Blockface histology with optical coherence tomography: a comparison with Nissl staining.

Science.gov (United States)

Magnain, Caroline; Augustinack, Jean C; Reuter, Martin; Wachinger, Christian; Frosch, Matthew P; Ragan, Timothy; Akkin, Taner; Wedeen, Van J; Boas, David A; Fischl, Bruce

2014-01-01

Spectral domain optical coherence tomography (SD-OCT) is a high resolution imaging technique that generates excellent contrast based on intrinsic optical properties of the tissue, such as neurons and fibers. The SD-OCT data acquisition is performed directly on the tissue block, diminishing the need for cutting, mounting and staining. We utilized SD-OCT to visualize the laminar structure of the isocortex and compared cortical cytoarchitecture with the gold standard Nissl staining, both qualitatively and quantitatively. In histological processing, distortions routinely affect registration to the blockface image and prevent accurate 3D reconstruction of regions of tissue. We compared blockface registration to SD-OCT and Nissl, respectively, and found that SD-OCT-blockface registration was significantly more accurate than Nissl-blockface registration. Two independent observers manually labeled cortical laminae (e.g. III, IV and V) in SD-OCT images and Nissl stained sections. Our results show that OCT images exhibit sufficient contrast in the cortex to reliably differentiate the cortical layers. Furthermore, the modalities were compared with regard to cortical laminar organization and showed good agreement. Taken together, these SD-OCT results suggest that SD-OCT contains information comparable to standard histological stains such as Nissl in terms of distinguishing cortical layers and architectonic areas. Given these data, we propose that SD-OCT can be used to reliably generate 3D reconstructions of multiple cubic centimeters of cortex that can be used to accurately and semi-automatically perform standard histological analyses. © 2013.

Intramacrophage survival of uropathogenic Escherichia coli: Differences between diverse clinical isolates and between mouse and human macrophages

KAUST Repository

Bokil, Nilesh J.; Totsika, Makrina; Carey, Alison J.; Stacey, Katryn J.; Hancock, Viktoria; Saunders, Bernadette M.; Ravasi, Timothy; Ulett, Glen C.; Schembri, Mark A.; Sweet, Matthew J.

2011-01-01

within the host. Given that many intracellular pathogens target macrophages, we assessed the interactions between UPEC and macrophages. Colonization of the mouse bladder by UPEC strain CFT073 resulted in increased expression of myeloid-restricted genes

CFT duals for extreme black holes

International Nuclear Information System (INIS)

Hartman, Thomas; Strominger, Andrew; Murata, Keiju; Nishioka, Tatsuma

2009-01-01

It is argued that the general four-dimensional extremal Kerr-Newman-AdS-dS black hole is holographically dual to a (chiral half of a) two-dimensional CFT, generalizing an argument given recently for the special case of extremal Kerr. Specifically, the asymptotic symmetries of the near-horizon region of the general extremal black hole are shown to be generated by a Virasoro algebra. Semiclassical formulae are derived for the central charge and temperature of the dual CFT as functions of the cosmological constant, Newton's constant and the black hole charges and spin. We then show, assuming the Cardy formula, that the microscopic entropy of the dual CFT precisely reproduces the macroscopic Bekenstein-Hawking area law. This CFT description becomes singular in the extreme Reissner-Nordstrom limit where the black hole has no spin. At this point a second dual CFT description is proposed in which the global part of the U(1) gauge symmetry is promoted to a Virasoro algebra. This second description is also found to reproduce the area law. Various further generalizations including higher dimensions are discussed.

AdS/CFT duality user guide

CERN Document Server

Natsuume, Makoto

2015-01-01

This book describes applications of the AdS/CFT duality to the "real world." The AdS/CFT duality is an idea that originated from string theory and is a powerful tool for analyzing strongly-coupled gauge theories using classical gravitational theories. In recent years, it has been shown that one prediction of AdS/CFT is indeed close to the experimental result of the real quark–gluon plasma. Since then, the AdS/CFT duality has been applied to various fields of physics; examples are QCD, nuclear physics, condensed-matter physics, and nonequilibrium physics.   The aim of this book is to provide background materials such as string theory, black holes, nuclear physics, condensed-matter physics, and nonequilibrium physics as well as key applications of the AdS/CFT duality in a single volume. The emphasis throughout the book is on a pedagogical and intuitive approach focusing on the underlying physical concepts. It also includes step-by-step computations for important results, which are useful for beginners.   Th...

