the previously included parts of the metapackage should also be noticed....

  18. Mechanism of n-butyl acrylate sensitization action in radiation vulcanization of natural rubber latex

    International Nuclear Information System (INIS)

    Sabharwal, S.; Chaudhari, C.V.; Bhardwaj, Y.K.; Majali, A.B.; Das, T.N.

    1996-01-01

    In order to understand the role of n-butyl acrylate (nBA) in radiation vulcanization of natural rubber latex, pulse radiolysis technique has been utilized to study the reactions of the transient species produced by reaction of OH . , e- aq and H . atoms with nBA in aqueous solutions. The results show that transients produced by reaction of e- aq with nBA alone are capable of propagating the polymerization reaction and enhance the vulcanization process. These results have been further confirmed by studying the effect of electron scavengers on the vulcanization behaviour of natural rubber latex in presence of nBA. (author). 3 refs., 3 figs

  19. Radiation vulcanization of natural rubber latex using 250 keV electron beam machine

    Energy Technology Data Exchange (ETDEWEB)

    Chirinos, H.; Yoshii, F.; Makuuchi, K.; Lugao, A. E-mail: ablugao@net.ipen.br

    2003-08-01

    The sensitized radiation vulcanization of natural rubber latex has been carried out with 250 keV electrons. Latex was irradiated over a range of the beam current from 5 to 20 mA in the presence of sensitizers like the n-butyl acrylate (n-BA). The vulcanization dose decreases with increasing beam current condition. The rate of vulcanization (R{sub vul}) depends on the beam current (I) as given by the equation R{sub vul}=kI{sup 0.6}.

  20. Anticancer activity of flavonol and flavan-3-ol rich extracts from Croton celtidifolius latex.

    Science.gov (United States)

    Biscaro, Fernanda; Parisotto, Eduardo Benedetti; Zanette, Vanilde Citadini; Günther, Tania Mara Fischer; Ferreira, Eduardo Antonio; Gris, Eliana Fortes; Correia, João Francisco Gomes; Pich, Claus Tröger; Mattivi, Fulvio; Filho, Danilo Wilhelm; Pedrosa, Rozangela Curi

    2013-06-01

    Croton celtidifolius Baill (Euphorbiaceae) is a tree found in the Atlantic Forest in Southern Brazil, where it is commonly known as "Sangue-de-Dragão". Its red latex is used traditionally for treating ulcers, diabetes and cancer. To evaluate antitumor activities of Croton celtififolius latex in vitro and in vivo. Phytochemical analyses were conducted using HPLC-DAD-MS. Cytotoxic, nuclease and pro-apoptotic properties were determined using the tetrazolium salt assay (MTT), plasmid DNA damage assay and ethidium bromide (EB)/acridine orange methods, respectively, and antitumor activity was determined in the Ehrlich ascites carcinoma (EAC) mouse model. Phytochemical studies indicated a high phenol content of flavonols (45.67 ± 0.24 and 18.01 ± 0.23 mg/mL of myricetin and quercetin, respectively) and flavan-3-ols (114.12 ± 1.84 and 1527.41 ± 16.42 mg/L of epicatechin and epigallocatechin, respectively) in latex. These compounds reduced MCF-7 and EAC cell viability in the MTT assay (IC50 = 169.0 ± 1.8 and 187.0 ± 2.2 μg/mL, respectively). Latex compounds caused significant DNA fragmentation and increased the number of apoptotic cells (negative control (NC), 12%; latex, 41%) as indicated by differential staining in the EB/acridine orange assay. The in vivo latex treatment at 3.12 mg/kg/day reduced the body weight by 7.57 ± 2.04 g and increased median survival time to 17.5 days when compared to the NC group (13.0 days). In addition, the highest latex concentration inhibited tumor growth by 56%. These results agree with ethno-pharmacological reports showing cytotoxicity and antitumor activity of C. celtidifolius latex. The mechanism of antitumor action may be related to direct DNA fragmentation that reduces survival and induces apoptosis.

  1. Radiation Vulcanization of Natural Rubber Latex (RVNRL): A Potential Material for Nuclear Power Plant Gloves

    International Nuclear Information System (INIS)

    Pairu Ibrahim; Wan Manshol Wan Zain; Keong, C.C.; Mohd Noorwadi Mat Lazim

    2011-01-01

    Radiation vulcanization of natural rubber latex has great potential for the production of nuclear power plant gloves due to its low ash and mineral content. And this is in-line with the role played by Malaysian Nuclear Agency as Technical Supporting Organization for Nuclear Power Program. This paper discussed the evaluation done to determine ash content in RVNRL and SVNRL films. Both samples were prepared using casting technique and the properties were compared. Films prepared from raw latex without any vulcanizing agent were regarded as a control. (author)

  2. Gamma irradiator design concepts for radiation vulcanisation of natural rubber latex

    International Nuclear Information System (INIS)

    Aggarwal, K.S.; Muralidharan, P.; Apte, M.G.; Kalurkar, A.R.; Shah, B.M.

    1990-01-01

    Radiation vulcanisation of natural rubber latex (NRL) is a new and yet unproven technology and one which involves undefined problems of consumer acceptance and high degree of radiation risk. Therefore, the designer should take care that the initial capital cost of the plant is as low as possible to keep the unit processing cost low during the initial lean period of the product requirement by the market. Three irradiators to process natural rubber latex have been designed as per capacity requirement of the user. Their salient features are described. (author). 2 tabs., 24 figs

  3. Low field NMR study of the latex derived from Brosimum parinarioides - Moraceae

    International Nuclear Information System (INIS)

    Miguez, Eduardo; Tavares, Maria Ines B.

    2009-01-01

    Brosimum parinarioides is a tree found in the Amazonia forest and its latex (Leite de Amapa) is often used like food and by the popular medicine in the treatment of tuberculosis and asthma. Being swallowed in nature, its necessary determinate the stability degree of this latex in the storage conditions in which is used in Amazonia. The analyses of T 2 data showed that the limit of stability is not longer than six month in the storage conditions used by the population of Amazonia. The Low field NMR proved to be an efficient method for this kind of study. (author)

  4. Analysis of Aqueous Extractable Protein in Radiation Pre vulcanized Natural Rubber Latex (RVNRL) And Sulphur Pre vulcanized Natural Rubber Latex (SVNRL)

    International Nuclear Information System (INIS)

    Sofian Ibrahim; Mohd Noor Wadi Mat Lazim; Syuhada Ramli; Keong, C.C.; Khairul Hisyam Mohd Yusof; Muhammad Saiful Omar; Najib Mohd Zakey; Hafizuddin Maseri; Noor Hasni Mohd Ali

    2015-01-01

    The use of radiation do not only produces Radiation Pre vulcanized Natural Rubber Latex (RVNRL) that can be used for the production of nitrosamines free products, moreover, RVNRL also able to exclude type IV allergy that caused by high protein content in the products. Leaching water from production of finger coat from RVNRL and Sulphur Pre vulcanized Natural rubber Latex (SVNRL) has been collected. Extractable protein content from water samples measured according to the test protocol ASTM D5712-2010. Water from leaching process of finger coat made from RVNRL showed a higher protein content than SVNRL. This explains why RVNRL based products contain very low protein content and thus reduce the risk of Type IV allergy. (author)

  5. Antimicrobial activity of a 48-kDa protease (AMP48) from Artocarpus heterophyllus latex.

    Science.gov (United States)

    Siritapetawee, J; Thammasirirak, S; Samosornsuk, W

    2012-01-01

    Artocarpus heterophyllus (jackfruit) is a latex producing plant. Plant latex is produced from secretory cells and contains many intergradients. It also has been used in folk medicine. This study aimed to purify and characterize the biological activities of a protease from jackfruit latex. A protease was isolated and purified from crude latex of a jackfruit tree by acid precipitation and ion exchange chromatography. The proteolytic activities of protein were tested using gelatin- and casein-zymography. The molecular weight and isoelectric point (pl) of protein were analysed by SDS/12.5% PAGE and 2D-PAGE, respectively. Antimicrobial activity of protein was analysed by broth microdilution method. In addition, the antibacterial activity of protein against Pseudomonas aeruginosa ATCC 27853 was observed and measured using atomic force microscopy (AFM) technique. The purified protein contained protease activity by digesting gelatin- and casein-substrates. The protease was designated as antimicrobial protease-48 kDa or AMP48 due to its molecular mass on SDS-PAGE was approximately 48 kDa. The isoelectric point (pl) of AMP48 was approximately 4.2. In addition, AMP48 contained antimicrobial activities by it could inhibit the growths of Pseudomonas aeruginosa ATCC 27853 and clinical isolated Candida albicans at minimum inhibitory concentration (MIC) 2.2 mg/ml and Minimum microbicidal concentration (MMC) 8.8 mg/ml. AFM image also supported the antimicrobial activities of AMP48 by the treated bacterial morphology and size were altered from normal.

  6. Reduction of residual monomer in latex products by enhanced polymerization and extraction in supercritical carbon dioxide

    NARCIS (Netherlands)

    Kemmere, M.F.; Schilt, van M.A.; Cleven, M.H.W.; Herk, van A.M.; Keurentjes, J.T.F.

    2002-01-01

    The redn. of Me methacrylate (MMA) in a PMMA latex was chosen as a representative model system. Pulsed electron beam expts. were performed to study the effect of supercrit. carbon dioxide (scCO2) on the monomer concn. inside the polymer particles during the polymn. reaction. The partitioning

  7. Evaluation of peptides release using a natural rubber latex biomembrane as a carrier.

    Science.gov (United States)

    Miranda, M C R; Borges, F A; Barros, N R; Santos Filho, N A; Mendonça, R J; Herculano, R D; Cilli, E M

    2018-05-01

    The biomembrane natural (NRL-Natural Rubber Latex), manipulated from the latex obtained from the rubber tree Hevea brasiliensis, has shown great potential for application in biomedicine and biomaterials. Reflecting the biocompatibility and low bounce rate of this material, NRL has been used as a physical barrier to infectious agents and for the controlled release of drugs and extracts. The aim of the present study was to evaluate the incorporation and release of peptides using a latex biomembrane carrier. After incorporation, the release of material from the membrane was observed using spectrophotometry. Analyses using HPLC and mass spectroscopy did not confirm the release of the antimicrobial peptide [W 6 ]Hylin a1 after 24 h. In addition, analysis of the release solution showed new compounds, indicating the degradation of the peptide by enzymes contained in the latex. Additionally, the release of a peptide with a shorter sequence (Ac-WAAAA) was evaluated, and degradation was not observed. These results showed that the use of NRL as solid matrices as delivery systems of peptide are sequence dependent and could to be evaluated for each sequence.

  8. Crystallization of Hevamine, an Enzyme with Lysozyme/Chitinase Activity from Hevea brasiliensis Latex

    NARCIS (Netherlands)

    ROZEBOOM, HJ; BUDIANI, A; BEINTEMA, JJ

    1990-01-01

    Hevamine, an enzyme with both lysozyme and chitinase activity, was isolated and purified from Hevea brasiliensis (rubber tree) latex. The enzyme (molecular weight 29,000) is homologous to certain “pathogenesis-related” proteins from plants, but not to hen egg-white or phage T4 lysozyme. To

  9. Enhancing Student Writing and Computer Programming with LATEX and MATLAB in Multivariable Calculus

    Science.gov (United States)

    Sullivan, Eric; Melvin, Timothy

    2016-01-01

    Written communication and computer programming are foundational components of an undergraduate degree in the mathematical sciences. All lower-division mathematics courses at our institution are paired with computer-based writing, coding, and problem-solving activities. In multivariable calculus we utilize MATLAB and LATEX to have students explore…

  10. Synthesis, Characterization and Gold Loading of Polystyrene-Poly(pyridyl methacrylate) Core-Shell Latex Systems

    NARCIS (Netherlands)

    Oláh, A.; Hempenius, Mark A.; Vancso, Gyula J.

    2004-01-01

    In this research, novel 3-(2-pyridyl)propyl methacrylate and 3-(3-pyridyloxy)propyl methacrylate monomers were synthesized and emulsion polymerized on colloidal polystyrene seeds, resulting in core–shell latex systems. The cores and the core–shell particles were characterized by static light

  11. Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal

    Energy Technology Data Exchange (ETDEWEB)

    Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S, E-mail: chai@nuclearmalaysia.gov.my [Malaysian Nuclear Agency, Bangi, 43000 Kajang, Selangor (Malaysia)

    2010-05-15

    Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant

  12. Latex paint as a delivery vehicle for diethylphthalate and di-n-butylphthalate

    DEFF Research Database (Denmark)

    Schripp, Tobias; Salthammer, Tunga; Fauck, Christian

    2014-01-01

    gas-phase concentration at steady state(y). For both, DEP and DnBP, the y0 obtained was lower than the respective saturation vapor pressure (Ps). Furthermore, for both phthalates in latex paint, the material/air partition coefficient (C0/y0) was close in value to the octanol/air partition coefficient...

  13. Marketing techniques and cost calculations of radiation vulcanised natural rubber latex (RVNRL)

    International Nuclear Information System (INIS)

    Wan Manshol Wan Zin; Chai Chee Keong; Najib Mohammed Zakey; Hafizuddin Maseri

    2005-01-01

    This paper describes how RVNRL is promoted to the latex based industries locally and abroad. RVNRL promotion requires patience and very challenging. This is a fact since the product is new to the market. Cost is important in deciding its market and potential usage. The elements that contribute to the cost is described in this paper. (Author)

  14. The effects of temperature and pH bacterial degradation of latex ...

    African Journals Online (AJOL)

    The goal of this study was to integrate the activities of paint deterioration of microbial communities (microcosms) on the basis of environmental factors. The effect of temperature and pH on bacterial degradation of latex paint under humid condition by bacterial isolates was studied. Results obtained revealed that paint ...

  15. THE PRIMARY STRUCTURE OF HEVAMINE, AN ENZYME WITH LYSOZYME CHITINASE ACTIVITY FROM HEVEA-BRASILIENSIS LATEX

    NARCIS (Netherlands)

    JEKEL, PA; HARTMANN, JBH; BEINTEMA, JJ

    1991-01-01

    The primary structure of hevamine, an enzyme with lysozyme/chitinase activity from Hevea brasiliensis latex, has been determined predominantly with conventional non-automatic methods. The positions of three disulfide bridges have been determined. The sequence has about 60% identity with that of a

  16. Lipid transfer protein from Hevea brasiliensis (Hev b 12), a cross-reactive latex protein

    NARCIS (Netherlands)

    Beezhold, Donald H.; Hickey, Vicky L.; Kostyal, David A.; Puhl, Henry; Zuidmeer, Laurian; van Ree, Ronald; Sussman, Gordon L.

    2003-01-01

    BACKGROUND: Latex-allergic individuals experience clinical cross-reactivity to a large number of fruits and vegetables. Much of the cross-reactivity can be attributed to Hev b 6, but evidence indicates that additional cross-reactive allergens may be present. A common pan-allergen, which has not

  17. Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps

    NARCIS (Netherlands)

    Giacomelli, CE; Vermeer, AWP; Norde, W

    2000-01-01

    The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propansulfonate (Chaps). The amount and reactivity of the surface

  18. Adsorption of immunoglobulin G on core-shell latex particles precoated with chaps

    NARCIS (Netherlands)

    Giacomelli, C.E.; Vermeer, A.W.P.; Norde, W.

    2000-01-01

    The aim of this work is to investigate the adsorption behavior of a monoclonal antibody (immunoglobulin G, IgG) on latex particles, possessing reactive chloromethyl groups, precoated with 3-([3-cholamidopropyl]dimethylammonio-1-propanesulfonate (Chaps). The amount and reactivity of the surface

  19. Costs and return analysis in rubber latex production in Edo State ...

    African Journals Online (AJOL)

    The study examined the costs and return analysis in rubber latex production in Edo Sate, Nigeria. Multi-stage sampling method was adopted to select 96 smallholder rubber framers for the study. The first stage was a purposive sampling of two LGAs and then simple random sampling of 6 villages each from the two LGA.

  20. Latex allergy: assessment of knowledge, appropriate use of gloves and prevention practice among hospital healthcare workers.

    Science.gov (United States)

    Al-Niaimi, F; Chiang, Y Z; Chiang, Y N; Williams, J

    2013-01-01

    Healthcare workers and patients are often exposed to natural rubber latex (NRL) through contact with gloves and various healthcare products, which can potentially cause allergic reactions, with varying degrees of severity. In 2008, the Royal College of Physicians published their first evidence-based guidance on occupational health interventions for latex allergy, which emphasized the importance of healthcare workers having knowledge of latex allergy. This study aimed to survey the knowledge of healthcare workers (n = 156) about latex gloves and NRL allergy, routine prevention practice and the appropriate use of gloves in patient care. Healthcare workers in a large teaching hospital were surveyed using a standard questionnaire. We found that only 1% of healthcare workers were able to correctly match the appropriate gloves to the specifically designed procedure. More than half (n = 74.53%) were unable to recognize the presentation of type 1 allergy to NRL. Of the 156 participants, 131 (84%) considered that they would benefit from training about NRL allergy and the use of different types of gloves in clinical care. This survey indicates the importance of education regarding appropriate use of gloves and prevention of NRL allergy among healthcare workers, and dermatologists should play an important role in facilitating this. © The Author(s). CED © 2012 British Association of Dermatologists.

  1. Formation of Defect-Free Latex Films on Porous Fiber Supports

    KAUST Repository

    Lively, Ryan P.

    2011-09-28

    We present here the creation of a defect-free polyvinylidene chloride barrier layer on the lumen-side of a hollow fiber sorbent. Hollow fiber sorbents have previously been shown to be promising materials for enabling low-cost CO 2 capture, provided a defect-free lumen-side barrier layer can be created. Film experiments examined the effect of drying rate, latex age, substrate porosity (porous vs nonporous), and substrate hydrophobicity/ hydrophilicity. Film studies show that in ideal conditions (i.e., slow drying, fresh latex, and smooth nonporous substrate), a defect-free film can be formed, whereas the other permutations of the variables investigated led to defective films. These results were extended to hollow fiber sorbents, and despite using fresh latex and relatively slow drying conditions, a defective lumen-side layer resulted. XRD and DSC indicate that polyvinylidene chloride latex develops crystallinity over time, thereby inhibiting proper film formation as confirmed by SEM and gas permeation. This and other key additional challenges associated with the porous hollow fiber substrate vs the nonporous flat substrate were overcome. By employing a toluene-vapor saturated drying gas (a swelling solvent for polyvinylidene chloride) a defect-free lumen-side barrier layer was created, as investigated by gas and water vapor permeation. © 2011 American Chemical Society.

  2. Diagnosis of toxoplasmosis in pregnancy. Evaluation of latex-protein complexes by immnunoagglutination.

    Science.gov (United States)

    Peretti, Leandro E; Gonzalez, Verónica D G; Marcipar, Iván S; Gugliotta, Luis M

    2017-07-01

    The aim of this work was to obtain a reagent based on latex particles for ruling out acute toxoplasmosis in pregnant women by immunoagglutination (IA). Latex-protein complexes (LPC) were previously synthesized coupling the recombinant protein of Toxoplasma gondii P22Ag and the homogenate of the parasite to latex particles with different size, chemical functionality and charge density. LPC were tested in IA assays against a panel of 72 pregnant women serum samples. Results were analysed through receiver operating characteristic curves, determining area under the curve (AUC), sensitivity, specificity positive and negative predictive values (PPV and NPV, respectively). It was observed that the antigenicity of proteins was not affected during sensitization by either physical adsorption or covalent coupling. The best results in the sense of maximizing discrimination of low avidity sera from chronic ones were observed for the IA test based on latex particles with carboxyl functionality and the recombinant P22Ag, obtaining an AUC of 0·94, a sensitivity of 100% and a NPV of 100%. In this way, the proposed test could be useful for the toxoplasmosis diagnosis in pregnant women, with the advantages of being cheap, rapid and easy to be implemented.

  3. Latex particle template lift-up guided gold wire-networks via evaporation lithography

    KAUST Repository

    Lone, Saifullah; Vakarelski, Ivan Uriev; Chew, Basil; Wang, Zhihong; Thoroddsen, Sigurdur T

    2014-01-01

    We describe a hybrid methodology that combines a two dimensional (2D) monolayer of latex particles (with a pitch size down to 1 μm) prepared by horizontal dry deposition, lift-up of a 2D template onto flat surfaces and evaporation lithography to fabricate metal micro- and nano wire-networks. This journal is

  4. Dynamics of ballistically injected latex particles in living human endothelial cells

    NARCIS (Netherlands)

    Li, Y.; Vanapalli Veera, V.S.A.R.; Vanapalli, Srinivas; Duits, Michael H.G.

    2009-01-01

    We studied the dynamics of ballistically injected latex particles (BIP) inside endothelial cells, using video particle tracking to measure the mean squared displacement (MSD) as a function of lag time. The MSD shows a plateau at short times and a linear behavior at longer times, indicating that the

  5. Insights on the Phytochemical Profile (Cyclopeptides and Biological Activities of Calotropis procera Latex Organic Fractions

    Directory of Open Access Journals (Sweden)

    Thiago Lustosa Jucá

    2013-01-01

    Full Text Available Calotropis procera is a medicinal plant whose pharmacological properties are associated with its latex. Here, the Calotropis procera latex fractions were investigated in an attempt to trace its phytochemical profile and measure its anti-inflammatory and toxicity activity. The crude latex was partitioned, yielding five fractions (49.4% hexane, 5.2% dichloromethane, 2.0% ethyl acetate, 2.1% n-butanol, and 41.1% aqueous. Phytochemical screening and spectroscopy analysis revealed that dichloromethane is the most chemically diverse fraction. Triterpenes were detected in both the hexane and dichloromethane fractions, while flavonoids were detected in the dichloromethane and ethyl acetate fractions. These fractions were cytotoxic to cancer cell lines (LD50 0.05 to 3.9 μg/mL and lethal to brine shrimp (LD50 10.9 to 65.7 μg/mL. Reduced neutrophil migration in rats was observed in carrageenan-induced peritonitis for the dichloromethane (67%, ethyl acetate (56%, and aqueous (72% fractions. A positive reaction with tolidine and ninhydrin suggested that cyclopeptides are in the ethyl acetate fraction. It is therefore concluded that Calotropis procera latex dichloromethane and ethyl acetate fractions exhibit both in vitro and in vivo activities as well as anti-inflammatory properties. Cyclopeptide detection is especially interesting because previous attempts to investigate these low-molecular cyclic amino acid sequences in C. procera have failed.

  6. Radiation prevulcanized natural rubber latex: Cytotoxicity and safety evaluation on animal

    International Nuclear Information System (INIS)

    Keong, C C; Zin, W M Wan; Ibrahim, P; Ibrahim, S

    2010-01-01

    Radiation prevulcanized natural rubber latex (RVNRL) was claimed to be more user friendly than natural rubber latex prevulcanized by sulphur curing system. The absence of Type IV allergy inducing chemicals in RVNRL make it a suitable material for manufacturing of many kinds of latex products, especially those come into direct contact with users. This paper reveals and discusses the findings of cytotoxicity test and safety evaluation on animal for RVNRL. The test was done on RVNRL films prepared by coagulant dipping method and RVNRL dipped products produced by latex dipped product manufacturers. Cytotocixity test was carried out on mammalian cell culture American Type Culture Collection CCL 81, Vero. Results indicated that no cytotoxic effect from RVNRL films and products was found on the cell culture. Two animal studies, namely dermal sensitization study and primary skin irritation study, were done on gloves made from RVNRL. Albino white guinea pigs were used as test subjects in dermal sensitization study and results showed no sensitization induced by the application of test material in the guinea pigs. Primary skin irritation study was done on New Zealand white rabbits and results showed that the product tested was not corrosive and was not a primary irritant

  7. [Detection of anti-Leptospira antibodies in sera of patients in the latex agglutination test].

    Science.gov (United States)

    Volina, E G; Sarukhanova, L E; Iashina, N V; Prokopov, N I; Shkarlat, P E; Barysheva, I V

    2001-01-01

    The results of the preliminary evaluation of the sensitivity and specificity of the newly developed diagnostic test based on the determination of genus-specific antibodies to leptospires in the latex agglutination test, are presented. This test makes it possible to detect anti-Leptospira antibodies of any serogroup. The advantages of the developed test have been determined.

  8. Dynamic speciation analysis of atrazine in aqueous latex nanoparticle dispersions using solid phase microextraction (SPME)

    NARCIS (Netherlands)

    Benhabib, K.; Town, R.M.; Leeuwen, van H.P.

    2009-01-01

    Solid phase microextraction (SPME) is applied in the dynamic speciation analysis of the pesticide atrazine in an aqueous medium containing sorbing latex nanoparticles. It is found that the overall rate of extraction of the analyte is faster than in the absence of nanoparticles and governed by the

  9. Studies on the effect of nano-TiO{sub 2} on vinyl acetate-butyl acrylate latex-based surface coating

    Energy Technology Data Exchange (ETDEWEB)

    Suma, K.K. [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India); Dept. of Chemistry, Maharaja' s College, Ernakulam, Kerala (India); Jacob, Sinto [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India); Joseph, Rani, E-mail: rani@cusat.ac.i [Dept. of Polymer Science and Rubber Technology, Cochin University of Science and Technology, Kochi 22, Kerala (India)

    2010-04-15

    Vinyl acetate-butyl acrylate (VAc-BuA) copolymer latex was prepared by emulsion polymerization. The polymerization conditions and the composition were optimized. The 85/15 wt.% (vinyl acetate/butyl acrylate) gave good tensile strength of the order of 15.6 MPa and a glass transition temperature (T{sub g}) value of -6.49 deg. C. This copolymer was used as a binder in the paint formulation. In this formulation nanosized TiO{sub 2} sol was used as a pigment instead of conventional rutile TiO{sub 2}. Nanosized TiO{sub 2} is prepared by wet process. These nanosized TiO{sub 2} rutile colloidal sol has improved properties such as photostability, UV shielding, dispersion stability, etc. The surface properties of paint were found to be superior compared to commercially used paint.

  10. STRENGTH OF NANOMODIFIED HIGH-STRENGTH LIGHTWEIGHT CONCRETES

    Directory of Open Access Journals (Sweden)

    NOZEMTСEV Alexandr Sergeevich

    2013-02-01

    Full Text Available The paper presents the results of research aimed at development of nanomodified high-strength lightweight concrete for construction. The developed concretes are of low average density and high ultimate compressive strength. It is shown that to produce this type of concrete one need to use hollow glass and aluminosilicate microspheres. To increase the durability of adhesion between cement stone and fine filler the authors offer to use complex nanodimensinal modifier based on iron hydroxide sol and silica sol as a surface nanomodifier for hollow microspheres. It is hypothesized that the proposed modifier has complex effect on the activity of the cement hydration and, at the same time increases bond strength between filler and cement-mineral matrix. The compositions for energy-efficient nanomodified high-strength lightweight concrete which density is 1300…1500 kg/m³ and compressive strength is 40…65 MPa have been developed. The approaches to the design of high-strength lightweight concrete with density of less than 2000 kg/m³ are formulated. It is noted that the proposed concretes possess dense homogeneous structure and moderate mobility. Thus, they allow processing by vibration during production. The economic and practical implications for realization of high-strength lightweight concrete in industrial production have been justified.

  11. Reliability of maximal isometric knee strength testing with modified hand-held dynamometry in patients awaiting total knee arthroplasty: useful in research and individual patient settings? A reliability study

    NARCIS (Netherlands)

    Koblbauer, Ian F. H.; Lambrecht, Yannick; van der Hulst, Micheline L. M.; Neeter, Camille; Engelbert, Raoul H. H.; Poolman, Rudolf W.; Scholtes, Vanessa A.

    2011-01-01

    Patients undergoing total knee arthroplasty (TKA) often experience strength deficits both pre- and post-operatively. As these deficits may have a direct impact on functional recovery, strength assessment should be performed in this patient population. For these assessments, reliable measurements

  12. Reliability of maximal isometric knee strength testing with modified hand-held dynamometry in patients awaiting total knee arthroplasty: useful in research and individual patient settings? A reliability study

    NARCIS (Netherlands)

    Koblbauer, I.F.H.; Lambrecht, Y.; van der Hulst, M.L.M.; Neeter, C.; Engelbert, R.H.H.; Poolman, R.W.; Scholtes, V.A.

    2011-01-01

    Background: Patients undergoing total knee arthroplasty (TKA) often experience strength deficits both pre- and post-operatively. As these deficits may have a direct impact on functional recovery, strength assessment should be performed in this patient population. For these assessments, reliable

  13. Tensile properties of carbon black-filled natural rubber latex films using two different approaches of film preparation

    Science.gov (United States)

    Jarkasi, Siti Aisyah; Samsuri, Azemi; Hashim, M. Y. Amir; Kamarun, Dzaraini

    2017-09-01

    A study was structured to investigate the effects of two different approaches of black-filled NRL films preparation on tensile strengths and tensile stress at 100% strain (M100). In the "First Approach", carbon black dispersion was added into the NRL and mixed using mechanical stirrer. Then the black-filled NRL was coagulated with acetic acid and dried to form NR black-filled masterbatch. This black-filled NR masterbatch was then masticated and mixed with other compounding ingredients on the 2-roll mill. In the "Second Approach", carbon black dispersion was mixed with NRL plus all other compounding ingredients using a mechanical stirrer at high mechanical stirring speed (200 rpm) for 3 hrs. Tensile test-pieces from these two rubber specimens were tested according to ISO37. It was observed that the tensile strengths are affected by both methods. In the case of masticated latex masterbatch, the black-filled NRL films gave higher tensile strength (25-27 MPa) as compared to un-masticated black-filled NRL films (11-17 MPa). The optimum amount of filler loading for highest tensile strength in both approaches was 20 phr of carbon black. However these different approaches did not give significant effect to the elongation at break, EB and M100. SEM images of samples prepared from both approaches suggested that the dispersion of filler in the rubber matrix was better in the masticated samples compared to the un-masticated samples. The reason for the difference in the tensile strength between the two black-filled rubbers might be associated with the degree of dispersions and the uniformity of the dispersions within the rubber matrix. The first mixing approach involved high mechanical shearing action during mastication and mixing process on the 2-roll mill. The high shearing actions were able to breakdown filler aggregates efficiently and distributed the dispersed filler uniformly within the rubber matrix. In the second approach, the breakdown of filler aggregates relied on

  14. Feasibility of protein-sparing modified fast by tube (ProMoFasT) in obesity treatment: a phase II pilot trial on clinical safety and efficacy (appetite control, body composition, muscular strength, metabolic pattern, pulmonary function test).

    Science.gov (United States)

    Sukkar, S G; Signori, A; Borrini, C; Barisione, G; Ivaldi, C; Romeo, C; Gradaschi, R; Machello, N; Nanetti, E; Vaccaro, A L

    2013-01-01

    Anecdotal data in the last few years suggest that protein-sparing modified diet (PSMF) delivered by naso-gastric tube enteral (with continuous feeding) could attain an significant weight loss and control of appetite oral feeding, but no phase II studies on safety and efficacy have been done up to now. To verify the safety and efficacy of a protein-sparing modified fast administered by naso-gastric tube (ProMoFasT) for 10 days followed by 20 days of a low-calorie diet, in patients with morbid obesity (appetite control, fat free mass maintenance, pulmonary function tests and metabolic pattern, side effects), 26 patients with a BMI ≥30 kg/m 2 have been selected. The patients had to follow a protein-sparing fast by enteral nutrition (ProMoFasT) for 24 h/day, for 10 days followed by 20 days of low-calorie diet (LCD). The endpoint was represented by body weight, BMI, abdominal circumference, Haber's appetite test, body composition by body impedance assessment (BIA), handgrip strength test, metabolic pattern, pulmonary function test. Safety was assessed by evaluation of complications and side effects of PSMF and/or enteral nutrition. In this report the results on safety and efficacy are described after 10 and 30 days of treatment. After the recruiting phase, a total of 22 patients out of 26 enrolled [14 (63.6 %) females] were evaluated in this study. Globally almost all clinical parameters changed significantly during first 10 days. Total body weight significantly decreased after 10 days (∆-6.1 ± 2; p  < 0.001) and this decrease is maintained in the following 20 days of LCD (∆ = -5.88 ± 1.79; p  < 0.001). Also the abdominal circumference significantly decreased after 10 days [median (range): -4.5 (-30 to 0); p  < 0.001] maintained then in the following 20 days of LCD [median (range) = -7 (-23.5 to -2); p  < 0.001]. All BIA parameters significantly changed after 10 and 30 days from baseline. All parameters except BF had a significant

  15. Attitude Strength.

    Science.gov (United States)

    Howe, Lauren C; Krosnick, Jon A

    2017-01-03

    Attitude strength has been the focus of a huge volume of research in psychology and related sciences for decades. The insights offered by this literature have tremendous value for understanding attitude functioning and structure and for the effective application of the attitude concept in applied settings. This is the first Annual Review of Psychology article on the topic, and it offers a review of theory and evidence regarding one of the most researched strength-related attitude features: attitude importance. Personal importance is attached to an attitude when the attitude is perceived to be relevant to self-interest, social identification with reference groups or reference individuals, and values. Attaching personal importance to an attitude causes crystallizing of attitudes (via enhanced resistance to change), effortful gathering and processing of relevant information, accumulation of a large store of well-organized relevant information in long-term memory, enhanced attitude extremity and accessibility, enhanced attitude impact on the regulation of interpersonal attraction, energizing of emotional reactions, and enhanced impact of attitudes on behavioral intentions and action. Thus, important attitudes are real and consequential psychological forces, and their study offers opportunities for addressing behavioral change.

  16. First record of the behavior of latex drainage by Trigona spinipes (Fabricius (Hymenoptera, Apidae in laticiferous flowers

    Directory of Open Access Journals (Sweden)

    Cristiana Koschnitzke

    2011-09-01

    Full Text Available This paper describes the behavior of the bee Trigona spinipes, to avoid the latex, when piercing the base of the tubular corolla of the flowers of Mandevilla guanabarica in order to steal the nectar.

  17. Prevalence of manufacturing defects in latex examination gloves used in selected dental practices in central Saudi Arabia.

    Science.gov (United States)

    Al-Swuailem, Abdullah S

    2014-07-01

    To assess the defect rates in latex examination gloves used in selected dental practices in Riyadh, Saudi Arabia. In this cross-sectional study, a total of 796 latex examination gloves were collected from 5 governmental hospitals and 5 private dental practices between April 2012 and May 2012. The gloves were assessed for presence of defects visually (VT) and using water inflation test (WIT). One and 2 sample t-tests were used to assess significant differences in defect rates among each latex brand, and between governmental hospitals and private dental practices. Defects in latex gloves were more likely to be identified using WIT compared with VT (20.2% versus 4.3%, p=0.000). Using WIT, examined latex gloves had a defect rate approximately 8 times the acceptable quality level of 2.5% (20.2%, p=0.000). Using WIT, gloves used in private dental practices had significantly higher defect rates compared with governmental dental clinics (25.6% versus 14.6%, p=0.006). Most latex examination gloves used in the sampled governmental dental clinics and private dental practices in Riyadh had significantly higher preexisting defect rates than acceptable standard levels.

  18. Frequent IgE sensitization to latex, cow's milk, and egg in children with short bowel syndrome.

    Science.gov (United States)

    Mazon, Angel; Solera, Eva; Alentado, Noemi; Oliver, Fernando; Pamies, Rafael; Caballero, Luis; Nieto, Antonio; Dalmau, Jaime

    2008-03-01

    Children with short bowel syndrome (SBS) undergo frequent operations, so they are at risk for sensitizing to latex. There have been isolated reports of sensitization to food in these children. In a cross-sectional study, we assessed sensitization to latex, cow's milk, and egg with skin prick tests (SPT) and serum-specific immunoglobulin E (IgE) in 14 children with SBS. Data were collected about the number of operations with latex devices, serum total IgE, and history of feeding with milk formula. Ten children were sensitized to latex (specific IgE median: 6.7 kU/l, range: 0.5-33). Compared with those non-sensitized, sensitized children had significantly (p range: 0.5-21.1 kU/l), and five to egg (specific IgE median: 0.68, range: 0.58-2.17 kU/l). Except for some isolated days with cow's milk formula, the children had been initially fed with a diet without intact cow's milk proteins. Sensitization to latex, cow's milk, and egg is very frequent in children with SBS. They should be treated in a latex-free environment since the very early stages of the disease, and should be routinely studied regarding food sensitization, as this might contribute as an added factor in the chronic diarrhea of these patients.