Hepcidin as a Major Component of Renal Antibacterial Defenses against Uropathogenic Escherichia coli

Science.gov (United States)

Houamel, Dounia; Ducrot, Nicolas; Lefebvre, Thibaud; Daher, Raed; Moulouel, Boualem; Sari, Marie-Agnes; Letteron, Philippe; Lyoumi, Said; Millot, Sarah; Tourret, Jerome; Bouvet, Odile; Vaulont, Sophie; Vandewalle, Alain; Denamur, Erick; Puy, Hervé; Beaumont, Carole; Gouya, Laurent

2016-01-01

The iron-regulatory peptide hepcidin exhibits antimicrobial activity. Having previously shown hepcidin expression in the kidney, we addressed its role in urinary tract infection (UTI), which remains largely unknown. Experimental UTI was induced in wild-type (WT) and hepcidin-knockout (Hepc−/−) mice using the uropathogenic Escherichia coli CFT073 strain. Compared with infected WT mice, infected Hepc−/− mice showed a dramatic increase in renal bacterial load. Moreover, bacterial invasion was significantly dampened by the pretreatment of WT mice with hepcidin. Infected Hepc−/− mice exhibited decreased iron accumulation in the renal medulla and significant attenuation of the renal inflammatory response. Notably, we demonstrated in vitro bacteriostatic activity of hepcidin against CFT073. Furthermore, CFT073 repressed renal hepcidin, both in vivo and in cultured renal cells, and reduced phosphorylation of SMAD kinase in vivo, suggesting a bacterial strategy to escape the antimicrobial activities of hepcidin. In conclusion, we provide new mechanisms by which hepcidin contributes to renal host defense and suggest that targeting hepcidin offers a strategy to prevent bacterial invasion. PMID:26293821

Metabolic Modeling of Common Escherichia coli Strains in Human Gut Microbiome

Directory of Open Access Journals (Sweden)

Yue-Dong Gao

2014-01-01

Full Text Available The recent high-throughput sequencing has enabled the composition of Escherichia coli strains in the human microbial community to be profiled en masse. However, there are two challenges to address: (1 exploring the genetic differences between E. coli strains in human gut and (2 dynamic responses of E. coli to diverse stress conditions. As a result, we investigated the E. coli strains in human gut microbiome using deep sequencing data and reconstructed genome-wide metabolic networks for the three most common E. coli strains, including E. coli HS, UTI89, and CFT073. The metabolic models show obvious strain-specific characteristics, both in network contents and in behaviors. We predicted optimal biomass production for three models on four different carbon sources (acetate, ethanol, glucose, and succinate and found that these stress-associated genes were involved in host-microbial interactions and increased in human obesity. Besides, it shows that the growth rates are similar among the models, but the flux distributions are different, even in E. coli core reactions. The correlations between human diabetes-associated metabolic reactions in the E. coli models were also predicted. The study provides a systems perspective on E. coli strains in human gut microbiome and will be helpful in integrating diverse data sources in the following study.

The carbon storage regulator (Csr) system exerts a nutrient-specific control over central metabolism in Escherichia coli strain Nissle 1917.

Science.gov (United States)

Revelles, Olga; Millard, Pierre; Nougayrède, Jean-Philippe; Dobrindt, Ulrich; Oswald, Eric; Létisse, Fabien; Portais, Jean-Charles

2013-01-01

The role of the post-transcriptional carbon storage regulator (Csr) system in nutrient utilization and in the control of the central metabolism in E. coli reference commensal strain Nissle 1917 was investigated. Analysis of the growth capabilities of mutants altered for various components of the Csr system (csrA51, csrB, csrC and csrD mutations) showed that only the protein CsrA - the key component of the system - exerts a marked role in carbon nutrition. Attenuation of CsrA activity in the csrA51 mutant affects the growth efficiency on a broad range of physiologically relevant carbon sources, including compounds utilized by the Entner-Doudoroff (ED) pathway. Detailed investigations of the metabolomes and fluxomes of mutants and wild-type cells grown on carbon sources representative of glycolysis and of the ED pathway (glucose and gluconate, respectively), revealed significant re-adjusting of central carbon metabolism for both compounds in the csrA51 mutant. However, the metabolic re-adjusting observed on gluconate was strikingly different from that observed on glucose, indicating a nutrient-specific control of metabolism by the Csr system.

Inflation in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Freivogel, Ben; /Stanford U., Phys. Dept. /LBL, Berkeley; Hubeny, Veronika E.; /LBL, Berkeley /Durham U., Dept. of Math.; Maloney, Alexander; /Stanford U., Phys. Dept.; Myers, Rob; /Perimeter Inst. Theor. Phys. /Waterloo U.; Rangamani, Mukund; /LBL, Berkeley /Durham U., Dept. of Math.; Shenker, Stephen; /Stanford U., Phys. Dept.