  19. Radiation-induced grafting polymerization of MMA onto polybutadiene rubber latex

    International Nuclear Information System (INIS)

    Peng Jing; Wang Maolin; Qiao Jinliang; Wei Genshuan

    2005-01-01

    The grafting of methyl methacrylate (MMA) onto polybutadiene rubber latex by the direct radiation method was carried out. The effects of monomer concentration, absorbed dose and dose rate of gamma rays on the grafting yield were investigated. The graft copolymers were characterized by transmission electron microscopy (TEM), FTIR spectroscopy, and differential scanning calorimetry. TEM photographs revealed that the core-shell structures of latex particles are formed at low MMA content, and with the increasing of MMA content, the semi-IPN-like structure with core-shell could be developed due to the high gel fraction of polybutadiene (PBD) seed particles. In addition, infrared analysis confirmed that MMA could be grafted onto PBD molecular chains effectively under appropriate irradiation conditions. The interfacial adhesion between PBD rubber (core) and PMMA (shell) phases could be enhanced with the increase of MMA concentration

  20. EVALUATION OF CYTOTOXIC, ANTIMICROBIAL AND ANTIINFLAMMATORY PROPERTIES FROM THE LATEX OF IPOMEA STAPHYLINA

    Directory of Open Access Journals (Sweden)

    Prasanthi Narra

    2014-04-01

    Full Text Available The plant Ipomoea staphylina has been used in diverse traditional medication for the treatment of diseases and illness of human beings. The crude latex extract obtained from the stem of Ipomea staphylina was evaluated for cytotoxic, antimicrobial and wound healing properties. Cell viability and cytotoxicity assays such as Colony Formation method and Enzyme based methods that determined cell viability with a colorimetric method were performed to evaluate the medicinal properties of Ipomea staphylina. Similarly Microbiological Antibiotic Assay to determine the antimicrobial properties and wound healing properties were tested by determining the potent anti-inflammatory molecules that inhibited COX and LOX enzymes. Results showed that the latex crude extract of Ipomea staphylina showed potent Antimicrobial and Antiinflamatory properties, but the viability of the cells were unaffected.

  1. Tensile properties of latex paint films with TiO2 pigment

    Science.gov (United States)

    Hagan, Eric W. S.; Charalambides, Maria N.; Young, Christina T.; Learner, Thomas J. S.; Hackney, Stephen

    2009-05-01

    The tensile properties of latex paint films containing TiO2 pigment were studied with respect to temperature, strain-rate and moisture content. The purpose of performing these experiments was to assist museums in defining safe conditions for modern paintings held in collections. The glass transition temperature of latex paint binders is in close proximity to ambient temperature, resulting in high strain-rate dependence in typical exposure environments. Time dependence of modulus and failure strain is discussed in the context of time-temperature superposition, which was used to extend the experimental time scale. Nonlinear viscoelastic material models are also presented, which incorporate a Prony series with the Ogden or Neo-Hookean hyperelastic function for different TiO2 concentrations.

  2. texreg: Conversion of Statistical Model Output in R to LATEX and HTML Tables

    Directory of Open Access Journals (Sweden)

    Philip Leifeld

    2013-11-01

    Full Text Available A recurrent task in applied statistics is the (mostly manual preparation of model output for inclusion in LATEX, Microsoft Word, or HTML documents usually with more than one model presented in a single table along with several goodness-of-fit statistics. However, statistical models in R have diverse object structures and summary methods, which makes this process cumbersome. This article first develops a set of guidelines for converting statistical model output to LATEX and HTML tables, then assesses to what extent existing packages meet these requirements, and finally presents the texreg package as a solution that meets all of the criteria set out in the beginning. After providing various usage examples, a blueprint for writing custom model extensions is proposed.

  3. Numerical Simulation and Experimental Validation of the Inflation Test of Latex Balloons

    Directory of Open Access Journals (Sweden)

    Claudio Bustos

    Full Text Available Abstract Experiments and modeling aimed at assessing the mechanical response of latex balloons in the inflation test are presented. To this end, the hyperelastic Yeoh material model is firstly characterized via tensile test and, then, used to numerically simulate via finite elements the stress-strain evolution during the inflation test. The numerical pressure-displacement curves are validated with those obtained experimentally. Moreover, this analysis is extended to a biomedical problem of an eyeball under glaucoma conditions.

  4. Numerical Simulation and Experimental Validation of the Inflation Test of Latex Balloons

    OpenAIRE

    Bustos, Claudio; Herrera, Claudio García; Celentano, Diego; Chen, Daming; Cruchaga, Marcela

    2016-01-01

    Abstract Experiments and modeling aimed at assessing the mechanical response of latex balloons in the inflation test are presented. To this end, the hyperelastic Yeoh material model is firstly characterized via tensile test and, then, used to numerically simulate via finite elements the stress-strain evolution during the inflation test. The numerical pressure-displacement curves are validated with those obtained experimentally. Moreover, this analysis is extended to a biomedical problem of an...

  5. The influence of temperature and reaction time in the degradation of natural rubber latex

    International Nuclear Information System (INIS)

    Siti Zaleha Isa; Rosiyah Yahya; Aziz Hassan; Mohd Tahir

    2007-01-01

    Liquid natural rubber (LNR /LENR) should be considered as a new material instead of a new type of rubber though they have the same configuration as the rubber used. In this work, thermal degradation of natural rubber latex was carried out to obtain LNR/LENR by varying the reaction time at different temperatures. The degraded polymers were characterized structurally using FTIR and NMR spectroscopies and the average molecular weights were determined by membrane-osmometry and viscometry. (author)

  6. Study on preparation of new antioxidants for radiation vulcanized natural rubber latex product. Antioxidant from keratin

    International Nuclear Information System (INIS)

    Nguyen Quoc Hien; Nguyen Van Toan; Vo Tan Thien; Le Hai

    2000-01-01

    The thermo-oxidative aging resistance of radiation vulcanization of natural rubber latex (RVNRL) products should be adequately by using suitable antioxidants or new kind of effective antioxidant. This work presents the results of preparation of natural antioxidant from hair keratin. Characteristics and effectiveness of resultant antioxidant are also presented. The results obtained indicates that antioxidant made from hair keratin is safe and effective for rubber products from RVNRL. (author)

  7. Comparison of the effect of using latex and nitrile gloves hand dexterity among Iranian population

    Directory of Open Access Journals (Sweden)

    T. Allahyari

    2014-02-01

    .Conclusion: Considering that there was no significant difference in the score of both fine finger and gross hand dexterity while using nitrile gloves as compared to the control condition (without gloves, means that use of nitrile gloves has no adverse effect on hand dexterity therefore, using nitrile gloves is recommended as a alternative for the latex gloves, considering the additional advantage of no allergic reaction in this gloves.

  8. Expression of VEGF and collagen using a latex biomembrane as bladder replacement in rabbits

    Directory of Open Access Journals (Sweden)

    André Luís Alonso Domingos

    2012-08-01

    Full Text Available OBJECTIVE: To investigate the VEGF expression and collagen deposition using a latex biomembrane as bladder replacement in rabbits. MATERIALS AND METHODS: After partial cystectomy, a patch of a non-vulcanized latex biomembrane (2 x 2 cm was sewn to the bladder of rabbits with 5/0 monofilament polydioxanone sulfate sutures in a watertight manner. Groups of 5 animals were killed at 15, 45 and 90 days after surgery and the bladder was removed. Sections of 5µm were cut and stained with picrosirius-red in order to estimate the amount of extracellular matrix in the graft. To confirm the presence of VEGF in tissues, protein expression was determined by immunohistochemistry. RESULTS: No death, urinary leakage or graft extrusion occurred in any group. All bladders showed a spherical shape. A progressive reduction in the amount of collagen occurred in the graft area and was negatively and linearly correlated with time (p < 0.001. VEGF expression was higher in grafted areas when compared to controls at 15 and 45 days after surgery and decreased with time (p < 0.001. CONCLUSION: The latex biomembrane as a matrix for partial bladder replacement in rabbits promotes temporary collagen deposition and stimulates the angiogenic process.

  9. Cytotoxicity Comparison of the Nanoparticles Deposited on Latex Rubber Bands between the Original and Stretched State

    Directory of Open Access Journals (Sweden)

    Jung-Hwan Lee

    2014-01-01

    Full Text Available Understanding the biocompatibility of nanoparticles in dental materials is essential for their safe usage in the oral cavity. In this study, we investigated whether nanoparticles deposited on orthodontic latex rubber bands are involved in the induction of cytotoxicity. A method of stretching to three times (“3L” the length of the latex rubber bands was employed to detach the particles using the original length (“L” for comparison. The cytotoxicity tests were performed on extracts with mouse fibroblasts (L929 and human gingival fibroblasts (HGFs. Fourier transform infrared spectroscopy, ion chromatography, elemental analysis, and inductively coupled plasma mass spectrometry (ICP-MS were performed to detect the harmful components in the extracts from rubber bands. There was a significant decrease in the cell viability in the “L” samples compared with the “3L” samples (P<0.05 in the L929 and HGF cells. This was due to the Ni single crystal nanoparticles (~50nm from the inner surface of “L” samples that were detached in the “3L” samples as well as the Zn ion (~9 ppm detected in the extract. This study revealed that the Ni nanoparticles, as well as Zn ions, were involved in the induction of cytotoxicity from the latex rubber bands.

  10. Sequence and expression analyses of ethylene response factors highly expressed in latex cells from Hevea brasiliensis.

    Directory of Open Access Journals (Sweden)

    Piyanuch Piyatrakul

    Full Text Available The AP2/ERF superfamily encodes transcription factors that play a key role in plant development and responses to abiotic and biotic stress. In Hevea brasiliensis, ERF genes have been identified by RNA sequencing. This study set out to validate the number of HbERF genes, and identify ERF genes involved in the regulation of latex cell metabolism. A comprehensive Hevea transcriptome was improved using additional RNA reads from reproductive tissues. Newly assembled contigs were annotated in the Gene Ontology database and were assigned to 3 main categories. The AP2/ERF superfamily is the third most represented compared with other transcription factor families. A comparison with genomic scaffolds led to an estimation of 114 AP2/ERF genes and 1 soloist in Hevea brasiliensis. Based on a phylogenetic analysis, functions were predicted for 26 HbERF genes. A relative transcript abundance analysis was performed by real-time RT-PCR in various tissues. Transcripts of ERFs from group I and VIII were very abundant in all tissues while those of group VII were highly accumulated in latex cells. Seven of the thirty-five ERF expression marker genes were highly expressed in latex. Subcellular localization and transactivation analyses suggested that HbERF-VII candidate genes encoded functional transcription factors.

  11. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    Energy Technology Data Exchange (ETDEWEB)

    Hudlikar, Manish; Joglekar, Shreeram [University of Pune, Division of Biochemistry, Department of Chemistry (India); Dhaygude, Mayur [National Chemical Laboratory, Polymer Science and Engineering Division (India); Kodam, Kisan, E-mail: kodam@chem.unipune.ac.in [University of Pune, Division of Biochemistry, Department of Chemistry (India)

    2012-05-15

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S{sup -2}) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S{sup -2}) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S{sup -2}) ions.

  12. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    Science.gov (United States)

    Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan

    2012-05-01

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV-vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S-2) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S-2) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S-2) ions.

  13. Latex-mediated synthesis of ZnS nanoparticles: green synthesis approach

    International Nuclear Information System (INIS)

    Hudlikar, Manish; Joglekar, Shreeram; Dhaygude, Mayur; Kodam, Kisan

    2012-01-01

    A low-cost, green synthesis of ZnS nanoparticles is reported using 0.3 % latex solution prepared from Jatropha curcas L. ZnS nanoparticles were characterized by X-ray diffraction, selected area electron diffraction, transmission electron microscopy, energy dispersive analysis of X-rays, UV–vis optical absorption and photoluminescence techniques. Fourier Transform Infrared Spectroscopy was performed to find the role of cyclic peptides namely curcacycline A (an octapeptide), curcacycline B (a nonapeptide) and curcain (an enzyme) as a possible reducing and stabilizing agents present in the latex of J. curcas L. The average size of ZnS nanoparticles was found to be 10 nm. Latex of J. curcas L. itself acts as a source of sulphide (S −2 ) ions that are donated to Zn ions under present experimental conditions. Source of sulphide (S −2 ) ions is still unclear, but we speculate that cysteine or thiol residues present in enzyme curcain may be donating these sulphide (S −2 ) ions.

  14. Hierarchically structured self-supported latex films for flexible and semi-transparent electronics

    Science.gov (United States)

    Määttänen, Anni; Ihalainen, Petri; Törngren, Björn; Rosqvist, Emil; Pesonen, Markus; Peltonen, Jouko

    2016-02-01

    Different length scale alterations in topography, surface texture, and symmetry are known to evoke diverse cell behavior, including adhesion, orientation, motility, cytoskeletal condensation, and modulation of intracellular signaling pathways. In this work, self-supported latex films with well-defined isotropic/anisotropic surface features and hierarchical morphologies were fabricated by a peel-off process from different template surfaces. In addition, the latex films were used as substrates for evaporated ultrathin gold films with nominal thicknesses of 10 and 20 nm. Optical properties and topography of the samples were characterized using UV-vis spectroscopy and Atomic Force Microscopy (AFM) measurements, respectively. The latex films showed high-level transmittance of visible light, enabling the fabrication of semi-transparent gold electrodes. Electrochemical impedance spectroscopy (EIS) measurements were carried out for a number of days to investigate the long-term stability of the electrodes. The effect of 1-octadecanethiol (ODT) and HS(CH2)11OH (MuOH) thiolation and protein (human serum albumin, HSA) adsorption on the impedance and capacitance was studied. In addition, cyclic voltammetry (CV) measurements were carried out to determine active medicinal components, i.e., caffeic acid with interesting biological activities and poorly water-soluble anti-inflammatory drug, piroxicam. The results show that the fabrication procedure presented in this study enables the formation of platforms with hierarchical morphologies for multimodal (optical and electrical) real-time monitoring of length-scale-dependent biomaterial-surface interactions.

  15. Evaluation of force degradation characteristics of orthodontic latex elastics in vitro and in vivo.

    Science.gov (United States)

    Wang, Tong; Zhou, Gang; Tan, Xianfeng; Dong, Yaojun

    2007-07-01

    To evaluate the characteristics of force degradation of latex elastics in clinical applications and in vitro studies. Samples of 3/16-inch latex elastics were investigated, and 12 students between the ages of 12 and 15 years were selected for the intermaxillary and intramaxillary tractions. The elastics in the control groups were set in artificial saliva and dry room conditions and were stretched 20 mm. The repeated-measure two-way analysis of variance and nonlinear regression analysis were used to identify statistical significance. Overall, there were statistically significant differences between the different methods and observation intervals. At 24- and 48-hour time intervals, the force decreased during in vivo testing and in artificial saliva (P .05). In intermaxillary traction the percentage of initial force remaining after 48 hours was 61%. In intramaxillary traction and in artificial saliva the percentage of initial force remaining was 71%, and in room conditions 86% of initial force remained. Force degradation of latex elastics was different according to their environmental conditions. There was significantly more force degradation in intermaxillary traction than in intramaxillary traction. The dry room condition caused the least force loss. There were some differences among groups in the different times to start wearing elastics in intermaxillary traction but no significant differences in intramaxillary traction.

  16. Natural membranes of Hevea brasiliensis latex as delivery system for Casearia sylvestris leaf components

    Directory of Open Access Journals (Sweden)

    Flávio A. Carvalho

    Full Text Available ABSTRACT Natural latex from Hevea brasiliensis (Wild. ex A.Juss Müll.Arg., Euphorbiaceae, showed angiogenic action and Casearia sylvestris Sw., Salicaceae, leaf derivatives presented anti-inflammatory and wound healing activities. Therefore, an association of these effects was interesting for wound healing applications. The aims of this study were the development of membranes of natural latex incorporated with C. sylvestris leaf derivatives (ethanolic extract, diterpene concentrated fraction and casearin J, their chemical and physical characterization, and the evaluation of in vitro skin permeation and retention of C. sylvestris bioactive secondary metabolites (diterpenes and phenolic compounds. The membranes were developed mixing hydroethanolic solutions of C. sylvestris derivatives with latex and drying them in a desiccator. They were characterized by infrared spectroscopy, scanning electron microscopy, water vapor permeability and mechanical resistance assays, demonstrating that all membranes were permeable, resistant and homogeneous in surfaces. The permeation and retention assays demonstrated dermal penetration of phenolic compounds for ethanolic extract membrane and of casearin-like clerodane diterpenes for all membranes, indicating that these membranes have great potential for therapeutical application as a topical system for C. sylvestris components releasing.

  17. Clonal stability of latex yield in eleven clones of Hevea brasiliensis Muell. Arg.

    Directory of Open Access Journals (Sweden)

    K.O. Omokhafe

    2003-01-01

    Full Text Available Eleven Hevea brasiliensis clones were evaluated for clonal stability of latex yield. A randomized complete block design was used with four replicates, two locations, seven years and three periods per year. Stability analysis was based on clone x year and clone x year x location interactions. Five stability parameters viz environmental variance, shukla's stability variance, regression of clonal latex yield on environmental index, variance due to regression and variance due to deviation from regression were applied. There was significant clone x environment effect at the two levels of interaction. Among the eleven clones, C 162 was outstanding for clonal stability and it can serve as donor parent for stability alleles. Three clones (C 76, C 150 and C 154 were also stable. The four stable clones (C 76, C 150, C 154 and C 162 are suitable for broad-spectrum recommendation for latex yield. Five clones (C 83, C 143, C 163, C 202 and RRIM 600 will require environment-specific recommendation because of their unstable phenotype. The stability feature of two clones (C 145 and C 159 was not clear and this will be investigated in subsequent studies.

  18. Antimalarial Activity of the Chemical Constituents of the Leaf Latex of Aloe pulcherrima Gilbert and Sebsebe.

    Science.gov (United States)

    Teka, Tekleab; Bisrat, Daniel; Yeshak, Mariamawit Yonathan; Asres, Kaleab

    2016-10-28

    Malaria is one of the three major global public health threats due to a wide spread resistance of the parasites to the standard antimalarial drugs. Considering this growing problem, the ethnomedicinal approach in the search for new antimalarial drugs from plant sources has proven to be more effective and inexpensive. The leaves of Aloe pulcherrima Gilbert and Sebsebe, an endemic Ethiopian plant, are locally used for the treatment of malaria and other infectious diseases. Application of the leaf latex of A. pulcherrima on preparative silica gel TLC led to the isolation of two C -glycosylated anthrones, identified as nataloin ( 1 ) and 7-hydroxyaloin ( 2 ) by spectroscopic techniques (UV, IR, ¹H- and 13 C-NMR, HR-ESIMS). Both the latex and isolated compounds displayed antimalarial activity in a dose-independent manner using a four-day suppressive test, with the highest percent suppression of 56.2% achieved at 200 mg/kg/day for 2 . The results indicate that both the leaf latex of A. pulcherrima and its two major constituents are endowed with antiplasmodial activities, which support the traditional use of the leaves of the plant for the treatment of malaria.

  19. Prevalence and clinical impact of sensitization to latex and fruits in dentistry students at the University of Antioquia, and its relationship with allergy to fruits

    Directory of Open Access Journals (Sweden)

    Echenique Manrique, Alejandro

    2015-04-01

    Full Text Available Objective: To determine the prevalence and clinical impact of sensitization to latex and to five tropical fruits (banana, avocado, kiwi, pineapple and passion fruit in dentistry students. Methods: Analytical cross-sectional study of 128 dentistry students at University of Antioquia in Medellín, Colombia. Information was collected by means of a questionnaire and skin prick tests with latex and fruits were done. Results: All students reported having had contact with latex. Nine of them informed at least one episode of adverse reaction to contact with latex without proof of sensitization to it. Five reported at least one reaction with one of the fruits, but skin prick tests were negative. Four of the 14 students who reported gastrointestinal symptoms were sensitized to latex or to one of the tested fruits. Overall, latex sensitization rate was 3.1%. Conclusion: This percentage of sensitization to latex is lower than that in other studies; this may be due to the expression of immune mechanisms other than IgE mediation. We failed to demonstrate a higher sensitization rate to latex as students advanced in their career. The association between gastrointestinal symptoms and sensitization to both fruit and latex is to be emphasized.

  20. Toxicological evaluation of natural rubber films from vulcanized latex by the conventional process and the alternative process with ionizing radiation

    International Nuclear Information System (INIS)

    Campos, Vania Elisabeth

    1997-01-01

    The industrial vulcanization of natural rubber latex (NRL) is made all over the world by conventional process using sulphur and heat but it can be made by an alternative process using ionizing radiation. In this research the NRL was tested by 13 physical, chemical and mechanical assays which showed its good quality. It was done a preliminary study of the toxicological properties of 4 natural rubber films obtained by casting process of NRL: one non vulcanized, other vulcanized by the conventional process and two vulcanized by the alternative process. In the alternative process the films were obtained by irradiation of NRL by gamma rays from the 60 Co source at 250 kGy in the absence of sensitizer and irradiated NRL at 12 kGy in the presence of 4ph r of n-butyl acrylate / 0.2 phr of KOH. These vulcanization doses were determined from broken tensile strength. In the conventional process, sulphur vulcanized NRL was made using a classical composition. Another film was made with non vulcanized NRL. The preliminary evaluation of the toxicological properties was made from in vitro cytotoxicity and in vivo systemic toxicity assays. The LBN films vulcanized by the alternative process have less cytotoxicity than the NRL film vulcanized by the conventional process. The sensitized vulcanized films by gamma rays and non vulcanized films showed similar cytotoxicity while the vulcanized films without sensitizer showed a slight lower cytotoxicity. The non vulcanized NRL film and the NRL films vulcanized by the alternative process did not show toxic effects int he 72 hours period of the systemic toxicity assay. However the NRL film vulcanized with sulphur induced effects like allaying and motor in coordination on the animals treated with an oil extract at the fourth hour and recovering after that. The alternative process promoted lower toxic effects than conventional process because there was no toxic substances present. (author)

  1. Modified cyanobacteria

    Science.gov (United States)

    Vermaas, Willem F J.

    2014-06-17

    Disclosed is a modified photoautotrophic bacterium comprising genes of interest that are modified in terms of their expression and/or coding region sequence, wherein modification of the genes of interest increases production of a desired product in the bacterium relative to the amount of the desired product production in a photoautotrophic bacterium that is not modified with respect to the genes of interest.

  2. Bond strength of masonry

    NARCIS (Netherlands)

    Pluijm, van der R.; Vermeltfoort, A.Th.

    1992-01-01

    Bond strength is not a well defined property of masonry. Normally three types of bond strength can be distinguished: - tensile bond strength, - shear (and torsional) bond strength, - flexural bond strength. In this contribution the behaviour and strength of masonry in deformation controlled uniaxial

  3. Topological strength of magnetic skyrmions

    Energy Technology Data Exchange (ETDEWEB)

    Bazeia, D.; Ramos, J.G.G.S.; Rodrigues, E.I.B.

    2017-02-01

    This work deals with magnetic structures that attain integer and half-integer skyrmion numbers. We model and solve the problem analytically, and show how the solutions appear in materials that engender distinct, very specific physical properties, and use them to describe their topological features. In particular, we found a way to model skyrmion with a large transition region correlated with the presence of a two-peak skyrmion number density. Moreover, we run into the issue concerning the topological strength of a vortex-like structure and suggest an experimental realization, important to decide how to modify and measure the topological strength of the magnetic structure.

  4. Electrochemical nitrite nanosensor developed with amine- and sulphate-functionalised polystyrene latex beads self-assembled on polyaniline

    Energy Technology Data Exchange (ETDEWEB)

    Muchindu, Munkombwe; Waryo, Tesfaye; Arotiba, Omotayo [SensorLab, Department of Chemistry, University of the Western Cape, Private Bag X17, Bellville 7535 (South Africa); Kazimierska, Ewa; Morrin, Aoife; Killard, Anthony J.; Smyth, Malcolm R. [School of Chemical Sciences, Dublin City University, Dublin 9 (Ireland); Jahed, Nazeem; Kgarebe, Boitumelo; Baker, Priscilla G.L. [SensorLab, Department of Chemistry, University of the Western Cape, Private Bag X17, Bellville 7535 (South Africa); Iwuoha, Emmanuel I., E-mail: eiwuoha@uwc.ac.z [SensorLab, Department of Chemistry, University of the Western Cape, Private Bag X17, Bellville 7535 (South Africa)

    2010-05-30

    Aniline doped with polyvinyl sulphonate (PV-SO{sub 3}{sup -}) was electropolymerised on screen printed carbon (SPCE) and glassy carbon (GCE) electrodes. Then nano-structured polystyrene (PS{sub NP}) latex beads functionalised with amine (PS{sub NP}-NH{sub 2}) and sulphate (PS{sub NP}-OSO{sub 3}{sup -}) were self-assembled on the modified SPCE and GCE. The resultant polyaniline nanocomposites (PANI|PS{sub NP}-NH{sub 2} or PANI|PS{sub NP}-OSO{sub 3}{sup -}) were characterised by cyclic voltammetry (CV), UV-vis spectroscopy and scanning electron microscopy (SEM). Brown-Anson analysis of the multi-scan rate CV responses of the various PANI films gave surface concentrations of the order of 10{sup -8} mol cm{sup -2}. UV-vis spectra of the PANI films dissolved in dimethyl sulphoxide showed typical strong absorbance maxima at 480 and 740 nm associated with benzenoid pi-pi* transition and quinoid excitons of polyaniline, respectively. The SEM images of the PANI nanocomposite films showed cauliflower-like structures that are <100 nm in diameter. When applied as electrochemical nitrite sensor, sensitivity values of 60, 40 and 30 muA/mM were obtained for electrode systems containing PANI|PS{sub NP}-NH{sub 2}, PANI and PANI|PS{sub NP}-SO{sub 3}{sup -}, respectively. The corresponding limits of detection of the sensors were 7.4, 9.2 and 38.2 muM NO{sub 2}{sup -}.

  5. Assessment of the mutagenic and antimutagenic activity of Synadenium umbellatum Pax latex by micronucleus test in mice

    Directory of Open Access Journals (Sweden)

    PR. Melo-Reis

    Full Text Available Synadenium umbellatum Pax, popularly known as "cola-nota", is a medicinal plant that grows in tropical regions. The latex of this plant is used against various diseases, such as diabetes mellitus, leprosy, tripanosomiasis, leukemia, and several malignant tumors. The mutagenic, antimutagenic, and cytotoxic effects of the latex of this plant were investigated by measuring the frequency of micronuclei in mice bone marrow cells. To evaluate mutagenicity, the animals were treated with four doses of latex (10, 30, 50, and 100 mg/kg body weight. To study the antimutagenic activity, the animals were simultaneously treated with latex and mitomycin C (4 mg/kg. The cytotoxicity was evaluated by polychromatic and normochromatic erythrocytes ratio. Our results showed a significant increase of frequency of micronucleated polychromatic erythrocytes (MNPCE compared to the negative control group (p 0.05 was detected at the doses of 50 and 100 mg/kg. Under our experimental conditions, the results obtained indicate strong mutagenic and cytotoxic activity of S. umbellatum latex except the dose of 10 mg/kg and moderate antimutagenic effect at lower doses.

  6. Identification, quantification, spatiotemporal distribution and genetic variation of major latex secondary metabolites in the common dandelion (Taraxacum officinale agg.).

    Science.gov (United States)

    Huber, Meret; Triebwasser-Freese, Daniella; Reichelt, Michael; Heiling, Sven; Paetz, Christian; Chandran, Jima N; Bartram, Stefan; Schneider, Bernd; Gershenzon, Jonathan; Erb, Matthias

    2015-07-01

    The secondary metabolites in the roots, leaves and flowers of the common dandelion (Taraxacum officinale agg.) have been studied in detail. However, little is known about the specific constituents of the plant's highly specialized laticifer cells. Using a combination of liquid and gas chromatography, mass spectrometry and nuclear magnetic resonance spectrometry, we identified and quantified the major secondary metabolites in the latex of different organs across different growth stages in three genotypes, and tested the activity of the metabolites against the generalist root herbivore Diabrotica balteata. We found that common dandelion latex is dominated by three classes of secondary metabolites: phenolic inositol esters (PIEs), triterpene acetates (TritAc) and the sesquiterpene lactone taraxinic acid β-D-glucopyranosyl ester (TA-G). Purification and absolute quantification revealed concentrations in the upper mgg(-1) range for all compound classes with up to 6% PIEs, 5% TritAc and 7% TA-G per gram latex fresh weight. Contrary to typical secondary metabolite patterns, concentrations of all three classes increased with plant age. The highest concentrations were measured in the main root. PIE profiles differed both quantitatively and qualitatively between plant genotypes, whereas TritAc and TA-G differed only quantitatively. Metabolite concentrations were positively correlated within and between the different compound classes, indicating tight biosynthetic co-regulation. Latex metabolite extracts strongly repelled D. balteata larvae, suggesting that the latex constituents are biologically active. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Assay of anti-HBs antibodies using a recombinant antigen and latex particle counting: comparison with five commercial tests.

    Science.gov (United States)

    Galanti, L M; Cornu, C; Masson, P L; Robert, A R; Becheanu, D; Lamy, M E; Cambiaso, C L

    1991-05-01

    An assay of anti-HBs antibodies based on agglutination of latex particles coated with recombinant HBs-antigen was compared with Abbott radioimmunoassay (Abbott-RIA), which uses a human plasma-derived antigen. The population examined consisted of 76 Abbott-RIA anti-HBs-negative prevaccinated subjects and 1044 serum samples anti-HBs found positive by Abbott-RIA, including 283 samples of subjects vaccinated either with a human plasma-derived vaccine (group A; n = 180) or with a recombinant vaccine (group B; n = 103). Correlation coefficients between the two techniques were respectively r = 0.89 for the whole population (n = 1044), r = 0.98 in group A and r = 0.74 in group B. Anti-HBs titres were higher with latex than with RIA in group B as shown by the regression slopes: latex = 508 + 1.11 RIA in group A and latex = -1138 + 3.97 RIA in group B, suggesting that some vaccinated subjects from group B produced antibodies against epitopes proper to the recombinant antigen. In the prevaccinated population and in group A, the latex results were compared with those of radioimmunoassays (Abbott, Sorin) and enzyme immunoassays (Behring, Roche, Pasteur). Only the Roche-EIA detected anti-HBs in the prevaccinated subjects. The correlation between the various immunoassays was r greater than 0.96 only for values higher than 100 IU/l.

  8. Synthesis and characterization of novel fluoroalkyl-terminated hyperbranched polyurethane latex

    Science.gov (United States)

    Xu, Wei; Zhao, Weijia; Hao, Lifen; Wang, Sha; Pei, Mengmeng; Wang, Xuechuan

    2018-04-01

    Waterborne polyurethane (PU) emulsions are widely used in various fields and the demand for them is ever-increasing over the years. However, the hydrophilic chain extender inevitably bonded into the PU backbone can affect the water tolerance of PU. Thus, it is of great importance to improve PU water resistance effectively. Herein, novel fluoroalkyl-terminated hyperbranched polyurethane (HBPUF) latex was accordingly synthesized by graft reaction of perfluorohexyl ethyl alcohol and hyperbranched polyurethane (HBPU), which was previously obtained from interaction between hydroxyl-terminated hyperbranched polymer and PU prepolymer manufactured via the acetone process, as well as using neutralization, adding water, and high-speed stirring operations. We characterized the resultants and investigated its surface properties by IR, NMR, TEM, XRD, TGA, DSC, FE-SEM, AFM, XPS, and contact angle measurements, etc. IR and NMR tests confirmed that the fluorinated fragments had been grafted onto the tail end of HBPU. TEM, XRD, DSC, and FE-SEM results all accounted for the fact that there were multi-crystals in PU, HBPU and HBPUF. TGA results showed that thermal stabilities of the PU, HBPU, and HBPUF latex films were enhanced in turn. XPS and AFM analyses demonstrated that the fluorine-containing segments from the HBPUF terminals were prone to migrate and enrich on the film-air surface of the HBPUF latex film, which made water contact angle and water absorption of the HBPUF film be as 113.9° and 11.1%, respectively, compared to those of the PU film (77.8° and 136.2%). This research indicates that water resistance of the PU film can be efficiently enhanced by fluorinated polyurethane with novel fluoroalkyl-terminated hyperbranched structure.

  9. Isolation of natural inhibitors of papain obtained from Carica papaya latex

    Directory of Open Access Journals (Sweden)

    Rubens Monti

    2004-09-01

    Full Text Available Studies were carried out to natural papain inhibitor from papaya latex. Fresh latex from green fruits of Carica papaya was collected and immediately transported in ice bath to the lab, from which three fractions with inhibitor effect of esterase papain activity were isolated by latex dialysis, Sephadex G-25 gel filtration and ionic exchange chromatography in SP-Sephadex C-25. The isolated fractions, identified as inhibitors I and II, showed a negative reaction with ninhydrin; however, the fraction identified as P-III showed positive reaction with ninhydrin. Kinetics data showed non-competitive inhibition (inhibitor I and uncompetitive (inhibitors II and P-III.Este trabalho apresenta novos dados sobre inibidores naturais de papaína. O látex fresco de frutos verdes de Carica papaya foi coletado pela manhã em plantações da região de Araraquara, SP, Brasil e imediatamente transportado ao laboratório em banho de gelo. Três frações com efeito inibitório da atividade esterásica da papaína foram isoladas a partir do látex fresco, através de diálise, filtração em Sephadex G-25 e cromatografia em SP-Sephadex C-25. As frações isoladas identificadas como inibidores I e II, mostraram reação negativa à ninidrina; entretanto, a fração identificada como P-III mostrou reação positiva. Dados cinéticos revelaram inibição não-competitiva (inibidor I e incompetitiva (inibidores II e P-III.

  10. Strength and life under creeping

    International Nuclear Information System (INIS)

    Pospishil, B.

    1982-01-01

    Certain examples of the application of the Lepin modified creep model, which are of interest from technical viewpoint, are presented. Mathematical solution of the dependence of strength limit at elevated temperatures on creep characteristics is obtained. Tensile test at elevated temperatures is a particular case of creep or relaxation and both strength limit and conventional yield strength at elevated temperatures are completely determined by parameters of state equations during creep. The equation of fracture summing during creep is confirmed not only by the experiment data when stresses change sporadically, but also by good reflection of durability curve using the system of equations. The system presented on the basis of parameters of the equations obtained on any part of durability curve, permits to forecast the following parameters of creep: strain, strain rate, life time, strain in the process of fracture. Tensile test at elevated temperature is advisable as an addition when determining creep curves (time-strain curves) [ru

  11. ENHANCEMENT OF RESISTANCE TO OXIDATIVE DEGRADATION OF NATURAL RUBBER THROUGH LATEX DEGRADATION

    Institute of Scientific and Technical Information of China (English)

    1998-01-01

    A fully characterised natural rubber latex was subjected to mechanical degradation by stirring at intervals. The resistance to oxidative degradation of the different samples were studied by measuring the Plasticity retention indices (PRI).The results show that there is an enhancement of the PRI from 57% for the undegraded rubber to 79% for the one-hour degraded sample. Further degradation resulted in decrease of PRI as time of degradation increased. Therefore, the one-hour degraded sample is a special rubber with high oxidation resistance which is of great importance in engineering.

  12. Posters y trípticos (Brochures) en LATEX con Beamer y Leaflet

    OpenAIRE

    Borbón, Alexánder

    2013-01-01

    Resumen. En este artículo se muestra la manera en que se puede realizar posters y trípticos (panfletos o brochures) con LATEX. Para realizar los posters se utiliza la clase beamer que usualmente se utiliza para hacer presentaciones, se utiliza el paquete beamerposter para poder utilizarla para posters. Los trípticos se realizan de dos formas, la primera utilizando la clase beamer con el paquete geometry y la segunda utilizando la clase leaflet que es una clase especializada para hacer este ti...