2005-10-07

We study the realization of inflation within the AdS/CFT correspondence. We assume the existence of a string landscape containing at least one stable AdS vacuum and a (nearby) metastable de Sitter state. Standard arguments imply that the bulk physics in the vicinity of the AdS minimum is described by a boundary CFT. We argue that large enough bubbles of the dS phase, including those able to inflate, are described by mixed states in the CFT. Inflating degrees of freedom are traced over and do not appear explicitly in the boundary description. They nevertheless leave a distinct imprint on the mixed state. Analytic continuation allows us, in principle, to recover a large amount of nonperturbatively defined information about the inflating regime. Our work also shows that no scattering process can create an inflating region, even by quantum tunneling, since a pure state can never evolve into a mixed state under unitary evolution.We study the realization of inflation within the AdS/CFT correspondence. We assume the existence of a string landscape containing at least one stable AdS vacuum and a (nearby) metastable de Sitter state. Standard arguments imply that the bulk physics in the vicinity of the AdS minimum is described by a boundary CFT. We argue that large enough bubbles of the dS phase, including those able to inflate, are described by mixed states in the CFT. Inflating degrees of freedom are traced over and do not appear explicitly in the boundary description. They nevertheless leave a distinct imprint on the mixed state. Analytic continuation allows us, in principle, to recover a large amount of nonperturbatively defined information about the inflating regime. Our work also shows that no scattering process can create an inflating region, even by quantum tunneling, since a pure state can never evolve into a mixed state under unitary evolution.

Intramacrophage survival of uropathogenic Escherichia coli: Differences between diverse clinical isolates and between mouse and human macrophages

KAUST Repository

Bokil, Nilesh J.

2011-11-01

Uropathogenic E. coli (UPEC) are the primary cause of urinary tract infections. Recent studies have demonstrated that UPEC can invade and replicate within epithelial cells, suggesting that this bacterial pathogen may occupy an intracellular niche within the host. Given that many intracellular pathogens target macrophages, we assessed the interactions between UPEC and macrophages. Colonization of the mouse bladder by UPEC strain CFT073 resulted in increased expression of myeloid-restricted genes, consistent with the recruitment of inflammatory macrophages to the site of infection. In in vitro assays, CFT073 was able to survive within primary mouse bone marrow-derived macrophages (BMM) up to 24h post-infection. Three additional well-characterized clinical UPEC isolates associated with distinct UTI symptomatologies displayed variable long-term survival within BMM. UPEC strains UTI89 and VR50, originally isolated from patients with cystitis and asymptomatic bacteriuria respectively, showed elevated bacterial loads in BMM at 24h post-infection as compared to CFT073 and the asymptomatic bacteriuria strain 83972. These differences did not correlate with differential effects on macrophage survival or initial uptake of bacteria. E. coli UTI89 localized to a Lamp1 + vesicular compartment within BMM. In contrast to survival within mouse BMM, intracellular bacterial loads of VR50 were low in both human monocyte-derived macrophages (HMDM) and in human T24 bladder epithelial cells. Collectively, these data suggest that some UPEC isolates may subvert macrophage anti-microbial pathways, and that host species differences may impact on intracellular UPEC survival. © 2011 Elsevier GmbH.

Efficacy of Probiotic Escherichia coli Nissle 1917 in Patients with Irritable Bowel Syndrome: a Double Blind Placebocontrolled Randomized Trial

Directory of Open Access Journals (Sweden)

Amir H Faghihi

2015-07-01

Full Text Available Aim: to evaluate potential improvement effect for probiotic E. coliNissle 1917 in the management of refractory IBS in an Iranian population. Methods: a double blind placebo controlled approach as been used in the current clinical trial. 139 confirmed IBS patients were included into the study, and were given probiotic E.coli Nissle 1917 for 6 weeks. 11 items Birmingham IBS Symptom Questionnairehas been used for evaluation of changes in the symptoms every 2 weeks. Results: sixty eight subjects (49% were males. Mean±SD age of the participants was 38±13.3 years. 49(35.3% of the patients were diarrhea-predominant. The total scores showed no significant difference between the intervention vs. control group(-6.7±6.8 vs. -6.7±6.5, respectively; p=0.95; neither did any of the questionnaire items any significant alterations in the two groups. After stratification of patients based on their IBS type, diarrhea-predominant patients showed a positive response to the probiotic improving their sleep (p=0.05&0.03 at weeks 2&6, respectively. Patients with constipation-predominant IBS showed no response to the probiotic; while patients with diarrhea-constipation mixed IBS showed unfavorable response to the probiotic in the need for strain to pass a motion compared to the placebo (p=0.03&0.02 at weeks 4&6, respectively. Conclusion: probiotic therapy with E.coliNissle 1917 was not able to induce significant improvement in the symptoms of patients with non-categorized IBS. Nevertheless, when IBS patients were recategorized to subgroups according to their main symptoms, evaluation of the efficacy of the probiotic on some individual items in the symptom list reached the significance level. Prospective clinical trials are recommended to confirm our findings. Key words: probiotic Escherichia Coli Nissle 1917, irritable bowel syndrome, double blind randomized controlled trial.