  13. Surgical gloves fabrication using natural rubber latex vulcanized with gamma radiation

    International Nuclear Information System (INIS)

    Collantes, Hugo David Chirinos.

    1995-01-01

    Surgical gloves were manufactured by immersion coagulant method from vulcanized natural rubber latex by gamma rays at dose of 10 kGy in the air, at room temperature, using the following sensitizer vulcanization An-B 3 phr/KOH 0.2 phr. The influence of the parameter in the thickness of the surgical gloves manufacture, studied through fractional factorial designs technic, can be resumed by empirical linear correlation: y = 0.213 + 0.025 [Ca Cl 2 ] + 0.019 t. (author). 49 refs., 13 figs., 31 tabs

  14. Cytotoxicity of latex and pharmacobotanical study of leaves and stem of Euphorbia umbellata (Janaúba

    Directory of Open Access Journals (Sweden)

    Lívia E.C. Luz

    Full Text Available AbstractIn southern Brazil, the bottled latex of Synadenium grantii Hook f., Euphorbiaceae, is popularly used as a treatment of all types of cancer. Similarly, Synadenium umbellatum Pax. is used in the central western region of Brazil for the same purpose and in the same manner of use. Both plants are popularly known as janaúba or leitosinha. The objectives of this study were to use pharmacobotanical analysis to verify whether these two species, which are considered to be distinct, are actually the same to determine anatomical markers; to assist in the identification and differentiation of other Euphorbia; and to evaluate the cytotoxic activity of the latex in relation to HeLa and HRT-18 cells. Leaves and stems of the species were collected in Goiânia and Ponta Grossa and were investigated using scanning electron microscopy and optical microscopy techniques. The latex was also collected and analyzed in relation to its cytotoxic effect by employing MTT and NR techniques. The pharmacobotanical study of the specimens in both localities showed that they were the same species, namely Euphorbia umbellata (Pax Bruyns, which is the scientific nomenclature accepted and confirmed by an expert taxonomist who specializes in Euphorbia. The pharmacobotanical characteristics highlighted in this study can assist in the identification of the taxon and contribute to the control of the quality of this plant drug. The evaluation of the latex in relation to HRT-18 cells demonstrated action after 48 h of experiment. In contrast, in relation to HeLa cells its induced cytotoxicity in all times and a dose-dependent manner. The IC50 values (72 h observed were 252.58 ± 18.51 µg/ml and 263.42 ± 15.92 µg/ml to MTT experiment and 250.18 ± 19.48 µg/ml and 430.56 ± 19.71 µg/ml to NR experiment for the HeLa and HRT-18 cells, respectively.

  15. Modification of Iraqi Asphalt 40/50 Properties Using Saw Dust (SD and Natural Rubber Latex

    Directory of Open Access Journals (Sweden)

    Rusul l M. Darwesh

    2018-04-01

    Full Text Available The aim of this research is to enhance the fundamental properties for asphalt binder as those spec-ifications relate to performance of asphalt mixtures. In this paper studied the effect of add (2, 4 % SD in different sizes and (3, 5 and 7% Natural rubber latex to the straight asphalt 40/50 produced from Al-Dura refinery at 160C, it was added each additive separately and then added together to asphalt in same temperature, then tested physically and mechanically according to the American Society for Testing and Materials (ASTM, the result showed largely improvement.

  16. An evidence-based approach to medication preparation for the surgical patient at risk for latex allergy: is it time to stop being stopper poppers?

    Science.gov (United States)

    Heitz, James W; Bader, Stephen O

    2010-09-01

    The prevalence of latex allergy is increasing in surgical patient populations. Avoidance of exposure to the allergen is essential to minimizing perioperative complications in patients suspected to be at risk. Natural rubber latex has historically been ubiquitous in medical devices containing rubber. In 1998, the Food and Drug Administration (FDA) began to require the labeling of medical devices made from natural rubber latex; since that time substantial progress has been made in identifying latex-free alternatives. However, the rubber stoppers commonly found in pharmaceutical vial closures are exempt from FDA labeling requirements. Examination of the clinical and basic science literature regarding pharmaceutical vial closures supports limiting the rubber stopper to a single needle puncture as a safer practice, with the caveat that no strategy exists for the complete elimination of risk as long as stoppers made from natural rubber latex are used in pharmaceutical vials intended for human use. Copyright © 2010 Elsevier Inc. All rights reserved.

  17. EFFECT OF THE PHASE STRUCTURE EVOLUTION ON THE PROPERTIES OF FILMS FORMED FROM PBA/P(ST-CO-MMA)COMPOSITE LATEX

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    A group of heterogeneous latexes poly(butyl acrylate)/poly(styrene-co-methyl methacrylate)(PBA/P(St-co-MMA))were prepared by a semi-continuous seeded emulsion polymerization process under monomer starved conditions.The glass transition temperature(Tg)and the mechanical properties of the film formed from the composite latex changed with the evolution of the particle morphology.A photon transmission method was used to monitor the phase structure evolution of films which were prepared from core-shell PBA/P(St-co-MMA)latex at room temperature and annealed at 383 K above Tg of the polymers.In addition,the changes of the surface of the film formed from the composite latex with time at 383 K were observed by AFM.The evidence illustrated that the film formed from the core-shell latex particles was metastable.The rearrangement of the phases could occur under proper conditions.

  18. Preparation of Low Allergenic Protein Concentrated Natural Rubber Latex Using Suitable Low Molecular Weight Cellulose Derivatives Induced by Gamma Irradiation

    International Nuclear Information System (INIS)

    Siri-Upathum, Chyagrit; Boonyawat, Jariya

    2007-08-01

    Full text: Low molecular weight carboxy methyl cellulose (CMC), hydroxyl ethyl cellulose (HEC), hydroxyl propyl cellulose (HPC) and methyl cellulose (MC) prepared by radiation-induced degradation were added into diluted natural concentrated latex prior to centrifuge for a purpose of reducing allergenic rubber protein in the latex. Optimum molecular weight (Mv) of CMC and HEC for such a purpose was found to be 17-18 kDa which decreased allergenic rubber protein (14-94 kDa) to an undetectable amount as determined by SDS PAGE method

  19. Technology of Anticorrosive Protection of Steel Constructions by Coatings Based on Rapid-Hardening Bitumen-Latex Emulsion

    Directory of Open Access Journals (Sweden)

    Nykyforchyn, H.M.

    2016-01-01

    Full Text Available The recipes of rapid-hardening bitumen-latex emulsions and coatings on its base are created, in-laboratory tests of their physical, chemical and anticorrosive properties are carried out. The technology of anticorrosive protection and the installation technical documentation for making of aqueous bitumen-latex emulsion is developed, installation is mounted and a pilot lot of rapid-hardening emulsion is produced. Experimental-industrial approbation of the technology of coating formation on pipes in oil and gas industry is carried out.

  20. Further investigations of the properties of polymer modified cements

    International Nuclear Information System (INIS)

    Johnson, D.I.

    1988-05-01

    This report concludes the work done on behalf of the Department of the Environment on polymer modified cement composites. Topics covered include: the influence of cure schedule on flexural properties, observation of the onset and cracking during flexural testing, measurement of water permeability and caesium diffusion rates, and the use of Back Scattered Electron Imaging to identify the polymer phase. The properties of epoxide resin modified cements in the previous report were disappointing. Air entrainment of the mixing stage was a likely cause of the poor performance of these products and procedures to overcome this problem were devised. The range of polymer additives investigated was broadened by the inclusion of modified acrylic latexes and a polymensable acrylate resin additive. Properties for OPC and 9 BFS: 1 OPC cements are compared and the modification of properties achieved by polymer additions to both cement systems is discussed. (author)

  1. Purification and autolysis of the ficin isoforms from fig (Ficus carica cv. Sabz) latex.

    Science.gov (United States)

    Zare, Hamid; Moosavi-Movahedi, Ali Akbar; Salami, Maryam; Mirzaei, Morteza; Saboury, Ali Akbar; Sheibani, Nader

    2013-03-01

    Ficin (EC 3.4.22.3), a cysteine endoproteolytic protease in fig trees' latex, has multiple isoforms. Until now, no data on autolysis of individual ficins (ficin isoforms) are available. Following purification, ficins' autolysis was determined by HPLC chromatogram changes and ultrafiltrations at different temperatures and storage times. These results showed that the number of HPLC peaks in latex proteins purification of Ficus carica cv. Sabz varied from previous fig varieties or cultivars. Proteolytic activity of ficins was inhibited by specific cysteine protease inhibitors, confirming the participation of the cysteine residue in the active site. The zeta potential of the first two eluted peaks (I and II) was negative, while that of other peaks were positive. All ficins were susceptible to autolysis when stored at high temperatures. In contrast, only the last two ficins (B, C) were prone to autolysis at cold temperature after long storage period. The rate of degradation of the ficins was significantly increased with the increased storage time. The ficin (A) related to peak (III) had the highest and the lowest surface hydrophobic patches and ratio of autolytic to proteolytic activity, respectively. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Calotropis procera Latex-Induced Inflammatory Hyperalgesia—Effect of Antiinflammatory Drugs

    Directory of Open Access Journals (Sweden)

    Raman Sehgal

    2005-01-01

    Full Text Available The milky white latex of plant Calotropis procera produces inflammation of the skin and mucous membranes on accidental exposure. It produces edema on local administration due to the release of histamine and prostaglandins and is associated with hyperalgesia. In the present study we have evaluated the antiedematous and analgesic activity of antiinflammatory drugs against inflammatory response induced by dried latex (DL of C procera in rat paw edema model. An aqueous extract of DL of C procera was injected into the subplantar surface of the rat paw and the paw volume was measured by a plethysmometer at 0, 1, 2, 6, 12, and 24 hours. Concomitantly the hyperalgesic response was also evaluated by motility test, stair climbing ability test, dorsal flexion pain test, compression test, and observing the grooming behavior. The inhibitory effect of diclofenac and rofecoxib on edema formation and hyperalgesic response was compared with cyproheptadine (CPH. DL-induced edema formation was maximum at 2 hours that was associated with decreased pain threshold, functional impairment, and grooming. Treatment with antiinflammatory drugs and CPH significantly attenuated the edematous response and grooming, increased the pain threshold, and improved functional parameters. Both antiinflammatory and antiserotonergic drugs significantly inhibited the hyperalgesia associated with DL-induced paw edema. Rofecoxib was found to be superior than diclofenac and was as effective as CPH in ameliorating the hyperalgesia. However, it was found to be less effective than CPH in attenuating edema formation.

  3. Diagnostic value of latex agglutination test in diagnosis of acute bacterial meningitis

    Directory of Open Access Journals (Sweden)

    Syeda Fasiha Mohammadi

    2013-01-01

    Full Text Available Objectives: To know the incidence of bacterial meningitis in children below five years of age. To compare conventional culture and antigen detection methods ( Latex agglutination test. Materials and Methods: 100 CSF samples of clinically suspected meningitis cases in children below 5 years of age were included. The samples were subjected to cell count, Gram stain, culture and LAT. The organisms isolated in the study were characterized according to standard procedures. Results: Of the 100 cases studied, 31 cases were diagnosed as ABM by Gram stain, culture and latex agglutination test as per WHO criteria. The hospital frequency of ABM was 1.7%. 15 (48.38 cases were culture positive. Gram stain was positive in 22(70.96 cases and LAT in 17(54.83 cases. Haemophilus influenzae was the most common causative agent of acute bacterial meningitis followed by S.pneumoniae. Case fatality rate was 45.16%.The sensitivity and specificity of LAT was 66.66% and 87.91% respectively. Conclusion : Bacterial meningitis is a medical emergency and early diagnosis and treatment is life saving and reduces chronic morbidity. LAT was more sensitive compared to conventional Gram stain and Culture technique in identifying the fastidious organisms like H.influenzae, S.pneumoniae and Group B Streptococcus. However, the combination of Gram stain, Culture and LAT proved to be more productive than any of the single tests alone.

  4. Severe complications caused by dissolution of latex with consequent self-disintegration of esophageal plastic tubes.

    Science.gov (United States)

    Löser, C

    2000-09-01

    A case of decisive material degeneration of an esophageal Celestin tube is described: a 50-year-old man with adenocarcinoma of the distal esophagus received a Celestin tube for palliative endoscopic treatment and 8 months later presented with suddenly occurring complete dysphagia. Dissolution of the latex layer in the proximal as well as the distal part of the tube had caused self-disintegration of the Celestin tube and had liberated the monofilament nylon coil which completely obstructed the lumen of the tube. Endoscopic tube removal was only possible by careful attachment of a balloon catheter and peroral extraction after insufflation with contrast medium up to 5 atm. A Medline-based review of the literature revealed different but predominantly severe complications (perforation, hemorrhage, obstruction, and peritonitis) based on material fatigue of the latex layer in esophageal Celestin tubes. At least 6 months after placement of a Celestin tube, regular fluoroscopic controls should be performed to detect early disintegration of the tube. Indication for the placement of Celestin tubes in patients with benign esophageal strictures and longer life expectancy should be assessed very critically.

  5. A simple kit for rapid field diagnosis of potato virus Y by latex serological test

    Directory of Open Access Journals (Sweden)

    Aarne Kurppa

    1987-07-01

    Full Text Available A simple kit for rapid detection of potato virus Y by latex serological test was developed. The test is carried out on a white cardboard sheet and the results can be read by naked eye in two minutes. A test card of 10 x 6 cm holds latex sensitized antibodies, buffers and other necessary ingredients as dry blue colored formulate on the ringed areas of the card. A test card includes space for six tests and positive and negative controls. The kit also includes disposable plastic sticks for mixing the samples with test reagents and a hand press with disposable plastic tips. For testing, dried reagents are dissolved in drops of sample and mixed. After gentle rotation, samples containing virus appear clearly granulated while samples from healthy plants remain unagglutinated. The testing of undiluted extracts of evenly developed tuber sprouts resulted in over 91 % identity with the results obtained with ELISA that was used as a control method. Testing of diluted leaf extracts reached the same reliability but undiluted leaf extracts from glasshouse grown potatoes were not well suitable as test samples because of their dark green color. No such problems occurred with field grown material and a complete identity with the ELISA readings was true when the samples included secondarily infected potato plants. No reaction to other potato viruses than PVY was obtained by the test kit.

  6. Influence of wearing latex gloves on electric pulp tester readings in children.

    Science.gov (United States)

    Holan, G

    1993-12-01

    Electric pulp testers operated by completing an electric circuit. Latex examination gloves have been claimed to interrupt this circuit and lead to false-negative results. This study was conducted to evaluate the influence of wearing latex gloves on electric pulp tester (EPT) readings. The pulps of 80 maxillary permanent incisors of 22 children 10-13 1/2 years old were tested using the Pelton & Crane 'Vitapulp' instrument. Each tooth was tested twice: with gloves and with bare hands. Teeth failing to respond to the EPT without gloves were excluded from the study. All EPT readings ranged between 1 and 9.5. Five teeth gave the same responses with gloved and ungloved hands. Only five teeth did not respond when gloves were worn, and all of these gave readings near the top of the EPT scale when tested without gloves. The other 70 teeth presented significantly higher readings with gloves than without gloves. It is concluded that removal of examination gloves during the operation of the EPT is necessary only if no response is obtained.

  7. Natural rubber latex used as drug delivery system in guided bone regeneration (GBR

    Directory of Open Access Journals (Sweden)

    Rondinelli Donizetti Herculano

    2009-06-01

    Full Text Available In this work, we propose natural rubber latex (NRL membranes as a protein delivery system. For this purpose Bovine Serum Albumin (BSA was incorporated into the latex solution for in vitro protein delivery experiments. Different polymerization temperatures were used, from -10 to 27 °C, in order to control the membrane morphology. These membranes were characterized by Scanning Electron Microscopy (SEM, Atomic Force Microscopy (AFM, as well as the Lowry Method to measure the BSA release. SEM and AFM microscopy analysis showed that the number, size and distribution of pores in NRL membranes can be varied, as well as its overall morphology. We have found that the morphology of the membrane is the predominant factor for higher protein release, compared with pore size and number of pores. Results demonstrated that the best drug-delivery system was the membrane polymerized at RT (27 °C, which does release 66% of its BSA content for up to 18 days. Our results indicate that NRLb could be used in the future as an active membrane that could accelerate bone healing in GBR.

  8. Determination of immune status in dogs against CPV-2 by recombinant protein based latex agglutination test.

    Science.gov (United States)

    Thomas, Jobin; Singh, Mithilesh; Goswami, T K; Glora, Philma; Chakravarti, Soumendu; Chander, Vishal; Upmanyu, Vikramaditya; Verma, Suman; Sharma, Chhavi; Mahendran, K

    2017-09-01

    Canine parvoviral enteritis is a highly contagious viral illness caused by canine parvovirus-2 (CPV-2) which affects puppies of mainly 6-20 weeks of age. Vaccination is pivotal in preventing and controlling CPV-2 infection. Determination of antibody status is a critical determinant for successful vaccination. The hemagglutination inhibition (HI) test is 'gold standard' test for quantification of antibodies specific to CPV-2, although the execution of this test is not feasible under field conditions. The present study was undertaken to develop a point of care testing to determine immune status prior to CPV-2 vaccination or to detect seroconversion in immunized dogs by latex agglutination test (LAT) using recombinant antigen. Truncated portion of VP2 protein (tVP2) of CPV-2 was selected on the basis of antigenic indices, overexpressed the recombinant protein in E. coli system and was subsequently used in development of LAT. A total of 59 serum samples obtained from vaccinated (n = 54) and healthy unvaccinated (n = 5) dogs were tested. The positivity was observed in 85% (46/54) of these dogs with varying agglutination pattern. The overall sensitivity and specificity of latex agglutination test in comparison to HI test was recorded as 90% and 88% respectively with an agreement value of 90% (CI = 95%). Copyright © 2017 International Alliance for Biological Standardization. Published by Elsevier Ltd. All rights reserved.

  9. Green synthesis of colloidal silver nanoparticles using natural rubber latex extracted from Hevea brasiliensis.

    Science.gov (United States)

    Guidelli, Eder José; Ramos, Ana Paula; Zaniquelli, Maria Elisabete D; Baffa, Oswaldo

    2011-11-01

    Colloidal silver nanoparticles were synthesized by an easy green method using thermal treatment of aqueous solutions of silver nitrate and natural rubber latex (NRL) extracted from Hevea brasiliensis. The UV-Vis spectra detected the characteristic surface plasmonic absorption band around 435 nm. Both NRL and AgNO(3) contents in the reaction medium have influence in the Ag nanoparticles formation. Lower AgNO(3) concentration led to decreased particle size. The silver nanoparticles presented diameters ranging from 2 nm to 100 nm and had spherical shape. The selected area electron diffraction (SAED) patterns indicated that the silver nanoparticles have face centered cubic (fcc) crystalline structure. FTIR spectra suggest that reduction of the silver ions are facilitated by their interaction with the amine groups from ammonia, which is used for conservation of the NRL, whereas the stability of the particles results from cis-isoprene binding onto the surface of nanoparticles. Therefore natural rubber latex extracted from H. brasiliensis can be employed in the preparation of stable aqueous dispersions of silver nanoparticles acting as a dispersing and/or capping agent. Moreover, this work provides a new method for the synthesis of silver nanoparticles that is simple, easy to perform, pollutant free and inexpensive. Copyright © 2011 Elsevier B.V. All rights reserved.

  10. Rubber elongation factor (REF, a major allergen component in Hevea brasiliensis latex has amyloid properties.

    Directory of Open Access Journals (Sweden)

    Karine Berthelot

    Full Text Available REF (Hevb1 and SRPP (Hevb3 are two major components of Hevea brasiliensis latex, well known for their allergenic properties. They are obviously taking part in the biosynthesis of natural rubber, but their exact function is still unclear. They could be involved in defense/stress mechanisms after tapping or directly acting on the isoprenoid biosynthetic pathway. The structure of these two proteins is still not described. In this work, it was discovered that REF has amyloid properties, contrary to SRPP. We investigated their structure by CD, TEM, ATR-FTIR and WAXS and neatly showed the presence of β-sheet organized aggregates for REF, whereas SRPP mainly fold as a helical protein. Both proteins are highly hydrophobic but differ in their interaction with lipid monolayers used to mimic the monomembrane surrounding the rubber particles. Ellipsometry experiments showed that REF seems to penetrate deeply into the monolayer and SRPP only binds to the lipid surface. These results could therefore clarify the role of these two paralogous proteins in latex production, either in the coagulation of natural rubber or in stress-related responses. To our knowledge, this is the first report of an amyloid formed from a plant protein. This suggests also the presence of functional amyloid in the plant kingdom.

  11. A system for treatment of diabetic foot ulcers using led irradiation and natural latex

    Directory of Open Access Journals (Sweden)

    Gustavo Adolfo Marcelino de Almeida Nunes

    Full Text Available Abstract Introduction: We developed and tested a new system for inducing the healing of diabetic foot ulcers. The system relies on the regenerative properties of its two components: an insole with a sheet of natural latex and a device that contains a matrix of light emitting diodes with wavelength of 635 nm. Methods The electronic and latex based devices were developed, and a four weeks test was performed in one control group (CG of five ulcers and one experimental group (EG of eight ulcers. The CG was treated with a standard approach, based on a silver-releasing foam dressing, and the EG was treated with the system under test. For each ulcer, an index for quantifying the percentage ulcer recovery, named CRU(%, has been calculated; a CRU(% = 0% means no healing, and a CRU(% = 100% means total healing. Results There were statistically significant increases of CRU(% of 51.8% (p = 0.022, for the CG, and of 78.4% (p < 0.001, for the EG. The increase in the EG was higher than the increase in the CG, and the difference was statistically significant (p < 0.001. The results showed that the proposed method had, for these particular sets of ulcers, faster healing rates, than for the standard method. Conclusion The results hint that the proposed method seems promising as a future treatment method. However, the technique must undergo further testing before it can be considered for extensive clinical applications.

  12. Research and application of fuzzy subtractive clustering model on tensile strength of radiation vulcanization for nitrile-butadiene rubber

    International Nuclear Information System (INIS)

    Zuo Duwen; Wang Hong; Zhu Nankang

    2010-01-01

    By use of fuzzy subtractive clustering model, the relationship between tensile strength of radiation vulcanization of NBRL (Nitrile-butadiene rubber latex) and irradiation parameters have been investigated. The correlation coefficient was calculated to be 0.8222 in the comparison of experimental data to the predicted data. It was obvious that fuzzy model identification method is not only high precision with small computation, but also easy to be used. It can directly supply the evolution of tensile strength of NBR by fuzzy modeling method in radiation vulcanization process for nitrile-butadiene rubber. (authors)

  13. The Strength Compass

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    In the Ph.D-project ͚Strengths-based Learning - Children͛s character strengths as a means to their learning potential͛ 750 Danish children have assessed ͚The Strength Compass͛ in order to identify their strengths and to create awareness of strengths. This was followed by a strengths......-based intervention program in order to explore the strengths. Finally different methods to apply the strength in everyday life at school were applied. The paper presentation will show the results for strengths display for children aged 6-16 in different categories: Different age groups: Are the same strengths...... present in both small children and youths? Gender: Do the results show differences between the two genders? Danish as a mother- tongue language: Do the results show any differences in the strengths display when considering different language and cultural backgrounds? Children with Special Needs: Do...

  14. Radio-vulcanization of natural rubber in the latex phase. Study of an experimental 1 tonne per hour production; Radio-vulcanisation du caoutchouc naturel en phase latex. Etude d'une production experimentale de 1 tonne par heure

    Energy Technology Data Exchange (ETDEWEB)

    Leveque, P; Puig, J R; Roudeix, H [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1968-07-01

    After briefly reviewing the main research carried out on the radio-vulcanization of latex and elastomers, a description is given of 4 types of cell which have been used successively with a view to industrial irradiation. They have made it possible to acquire the information necessary for resolving the main problem arising during irradiation - the formation of coagulum. The first two cell are designed for irradiation by a horizontal beam ('Dynamitron'), the two others use a vertical beam ('Circe'). The study of the properties of the rubber obtained shows it to compare favorably with 'Revultex'. In the appendix are given some characteristics of natural latex and information about its processing. (authors) [French] Apres un rappel des principales etudes sur la radio-vulcanisation du latex et des elastomeres, on decrit les quatre types de cellules successivement essayes en vue de l'irradiation industrielle. Ils ont permis d'acquerir les informations necessaires a la resolution du probleme principal pose par l'irradiation, la formation de coagulum au cours de celle,-ci. Les deux premiers sont concus pour l'irradiation par un faisceau horizontal ('Dynamitron'), les derniers par un faisceau vertical ('Circe'). L'etude des proprietes du caoutchouc obtenu montre qu'il se compare favorablement au 'Revultex'. Un apercu est donne en annexe des caracteristiques du latex naturel et de sa mise en oeuvre. (auteurs)

  15. Composite poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex for immunoassay. The case of plasminogen.

    Science.gov (United States)

    Miksa, B; Wilczynska, M; Cierniewski, C; Basinska, T; Slomkowski, S

    1995-01-01

    Poly(methyl methacrylate-methacrylic acid-2-hydroxyethyl methacrylate) latex (ACRYLAT) was synthesized by radical precipitation polymerization. The mass median diameter (MMD) and the geometrical standard deviation (GSD) of the ACRYLAT particles were 138 nm and 1.2, respectively. The concentration of the titrable carboxylic groups in the surface layer of latex particles was equal to 8.41 x 10(-6) mol m-2. Latex was able to bind up to 2.82 x 10(-7) mol of 1-aminopyrene per 1 m2 of the surface of the latex particles due to the ionic interactions between carboxylate anions and ammonium cations of protonated 1-aminopyrene. ACRYLAT was able to immobilize covalently human serum albumin in amounts up to 0.23 mg m-2. Aggregation of ACRYLAT with immobilized HSA, induced with specific antibodies (anti-HSA), was investigated turbidimetrically. The results indicated that in the model turbidimetric immunoassay, ACRYLAT coated with HSA can be used for the detection of anti-HSA in the goat anti-HSA serum diluted from 50 to 7000-fold. Immobilization of rabbit antibodies to plasminogen (anti-Plg) to ACRYLAT via the epsilon-aminocaproic acid linkers provided particles which were used for the development of the turbidimetric immunoassay for plasminogen. In this assay plasminogen could be detected in concentration ranging from 0.75 to 75 micrograms ml-1 in the blood plasma.

  16. Sequencing and characterization of asclepain f: the first cysteine peptidase cDNA cloned and expressed from Asclepias fruticosa latex.

    Science.gov (United States)

    Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X

    2009-07-01

    Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.

  17. Diagnosis of Trichomonous vaginalis by microscopy, latex agglutination, diamond's media, and PCR in symptomatic women, Khartoum, Sudan.

    Science.gov (United States)

    Saleh, Amir M; Abdalla, Hamid S; Satti, Abdelsalam B; Babiker, Suad M; Gasim, Gasim I; Adam, Ishag

    2014-03-06

    Trichomoniasis is the most common sexually transmitted disease. However, limited data are available on an effective technique for the diagnosis of Trichomonas vaginalis. A cross-sectional study was conducted to evaluate the accuracy of wet mount microscopy, latex agglutination, Diamond's media, and polymerase chain reaction (PCR) for detection of T. vaginalis among symptomatic women who attended the gynecological clinic at Khartoum, Sudan. Of the 297 women studied, 252 (84.8%) were positive for T. vaginalis by wet mount microscopy, 257 (86.5%) by latex agglutination, 253 (85.2%) by Diamond's media, and 253 (85.2%) by PCR. The sensitivity and specificity of wet mount microscopy were 99.2% and 97.7%, respectively, compared with PCR. The sensitivity and specificity of latex agglutination and Diamond's media were 99.6% and 88.6%, and 100.0% and 86.4%, respectively, compared with PCR. In this study, wet mount microscopy, latex agglutination, and Diamond's media were found to be highly sensitive and specific. However, the availability and cost effectiveness might limit the use of Diamond's media and PCR in routine practice. The virtual slide(s) for this article can be found here: http://www.diagnosticpathology.diagnomx.eu/vs/7859723851211496.

  18. Dragon Fruit Foliage Plant-Based Coagulant for Treatment of Concentrated Latex Effluent: Comparison of Treatment with Ferric Sulfate

    Directory of Open Access Journals (Sweden)

    Juferi Idris

    2013-01-01

    Full Text Available The effectiveness of dragon fruit foliage as a natural coagulant for treatment of concentrated latex effluent was investigated and compared with ferric sulfate, a chemical coagulant. Dragon fruit is a round and often red-colored fruit with scales-like texture and is native to south American countries which is also cultivated and heavily marketed in southeast Asian countries. Its foliage represents a part of its overall plant system. Latex effluent is one of the main byproduct from rubber processing factories in Malaysia. Three main parameters investigated were chemical oxygen demand (COD, suspended solids (SS, and turbidity of effluent. Coagulation experiments using jar test were performed with a flocculation system where the effects of latex effluent pH as well as coagulation dosage on coagulation effectiveness were examined. The highest recorded COD, SS, and turbidity removal percentages for foliage were observed for effluent pH 10 at 94.7, 88.9, and 99.7%, respectively. It is concluded that the foliage showed tremendous potential as a natural coagulant for water treatment purposes. The foliage could be used in the pretreatment stage of Malaysian latex effluent prior to secondary treatment.

  19. Detection of latex allergens by immunoelectron microscopy in ambient air (PM10) in Oslo, Norway (1997-2003).

    Science.gov (United States)

    Namork, Ellen; Kurup, Viswanath P; Aasvang, Gunn Marit; Johansen, Bjørn V

    2004-11-01

    The authors collected ambient air along two highways in Oslo to investigate the annual variations in particulate matter (PM10) and the presence of latex as an outdoor allergen. PMI, was monitored for a period of five years, during which time the use of studded winter tires was reduced. The presence of latex and of common aeroallergens was examined directly on the collection filters with immunoelectron microscopy visualized in a scanning electron microscope. The annual variation in PM10 was similar over the five years of sampling, with increased mass concentrations in winter. Statistical analysis indicated no major effect from the change to nonstudded tires. The most important factors influencing the PM10 concentration were meteorological parameters like wind and rain. Immnunolabeling of the filters showed latex as an outdoor allergen that adhered to carbon aggregates from vehicle emission. The results also indicated cross-reactive epitopes among the common allergens investigated, which for sensitized subjects may add to the risk of developing latex allergy.

  20. The patatin-like protein from the latex of Hevea brasiliensis (Hev b 7) is not a vacuolar protein

    NARCIS (Netherlands)

    Jekel, PA; Hofsteenge, J; Beintema, JJ

    Upon centrifugation, rubber latex is divided into a layer of rubber particles, the cytosol, and the lutoid-body fraction, which is of vacuolar origin. One of the proteins isolated from the lutoid-body fraction is a protein with a molecular mass of 43 kDa, which has esterase activity on

  1. Banyan latex: a facile fuel for the multifunctional properties of MgO nanoparticles prepared via auto ignited combustion route

    International Nuclear Information System (INIS)

    Anil Kumar, M R; Nagaswarupa, H P; Gurushantha, K; Pratapkumar, C; Prashantha, S C; Shashishekar, T R; Anantharaju, K S; Nagabhushana, H; Sharma, S C; Vidya, Y S; Daruka Prasad, B; Vivek Babu, C S; Vishnu Mahesh, K R

    2015-01-01

    MgO nanoparticles (MNPs) were prepared by a solution combustion route using banyan tree (BT) latex and glycine as fuels. The powder x-ray diffraction results indicate the formation of a single cubic phase and the crystallite size obtained from transmission electron microscopy was found to be ∼10–15 nm. Scanning electron microscopy result reveals spherical-shaped particles obtained with BT latex. However, in a chemical route, porous and agglomerated particles were obtained. The energy band gap of MNPs obtained using BT latex and a chemical route were found to be in the range 4.85–5.0 eV. Photoluminescence peaks observed at 473, 514, and 588 nm when excited at 433 nm, which were attributed to surface defects. The enhanced photocatalytic activities of spherical MgO were due to smaller crystallite size, higher surface defects, dye sensitization, and capability to reduce the electron–hole pair recombination. Further, green-synthesized MNPs exhibit superior antifungal activity against various plant pathogens. The present studies demonstrated a green engineering route for the synthesis of multifunctional MNPs using BT latex. (paper)

  2. Barrier and adhesion properties of anti-corrosion coatings based on surfactant-free latexes from anhydride-containing polymers

    NARCIS (Netherlands)

    Soer, W.J.; Ming, W.; Koning, C.E.; Benthem, van R.A.T.M.; Mol, J.M.C.; Terryn, H.

    2009-01-01

    We have successfully obtained surfactant-free latexes from anhydride-containing polymers, including poly(styrene-alt-maleic anhydride) (PSMA), maleinized polybutadiene (PBDMA), and poly(octadecene-alt-maleic anhydride) (POMA). Here we report barrier and adhesion properties of the coatings made from

  3. Sulfonated macro-RAFT agents for the surfactant-free synthesis of cerium oxide-based hybrid latexes

    NARCIS (Netherlands)

    Garnier, J.; Warnant, J.; Lacroix-Desmazes, P.; Dufils, P.E.; Vinas, J.; Herk, van A.M.

    2013-01-01

    Three types of amphiphatic macro-RAFT agents were employed as compatibilizers to promote the polymerization reaction at the surface of nanoceria for the synthesis of CeO2-based hybrid latexes. Macro-RAFT copolymers and terpolymers were first synthesized employing various combinations of butyl

  4. Enzymic and structural studies on processed proteins from the vacuolar (lutoid-body) fraction of latex of Hevea brasiliensis

    NARCIS (Netherlands)

    Subroto, T; de Vries, H; Schuringa, JJ; Soedjanaatmadja, UMS; Hofsteenge, J; Jekel, PA; Beintema, JJ

    2001-01-01

    The lutoid-body (bottom) fraction of latex from the rubber tree (Hevea brasiliensis) contains a limited number of major proteins. These are the chitin-binding protein hevein, its precursor and C-terminal fragment of the precursor, a basic chitinase/lysozyme, and a beta-1,3-glucanase. The content and

  5. Effect of Hevea brasiliensis latex sap gel on healing of acute skin wounds induced on the back of rats

    Directory of Open Access Journals (Sweden)

    Maria Vitória Carmo Penhavel

    Full Text Available Objective : to evaluate the effect of topical delivery of latex cream-gel in acute cutaneous wounds induced on the back of rats. Methods : we subjected sixteen rats to dermo-epidermal excision of a round dorsal skin flap, with 2.5cm diameter. We divided the animals into two groups: Latex Group: application of cream-gel-based latex throughout the wound bed on postoperative days zero, three, six and nine; Control group: no treatment on the wound. Photographs of the lesions were taken on the procedure day and on the 6th and 14th postoperative days, for analyzing the area and the larger diameter of the wound. We carried out euthanasia of all animals on the 14th postoperative day, when we resected he dorsal skin and the underlying muscle layer supporting the wound for histopathological study. Results : there was no statistically significant difference in the percentage of wound closure, in the histopathological findings or in the reduction of the area and of the largest diameter of the wounds among the groups studied on the 14th postoperative day. Conclusion : according to the experimental conditions in which the study was conducted, latex cream-gel did not interfere in the healing of acute cutaneous wounds in rats.

  6. Latex Allergy

    Science.gov (United States)

    American Academy of Allergy Asthma & Immunology Menu Search Main navigation Skip to content Conditions & Treatments Allergies Asthma Primary Immunodeficiency Disease Related Conditions Drug Guide Conditions Dictionary Just ...

  7. Latex Allergy

    Science.gov (United States)

    ... Conditions Drug Guide Conditions Dictionary Just for Kids Library School Tools Videos Virtual Allergist Education & Training Careers in ... Support the AAAAI Foundation Donate Utility navigation Español Journals Annual Meeting Member Login / My Membership Search navigation ...

  8. Latex Allergy

    Science.gov (United States)

    ... Kids and Teens Pregnancy and Childbirth Women Men Seniors Your Health Resources Healthcare Management End-of-Life Issues Insurance & Bills Self Care Working With Your Doctor Drugs, Procedures & Devices Over-the- ...

  9. A comparison of tackified, miniemulsion core-shell acrylic latex films with corresponding particle-blend films: structure-property relationships.

    Science.gov (United States)

    Canetta, Elisabetta; Marchal, Jeanne; Lei, Chun-Hong; Deplace, Fanny; König, Alexander M; Creton, Costantino; Ouzineb, Keltoum; Keddie, Joseph L

    2009-09-15

    Tackifying resins (TRs) are often added to pressure-sensitive adhesive films to increase their peel strength and adhesion energy. In waterborne adhesives, the TR is dispersed in water using surfactants and then blended with colloidal polymers in water (i.e., latex). In such waterborne systems, there are problems with the colloidal stability and difficulty in applying coatings of the particle blends; the films are often hydrophilic and subject to water uptake. Here, an alternative method of making waterborne, tackified adhesives is demonstrated. The TR is incorporated within the core of colloidal polymer particles via miniemulsion polymerization. Atomic force microscopy (AFM) combined with force spectroscopy analysis reveals there is heterogeneity in the distribution of the TR in films made from particle blends and also in films made from miniemulsion polymers. Two populations, corresponding to TR-rich and acrylic-rich components, were identified through analysis of the AFM force-displacement curves. The nanoscale maximum adhesion force and adhesion energy were found to be higher in a miniemulsion film containing 12 wt % tackifying resin in comparison to an equivalent blended film. The macroscale tack and viscoelasticity are interpreted by consideration of the nanoscale structure and properties. The incorporation of tackifying resin through a miniemulsion polymerization process not only offers clear benefits in the processing of the adhesive, but it also leads to enhanced adhesion properties.

  10. Detection and toxicity assessment of nitrosamines migration from latex gloves in the Chinese market.

    Science.gov (United States)

    Feng, Di; Wang, Huiping; Cheng, Xuelian; Wang, Jiedong; Ning, Lifeng; Zhou, Qingfeng; Zhou, Yue; Yang, Quanli

    2009-09-01

    Nitrosamines are potent carcinogens and have been found in latex products. In 2007, twenty-seven natural latex gloves including sterile gloves, examination gloves and household use gloves were sampled from the Chinese market. This study monitored the migration of nitrosamines and nitrosatable substance from these gloves, and evaluated their mutagenicity using a Salmonella typhimurium mutation assay (Ames assay) with the strains TA98, TA97, TA100 and TA102 and by a micronucleus test (MN test) using ICR mice. In addition, the cytotoxicity of these compounds was determined by a MTT assay. N-nitrosodimethylamine (NDMA), N-nitrosodiethylamine (NDEA) and N-nitrosodibutylamine (NDBA) were all found in samples treated with artificial sweat for 4h at 37 degrees C, and total nitrosamines varied from 18.89 to 244.51microg/Kg. The nitrosamine mixture of NDMA, NDEA and NDBA was used in both the Ames assay and the MN test. The proportion of NDMA, NDEA and NDBA (1:10:20) was selected according to the proportion of nitrosamines migration from sample E05. In the Ames assay, the lowest dose (1.98 x 10(-3)microg per plate) produced a positive result in the TA98 strain, corresponding to nitrosamines migration from sample E05 of 0.016g (the total nitrosamines migration from glove E05 was 122.55 microg/kg). The TA100 strain responded positively at a dose of 4.96 x 10(-2)microg per plate, corresponding to nitrosamines migration from glove E05 of 0.040g. The MN test showed nitrosamine migration of 3.04 mg from 2066 pairs of sample E05 and could induce micronuclei in one mouse weighing 28g (average weight of one E05 glove was 6g). Extracts from gloves were found to be cytotoxic and there was a significant correlation between cytotoxicity (IC50) and the release level of nitrosamines. In conclusion, in view of the high content of nitrosamines in latex gloves and the potential toxicity of nitrosamines migration from these gloves, it is suggested that both an effective and feasible detection

  11. Type I allergy to natural rubber latex and type IV allergy to rubber chemicals in health care workers with glove-related skin symptoms.

    Science.gov (United States)

    Nettis, E; Assennato, G; Ferrannini, A; Tursi, A

    2002-03-01

    It has been established that there are type I and type IV allergens in latex gloves. The purpose of the study was to establish the prevalence of rubber glove-induced skin symptoms among health care workers in one Italian hospital. Health care workers (n = 1584) were evaluated using a written questionnaire and 295 respondents with glove-induced skin symptoms were tested. We performed: skin prick test with latex glove extract and commercial latex, and environmental and food allergens; glove use test; patch tests with a rubber additive series; and RASTs. Hospital employees who used or had used latex gloves at work were 1294. Three hundred and sixteen (24.4%) reported glove-induced symptoms, namely, cutaneous symptoms in all the cases and non-cutaneous symptoms in 105 subjects (8.1%). Twenty-seven of the 295 symptomatic employees tested (9.1%) were latex sensitive. Thirty-one patients (10.5%) exhibited positive patch test to rubber-related allergens. The most positive readings were obtained from the Thiuram mix and the Carba mix, with 12 and 9 positivities, respectively. The risk factors for latex skin sensitization were: a previous history of atopy and asthma; history of surgery; pre-existing hand dermatitis; work-related symptoms; and positive skin tests to common inhalant and certain foods (P skin complaints of latex gloves are related to skin irritation rather than to allergy. The immediate allergy to latex and the delayed allergy to rubber chemicals suggest that all the health care workers with glove-related dermatitis should undergo both skin prick test and glove use test to detect type I hypersensitivity to latex, and patch test to detect type IV hypersensitivity to rubber chemicals.

  12. Preparation and Characterization of Conducting Polymer Latices by Chemical Polymerization of Aniline or Anisidine in Presence of Latex: Study of Their Electroactivity and Anti-Corrosion Properties

    Directory of Open Access Journals (Sweden)

    Bakhshali Massoumi

    2013-06-01

    Full Text Available Poly (vinylacetate-co-butylmethacrylate was prepared in presence of potassium persulphate as an oxidizing agent in aqueous solution of dodecylbenzene sulfonate sodium as an emulsifying agent. Then, aniline was polymerized by chemical oxidation method at three different concentrations of aniline monomer (0.1, 0.2 and 0.3 M in toluene in presence of poly(vinylacetate-co-butylmethacrylate in order to obtain polyaniline/poly(vinylacetate-co-butylmethacrylate. To prepare conducting-latex of polyanisidine/poly(vinylacetate-co-butylmethacrylate the same method was employed as above for aniline monomer in obtaining conducting polyaniline/poly(vinylacetate-co-butylmethacrylate latex. In addition, the purification of conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was conducted and preparation of tin layer films of conducting-latex polymers was carried out by casting method on glassy lames. The electroactivity properties of the prepared latex-polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate were investigated by cyclic voltammetery (CV. The voltamogrames showed that the latex films were electroactive. Because of conductivity and electroactivity, the obtained films may find applications in anti-corrosion coatings. The anti-corrosion properties of conducting-latex polymers were studied on aluminum surface by impedance technique. The structure of the prepared conducting-latex polymers was confirmed by Fourier transform infrared (FTIR. Finally, the electrical conductivity of synthesized conducting-latex polymers, polyaniline/poly(vinylacetate-co-butylmethacrylate and polyanisidine/poly(vinylacetate-co-butylmethacrylate was measured by four probe technique.

  13. Particle size, morphology and color tunable ZnO:Eu{sup 3+} nanophosphors via plant latex mediated green combustion synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Chandrasekhar, M. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Department of Physics, Acharya Institute of Technology, Bangalore 560 107 (India); Nagabhushana, H., E-mail: bhushanvlc@gmail.com [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Sharma, S.C. [B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Department of Mechanical Engineering, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sudheer kumar, K.H. [Department of Environmental Science, Kuvempu University, Shankarghatta, Shimoga 577 451 (India); Department of Chemistry, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Dhananjaya, N. [Department of Physics, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); B.S. Narayan Centre of Excellence for Advanced Materials, B.M.S. Institute of Technology, Yelahanka, Bangalore 560 064 (India); Sunitha, D.V. [Prof. C.N.R. Rao Centre for Advanced Materials, Tumkur University, Tumkur 572 103 (India); Shivakumara, C. [Solid State and Structural Chemistry Unit, Indian Institute of Science, Bangalore 560 012 (India); Nagabhushana, B.M. [Department of Chemistry, M.S. Ramaiah Institute of Technology, Bangalore 560 054 (India)

    2014-01-25

    Highlights: • ZnO:Eu{sup 3+} phosphors were prepared by green synthesis route. • Morphology and particle size was tuned by varying the concentration of plant latex. • The phosphor show excellent chromaticity coordinates in the white region. -- Abstract: Efficient ZnO:Eu{sup 3+} (1–11 mol%) nanophosphors were prepared for the first time by green synthesis route using Euphorbia tirucalli plant latex. The final products were well characterized by powder X-ray diffraction (PXRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), UV–visible spectroscopy (UV–Vis), Fourier transform infrared spectroscopy (FTIR), etc. The average particle size of ZnO:Eu{sup 3+} (7 mol%) was found to be in the range 27–47 nm. With increase of plant latex, the particle size was reduced and porous structure was converted to spherical shaped particles. Photoluminescence (PL) spectra indicated that the peaks situated at ∼590, 615, 648 and 702 nm were attributed to the {sup 5}D{sub 0} → {sup 7}F{sub j(j=1,2,3,4)} transitions of Eu{sup 3+} ions. The highest PL intensity was recorded for 7 mol% with Eu{sup 3+} ions and 26 ml plant latex concentration. The PL intensity increases with increase of plant latex concentration up to 30 ml and there after it decreases. The phosphor prepared by this method show spherical shaped particles, excellent chromaticity co-ordinates in the white light region which was highly useful for WLED’s. Further, present method was reliable, environmentally friendly and alternative to economical routes.

  14. The strength compass

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    of agreement/disagreement. Also the child/teacher is asked whether the actual strength is important and if he or she has the possibilities to apply the strength in the school. In a PhDproject ‘Strengths-based Learning - Children’s Character Strengths as Means to their Learning Potential’ 750 Danish children......Individual paper presentation: The ‘Strength Compass’. The results of a PhDresearch project among schoolchildren (age 6-16) identifying VIAstrengths concerning age, gender, mother-tongue-langue and possible child psychiatric diagnosis. Strengths-based interventions in schools have a theoretical...... Psychological Publishing Company. ‘The Strength Compass’ is a computer/Ipad based qualitative tool to identify the strengths of a child by a self-survey or a teacher’s survey. It is designed as a visual analogue scale with a statement of the strength in which the child/teacher may declare the degree...

  15. Isometric shoulder strength in young swimmers.

    Science.gov (United States)

    McLaine, Sally J; Ginn, Karen A; Fell, James W; Bird, Marie-Louise

    2018-01-01

    The prevalence of shoulder pain in young swimmers is high. Shoulder rotation strength and the ratio of internal to external rotation strength have been reported as potential modifiable risk factors associated with shoulder pain. However, relative strength measures in elevated positions, which include flexion and extension, have not been established for the young swimmer. The aim of this study was to establish clinically useful, normative shoulder strength measures and ratios for swimmers (14-20 years) without shoulder pain. Cross-sectional, observational study. Swimmers (N=85) without a recent history of shoulder pain underwent strength testing of shoulder flexion and extension (in 140° abduction); and internal and external rotation (in 90° abduction). Strength tests were performed in supine using a hand-held dynamometer and values normalised to body weight. Descriptive statistics were calculated for strength and strength ratios (flexion:extension and internal:external rotation). Differences between groups (based on gender, history of pain, test and arm dominance) were explored using independent and paired t tests. Normative shoulder strength values and ratios were established for young swimmers. There was a significant difference (pdifferences in strength ratios. Relative strength of the dominant and non-dominant shoulders (except for extension); and for swimmers with and without a history of shoulder pain was not significantly different. A normal shoulder strength profile for the young swimmer has been established which provides a valuable reference for the clinician assessing shoulder strength in this population. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

  16. Modified SEAGULL

    Science.gov (United States)

    Salas, M. D.; Kuehn, M. S.

    1994-01-01

    Original version of program incorporated into program SRGULL (LEW-15093) for use on National Aero-Space Plane project, its duty being to model forebody, inlet, and nozzle portions of vehicle. However, real-gas chemistry effects in hypersonic flow fields limited accuracy of that version, because it assumed perfect-gas properties. As a result, SEAGULL modified according to real-gas equilibrium-chemistry methodology. This program analyzes two-dimensional, hypersonic flows of real gases. Modified version of SEAGULL maintains as much of original program as possible, and retains ability to execute original perfect-gas version.

  17. Development of a rapid agglutination latex test for diagnosis of enteropathogenic and enterohemorrhagic Escherichia coli infection in developing world: defining the biomarker, antibody and method.

    Directory of Open Access Journals (Sweden)

    Letícia B Rocha

    2014-09-01

    Full Text Available Enteropathogenic and enterohemorrhagic Escherichia coli (EPEC/EHEC are human intestinal pathogens responsible for diarrhea in both developing and industrialized countries. In research laboratories, EPEC and EHEC are defined on the basis of their pathogenic features; nevertheless, their identification in routine laboratories is expensive and laborious. Therefore, the aim of the present work was to develop a rapid and simple assay for EPEC/EHEC detection. Accordingly, the EPEC/EHEC-secreted proteins EspA and EspB were chosen as target antigens.First, we investigated the ideal conditions for EspA/EspB production/secretion by ELISA in a collection of EPEC/EHEC strains after cultivating bacterial isolates in Dulbecco's modified Eagle's medium (DMEM or DMEM containing 1% tryptone or HEp-2 cells-preconditioned DMEM, employing either anti-EspA/anti-EspB polyclonal or monoclonal antibodies developed and characterized herein. Subsequently, a rapid agglutination latex test (RALT was developed and tested with the same collection of bacterial isolates.EspB was defined as a biomarker and its corresponding monoclonal antibody as the tool for EPEC/EHEC diagnosis; the production of EspB was better in DMEM medium. RALT assay has the sensitivity and specificity required for high-impact diagnosis of neglected diseases in the developing world.RALT assay described herein can be considered an alternative assay for diarrhea diagnosis in low-income countries since it achieved 97% sensitivity, 98% specificity and 97% efficiency.

  18. Preparation of magnetic latexes functionalized with chloromethyl groups via emulsifier-free miniemulsion polymerization

    International Nuclear Information System (INIS)

    Faridi-Majidi, Reza; Sharifi-Sanjani, Naser

    2007-01-01

    Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe 3 O 4 as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50

  19. Preparation of magnetic latexes functionalized with chloromethyl groups via emulsifier-free miniemulsion polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Faridi-Majidi, Reza [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)]. E-mail: refaridi@khayam.ut.ac.ir; Sharifi-Sanjani, Naser [School of Chemistry, University College of Science, Tehran University, Tehran (Iran, Islamic Republic of)

    2007-04-15

    Functionalized crosslinked polystyrene-co-divinylbenzene-co-chloromethylstyrene magnetic latex particles were prepared via emulsifier-free miniemulsion polymerization using 2, 2' azobis (2-amidinopropane) dihydrochloride (V-50) as an initiator and in the presence of magnetite nanoparticles in the monomers. Transmission electron microscopy (TEM) proved the presence of magnetite nanoparticles in polymer particles. Differential scanning calorimetery (DSC) analysis of the product showed an exothermic signal due to crosslinking of chains through electrophilic aromatic substitution of phenyl groups with chloromethyl groups in the presence of the dispersed Fe{sub 3}O{sub 4} as Lewis acid. This was proven by thermogravimetric analysis (TGA) via the loss of gaseous HCl. The results were also compared with those of magnetite-free miniemulsion polymerization using V-50.

  20. Antifungal activity of fluconazole-loaded natural rubber latex against Candida albicans.

    Science.gov (United States)

    Yonashiro Marcelino, Mônica; Azevedo Borges, Felipe; Martins Costa, Ana Flávia; de Lacorte Singulani, Junya; Ribeiro, Nathan Vinícius; Barcelos Costa-Orlandi, Caroline; Garms, Bruna Cambraia; Soares Mendes-Giannini, Maria José; Herculano, Rondinelli Donizetti; Fusco-Almeida, Ana Marisa

    2018-03-01

    This work aimed to produce a membrane based on fluconazole-loaded natural rubber latex (NRL), and study their interaction, drug release and antifungal susceptibility against Candida albicans. Fluconazole-loaded NRL membrane was obtained by casting method. The Fourier Transform Infrared Spectroscopy showed no modifications either in NRL or fluconazole after the incorporation. Mechanical test presented low Young's modulus and high strain, indicating the membranes have sufficient elasticity for biomedical application. The bio-membrane was able to release the drug and inhibit the growth of C. albicans as demonstrated by disk diffusion and macrodilution assays. The biomembrane was able to release fluconazole and inhibit the growth of C. albicans, representing a promising biomaterial for skin application.

  1. Formation of protein complex with the aid of polyethylene glycol for deproteinized natural rubber latex

    Science.gov (United States)

    Wei, Lim Keuw; Ing, Wong Kwee; Badri, Khairiah Haji; Ban, Wong Chong

    2013-11-01

    The effect of polyethylene glycol (PEG) as a deproteinizing agent in commercial natural rubber latex (NRL) onto the physicochemical properties of the NRL was investigated. Three types of PEG were used namely PEG200, PEG4000 and PEG20000 (molecular weight of 200, 4000 and 20000 g/mol respectively). The optimum amount of PEG in NRL was determined from viscosity changes, protein content and Fourier Transform Infrared spectroscopy. Level of protein reduction was affected by molecular weight of PEG. The addition of PEG in NRL reduced the protein content of NRL (3.30 %) to the lowest (2.01 %) at 0.40 phr of PEG200 due to more attractive hydrophobic interactions between short chains PEG compared to PEG4000 (2.24%) and PEG20000 (2.15%). This was verified through FTIR spectroscopy analysis by observing the primary and secondary amide peak where PEG4000 has lesser absorption at the region compared to with PEG20000.

  2. Diclofenac Potassium Transdermal Patches Using Natural Rubber Latex Biomembranes as Carrier

    Directory of Open Access Journals (Sweden)

    Natan Roberto de Barros

    2015-01-01

    Full Text Available The aim of this study was to design a compound transdermal patch containing diclofenac potassium (Dic-K using natural rubber latex (NRL biomembrane. The NRL from Hevea brasiliensis is easily manipulated and low cost and presents high mechanical resistance. It is a biocompatible material which can stimulate natural angiogenesis and is capable of adhering cells on its surface. Recent researches have used the NRL for Transdermal Drug Delivery Systems (TDDSs. Dic-K is used for the treatment of rheumatoid arthritis and osteoarthritis and pain relief for postoperative and posttraumatic cases, as well as inflammation and edema. Results showed that the biomembrane can release Dic-K for up to 216 hours. The kinetics of the Dic-K release could be fitted with double exponential function. X-ray diffraction and Fourier Transform Infrared (FTIR spectroscopy show some interaction by hydrogen bound. The results indicated the potential of the compound patch.

  3. Characteristic of natural rubber latex-methyl metha-crylate copolymer in mineral lubricant base oil

    International Nuclear Information System (INIS)

    Meri Suhartini; Rahmawati

    2010-01-01

    Natural rubber latex-methyl methacrylate copolymer was diluted in xylene, then diluted in four types of lubricant base oil with concentrations of 0.25%, 1%, 5%, and 10%. The mixed solutions were analyzed to obtain kinematics viscosity, viscosity index, density, ash content, metal content, flash point, shear stability and total alkali number. The viscosity index of sample, increased by adding the copolymer solution. The results showed that lubricant base oil of High Viscosity index (HVI) 60 and mixed HVI 60: HVI 650 gave optimum viscosity index. The higher concentration of polymer added into base lubricant oil, the higher viscosity index obtained. The shear stability test showed that the kinematics viscosity of sample decreased 6.5% after 60 minutes of treatment test. (author)

  4. Production and testing of 244Cm-labeled fluorescent polystyrene latex microspheres

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Mueller, H.L.; Brodbeck, R.D.

    1988-01-01

    To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating 244 Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to μm-size (AMAD) 239 Pu0 2 particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)

  5. Production and testing of {sup 244}Cm-labeled fluorescent polystyrene latex microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Guilmette, R A; Mueller, H L; Brodbeck, R D

    1988-12-01

    To provide a useful tool for studying the mechanisms of retention and translocation of respirable-sized, alpha-emitting particles, we have developed a method of incorporating {sup 244}Cm into fluorescent polystyrene latex microspheres. The resultant particles contain alpha radioactivity comparable to {mu}m-size (AMAD) {sup 239}Pu0{sub 2} particles, but are easily visible by fluorescent light microscopy. Preliminary testing of the particles with dog macrophages in vitro has shown that the initial uptake of these Cm-labeled particles is more rapid than uptake of unlabeled particles of similar size. We are continuing to develop procedures for achieving better particle yields, smaller dispersity of particle size distributions and improved retention of the Cm label by the particles. (author)

  6. Co-coagulation of the NBR latex and clay aqueous suspension: preparation and characterization

    International Nuclear Information System (INIS)

    Reis, Raquel S.; Brum, Elisson; Silva, Vanessa M.; Souza, Diego H.S.; Gomes, Ailton de S.; Nunes, Regina C.R.

    2009-01-01

    Blends of nitrile rubber (NBR) and sodium montmorillonite (MMT-Na) were prepared by co-coagulation of the NBR latex with aqueous suspension of clay. The content of MMT was varied from 0 to 7 phr and different mixtures were analyzed by X-ray diffraction, light scattering, gel content, thermogravimetric analysis and the oscillating disk rheometer. The different methods used indicated that there was formation of a structure interspersed in the mixtures studied, and that increasing the content MMT-Na enhances the values obtained. Rheological measurements on compositions with NBR showed the influence of clay on increasing the time of healing in terms of its content, as is the gel content and the thermal resistance. All results were compared to composition of NBR without MMT. (author)

  7. Fluorescent Labeling and Biodistribution of Latex Nanoparticles Formed by Surfactant-Free RAFT Emulsion Polymerization.

    Science.gov (United States)

    Poon, Cheuk Ka; Tang, Owen; Chen, Xin-Ming; Kim, Byung; Hartlieb, Matthias; Pollock, Carol A; Hawkett, Brian S; Perrier, Sébastien

    2017-10-01

    The authors report the preparation of a novel range of functional polyacrylamide stabilized polystyrene nanoparticles, obtained by surfactant-free reversible addition-fragmentation chain transfer (RAFT) emulsion polymerization, their fluorescent tagging, cellular uptake, and biodistribution. The authors show the versatility of the RAFT emulsion process for the design of functional nanoparticles of well-defined size that can be used as drug delivery vectors. Functionalization with a fluorescent tag offers a useful visualization tool for tracing, localization, and clearance studies of these carriers in biological models. The studies are carried out by labeling the sterically stabilized latex particles chemically with rhodamine B. The fluorescent particles are incubated in a healthy human renal proximal tubular cell line model, and intravenously injected into a mouse model. Cellular localization and biodistribution of these particles on the biological models are explored. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Composite Films Formed by Cellulose nanocrystals and Latex Nanoparticles: Optical, Structural, and Mechanical Properties

    Science.gov (United States)

    Vollick, Brandon McRae

    This thesis describes the preparation of iridescent, birefringent, composite films composed of cellulose nanocrystals (CNCs), latex nanoparticles (NPs) and a NP crosslinker; hexanediamine (HDA). First, aqueous suspensions were prepared with varying quantities of CNCs, NPs and HDA before equilibrating for one week. The cholesteric (Ch) phase was then cast and dried into a film. The optical, structural and mechanical properties of the film was analyzed. Second, films with identical compositions of CNCs, NPs, and HDA were fabricated in three different ways to yield films of different morphology, (i) fast drying of an isotropic suspension, yielding an isotropic film, (ii) slow drying of an isotropic suspension, yielding a partially Ch films, (iii) slow drying of an equilibrated suspension, yielding a highly Ch film. The optical and mechanical properties of the films was analyzed.

  9. Toxicological evaluation of natural rubber latex film vulcanized with ionizing radiation

    International Nuclear Information System (INIS)

    Campos, Vania E.; Higa, Olga Z.; Guedes, Selma M.L.; Hanada, Seico

    1999-01-01

    The industrial vulcanization of natural rubber latex (NRL) is made worldwide by conventional process using sulphur, but it can be made by an alternative process using ionizing radiation. The main advantages of this process are related to absence of toxic effect promoted by chemical substances added to the NRL on the conventional process. In this research was tested the toxicological properties of the films vulcanized by the alternative process in relation to that vulcanized by the conventional process. The toxicity was evaluated by in vitro cytotoxicity assay and in vivo systemic toxicity assay. The results showed that vulcanized films by gamma ray are less cytotoxic. The systemic toxicity assay showed that only the vulcanized film using sulphur induced allaying and motor in coordination on the animals for a short period of time. these results evidence the less cytotoxic properties of vulcanized films by gamma ray in relation to that vulcanized by conventional process using sulphur. (author)

  10. Latex content and biomass increase in Mycorrhizal guayule (Parthenium argentatum) under field conditions

    Energy Technology Data Exchange (ETDEWEB)

    Bloss, H.E.; Pfeiffer, C.M.

    1984-01-01

    Guayule seedlings were inoculated with two Glomus species in pasteurised soil and grown in the glasshouse without added fertilizer for 8 weeks prior to transplanting to the field. The survival rate of transplanted guayule seedlings was increased by inoculation with vesicular arbuscular mycorrhizal fungi compared wtih uninoculated controls. Inoculated guayule had greater concentrations of Ca, Fe, Mg and Mn at six months of age, and greater concentrations of Ca, Mg, and Zn at 12 months of age than did uninoculated plants. The latex content of both roots and shoots of guayule was greater in inoculated than in uninoculated guayule plants at 12 and 18 months of age. The resin content remained unchanged between treatments irrespective of sampling date.

  11. Quality and quantity of latex which can be produced from natural vegetation in Greece

    Energy Technology Data Exchange (ETDEWEB)

    Margaris, N.S.; Vokou, D.; Diamantopoulos, J.

    1985-01-01

    Euphorbiaceae is one of the major latex producing families very promising in terms of exploitation as energy sources. Research in the Greek areas proved that Euphorbia species are very numerous with high contribution in biomass terms in many of them. Provided are data concerning growth characteristics of E. dendroides and E. acanthothamnos to answer the question of the feasibility of harvesting. E. helioscopia is proved to be a very promising species with many ecotypes. Its occurrence and extremely increased growth in olive, almonds, and pear plantations makes it a very important species needing further research to evaluate the possibility of combined cultivation with the above mentioned trees. It is estimated the oil production that such plantations may yield.

  12. Enhancement of sludge granulation in anaerobic treatment of concentrated latex wastewater

    Directory of Open Access Journals (Sweden)

    Nugul Intrasungkha

    2008-04-01

    Full Text Available Recently, the upflow anaerobic sludge blanket (UASB reactor has become attractive for wastewater treatment with low energy requirement and biogas production. However, the start-up of an UASB reactor depends on the formation of granules. Therefore, this research aims to study the effect of AlCl3, CaCl2 and temperature on the granule formation process using real concentrated latex wastewater. The result shows that the optimum chemicals concentration of AlCl3 at 300 mg/l enhanced the biomass accumulation and sludge formation process. Approximately 50% of large granular size (0.5 mm 0.8 mm within 35 days, whereas the large granular sizes in reactorwithout AlCl3 supplement (R2 became visible within 63 days. Moreover, this experiment found that R1, R2 and R3 could reach steady state within 40, 55 and 45 days, respectively.

  13. Finite Element Analysis of Simple Rectangular Microstrip Sensor for Determination Moisture Content of Hevea Rubber Latex

    Science.gov (United States)

    Yahaya, NZ; Ramli, MR; Razak, NNANA; Abbas, Z.

    2018-04-01

    The Finite Element Method, FEM has been successfully used to model a simple rectangular microstrip sensor to determine the moisture content of Hevea rubber latex. The FEM simulation of sensor and samples was implemented by using COMSOL Multiphysics software. The simulation includes the calculation of magnitude and phase of reflection coefficient and was compared to analytical method. The results show a good agreement in finding the magnitude and phase of reflection coefficient when compared with analytical results. Field distributions of both the unloaded sensor as well as the sensor loaded with different percentages of moisture content were visualized using FEM in conjunction with COMSOL software. The higher the amount of moisture content in the sample the more the electric loops were observed.

  14. Ficus carica latex prevents invasion through induction of let-7d expression in GBM cell lines.

    Science.gov (United States)

    Tezcan, Gulcin; Tunca, Berrin; Bekar, Ahmet; Yalcin, Murat; Sahin, Saliha; Budak, Ferah; Cecener, Gulsah; Egeli, Unal; Demir, Cevdet; Guvenc, Gokcen; Yilmaz, Gozde; Erkan, Leman Gizem; Malyer, Hulusi; Taskapilioglu, Mevlut Ozgur; Evrensel, Turkkan; Bilir, Ayhan

    2015-03-01

    Glioblastoma multiforme (GBM) is one of the deadliest human malignancies. A cure for GBM remains elusive, and the overall survival time is less than 1 year. Thus, the development of more efficient therapeutic approaches for the treatment of these patients is required. Induction of tumor cell death by certain phytochemicals derived from medicinal herbs and dietary plants has become a new frontier for cancer therapy research. Although the cancer suppressive effect of Ficus carica (fig) latex (FCL) has been determined in a few cancer types, the effect of this latex on GBM tumors has not been investigated. Therefore, in the current study, the anti-proliferative activity of FCL and the effect of the FCL-temozolomide (TMZ) combination were tested in the T98G, U-138 MG, and U-87 MG GBM cell lines using the WST-1 assay. The mechanism of cell death was analyzed using Annexin-V/FITC and TUNEL assays, and the effect of FCL on invasion was tested using the chick chorioallantoic membrane assay. To determine the effect of FCL on GBM progression, the expression levels of 40 GBM associated miRNAs were analyzed in T98G cells using RT-qPCR. According to the obtained data, FCL causes cell death in GBM cells with different responses to TMZ, and this effect is synergistically increased in combination with TMZ. In addition, the current study is the first to demonstrate the effect of FCL on modulation of let-7d expression, which may be an important underlying mechanism of the anti-invasive effect of this extract.

  15. The Latex Protein MLX56 from Mulberry (Morus multicaulis Protects Plants against Insect Pests and Pathogens

    Directory of Open Access Journals (Sweden)

    Ying-Ping Gai

    2017-08-01

    Full Text Available Biotic stresses are major constraints limiting the leaf quality and productivity of mulberry. MLX56 is a unique chitin-binding protein isolated from Shin-Ichinose (Morus alba latex that displays toxicity against lepidopteran caterpillars. In this study, the full-length cDNA encoding MLX56 was isolated from Husang 32 (M. multicaulis and designated HMLX56. Amino acid sequence analysis and protein modeling of three MLX56 proteins showed that they were highly conserved among Morus species. Tissue expression pattern analysis showed that the HMLX56 gene was strongly expressed in mulberry bark and leaves but only slightly expressed in fruits. In addition, analysis of GUS expression indicated that the promoter of HMLX56 showed higher transcriptional activity along the vascular strands, and its activity can be regulated by various environmental factors. Like the MLX56 protein from M. alba, the HMLX56 protein showed toxicity to Plutella xylostella. Moreover, when the HMLX56 gene was ectopically expressed in Arabidopsis, the transgenic plants showed enhanced resistance to aphids, the fungal pathogen Botrytis cinerea and the bacterial pathogen Pseudomonas syringae pv. tomato DC3000. Our data suggest that the HMLX56 protein has a lectin-like molecular structure consisting of two hevein-like chitin-binding domains which provide not only chitin-binding activities but also other mechanisms of defense. The information provided here improves our understanding of the potential functions and defense mechanisms of MLX56 proteins, enabling in-depth functional analysis of latex exudates and perhaps facilitating mulberry genetic improvement in the future.

  16. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  17. Thermal-kinetic study of natural rubber latex films vulcanized by using gamma radiation; Estudo termo-cinetico de filmes de latex de borracha natural de Hevea brasiliensis vulcanizada por radiacao gama

    Energy Technology Data Exchange (ETDEWEB)

    Leal, Ana Paula Pinho Rodrigues; Barros, Glaucione Gomes de [Brasilia Univ., DF (Brazil). Inst. de Quimica; Guedes, Selma M.L. [Instituto de Pesquisa em Energia Nuclear, Sao Paulo, SP (Brazil)

    1999-07-01

    Vulcanization of natural rubber latex by ionization radiation produces the crosslink in disperse latex particles. Advantages over conventional process of vulcanization are: the absence of carcinogenic nitrosamines, low cytotoxicity and better degradation at room conditions, due to mainly to the absence of sulfur, zinc oxide and dithiocarbamates. Thermogravimetric analysis (TG) is the measurement of the weight change of a material as a function of temperature and time. TG data different heat speed provide an alternative model of the kinetics of degradation of polymeric materials. The kinetic studies of this material showed a single degradation process at least for 76,5% of mass loss. The activation energy was 49 Kcal/mol. For higher mass loss (85%) the degradation was characterized by associate mechanism. (author)

  18. Antifungal Activity of Leaf and Latex Extracts of Calotropis procera (Ait.) against Dominant Seed-Borne Storage Fungi of Some Oil Seeds

    OpenAIRE

    Manoorkar V B; Mandge S V; B D Gachande

    2015-01-01

    In present study, aqueous and ethanol extracts of leaf & latex of Calotropis procera (Ait.) was tested for their antifungal activity against dominant storage seed-borne fungi of some oil seeds such as groundnut, soybean, sunflower and mustard. The antifungal effect of ethanol and aqueous extracts of leaf & latex of Calotropis procera (Ait.) against ten seed-borne dominant fungi viz., Cuvularia lunata, Alternaria alternata, Rhizoctonia solani, Fusarium solani, Penicillium chrysogenum, Asperg...

  19. Strengths-based Learning

    DEFF Research Database (Denmark)

    Ledertoug, Mette Marie

    -being. The Ph.D.-project in Strength-based learning took place in a Danish school with 750 pupils age 6-16 and a similar school was functioning as a control group. The presentation will focus on both the aware-explore-apply processes and the practical implications for the schools involved, and on measurable......Strength-based learning - Children͛s Character Strengths as Means to their Learning Potential͛ is a Ph.D.-project aiming to create a strength-based mindset in school settings and at the same time introducing strength-based interventions as specific tools to improve both learning and well...

  20. 15-demethylisoplumieride acid, a new iridoid isolated from the bark of Plumeria rubra and latex of Himatanthus sucuuba; Acido 15-desmetilisoplumierideo, um novo iridoide isolado das cascas de Plumeria rubra e do latex de Himatanthus sucuuba

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, Alaide de Sa; Amaral, Ana Claudia F. [Fundacao Inst. Oswaldo Cruz (FIOCRUZ), Rio de Janeiro, RJ (Brazil). Instituto de Tecnologia em Farmacos -Farmanguinhos. Lab. de Plantas Medicinais e Derivados; Silva, Jefferson Rocha de A. [Universidade Federal do Amazonas, Manaus, AM (Brazil). Dept. de Quimica]. E-mail: jrocha_01@ufam.edu.br; Schripsema, Jan [Universidade Estadual do Norte Fluminense (UENF), Campos dos Goytacazes, RJ (Brazil). Setor de Quimica de Produtos Naturais; Rezende, Claudia M.; Pinto, Angelo C. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Inst. de Quimica

    2007-09-15

    Himatanthus sucuuba and Plumeria rubra are used in folk medicine in Brazil to treat various ailments. The isolation of the new iridoid 15-demethylisoplumieride from the bark of Plumeria rubra L. var. acutifolia (Ait) Woodson and latex of Himatanthus sucuuba (Spruce) Woodson is reported. Other iridoid glycosides were obtained from both plants. The structures of these substances were elucidated by spectral analysis and comparison with data already reported. (author)