Prototype for dS/CFT correspondence

International Nuclear Information System (INIS)

Gueijosa, Alberto; Lowe, David A.; Murugan, Jeff

2005-01-01

We consider dS 2 /CFT 1 where the asymptotic symmetry group of the de Sitter spacetime contains the Virasoro algebra. We construct representations of the Virasoro algebra realized in the Fock space of a massive scalar field in de Sitter space, built as excitations of the Euclidean vacuum state. These representations are unitary, without highest weight, and have vanishing central charge. They provide a prototype for a new class of conformal field theories dual to de Sitter backgrounds in string theory. The mapping of operators in the CFT to bulk quantities is described in detail. We comment on the extension to dS 3 /CFT 2

Dopamine transporter binding in rat striatum: a comparison of [O-methyl-{sup 11}C]{beta}-CFT and [N-methyl-{sup 11}C]{beta}-CFT

Energy Technology Data Exchange (ETDEWEB)

Yoder, Karmen K.; Hutchins, Gary D.; Mock, Bruce H.; Fei, Xiangshu; Winkle, Wendy L. [Department of Radiology, Indiana University School of Medicine, L3-208, Indianapolis, IN 46202 (United States); Gitter, Bruce D.; Territo, Paul R. [Lilly Center for Anatomical and Molecular Imaging, Integrative Biology Division, Lilly Research Laboratories, Greenfield, IN 46140 (United States); Zheng Qihuang [Department of Radiology, Indiana University School of Medicine, L3-208, Indianapolis, IN 46202 (United States)], E-mail: qzheng@iupui.edu

2009-01-15

Introduction: Positron emission tomography scanning with radiolabeled phenyltropane cocaine analogs is important for quantifying the in vivo density of monoamine transporters, including the dopamine transporter (DAT). [{sup 11}C]{beta}-CFT is useful for studying DAT as a marker of dopaminergic innervation in animal models of psychiatric and neurological disorders. [{sup 11}C]{beta}-CFT is commonly labeled at the N-methyl position. However, labeling of [{sup 11}C]{beta}-CFT at the O-methyl position is a simpler procedure and results in a shorter synthesis time [desirable in small-animal studies, where specific activity (SA) is crucial]. In this study, we sought to validate that the O-methylated form of [{sup 11}C]{beta}-CFT provides equivalent quantitative results to that of the more commonly reported N-methyl form. Methods: Four female Sprague-Dawley rats were scanned twice on the IndyPET II small-animal scanner, once with [N-methyl-{sup 11}C]{beta}-CFT and once with [O-methyl-{sup 11}C]{beta}-CFT. DAT binding potentials (BP{identical_to}B'{sub avail}/K{sub d}) were estimated for right and left striata with a nonlinear least-squares algorithm, using a reference region (cerebellum) as the input function. Results: [N-Methyl-{sup 11}C]{beta}-CFT and [O-methyl-{sup 11}C]{beta}-CFT were synthesized with 40-50% radiochemical yields (HPLC purification). Radiochemical purity was >99%. SA at end of bombardment was 258{+-}30 GBq/{mu}mol. Average BP values for right and left striata with [N-methyl-{sup 11}C]{beta}-CFT were 1.16{+-}0.08 and 1.23{+-}0.14, respectively. BP values for [O-methyl-{sup 11}C]{beta}-CFT were 1.18{+-}0.08 (right) and 1.22{+-}0.16 (left). Paired t tests demonstrated that labeling position did not affect striatal DAT BP. Conclusions: These results suggest that [O-methyl-{sup 11}C]{beta}-CFT is quantitatively equivalent to [N-methyl-{sup 11}C]{beta}-CFT in the rat striatum.

ADS/CFT and QCD

International Nuclear Information System (INIS)

Brodsky, Stanley J.; de Teramond, Guy F.

2007-01-01

The AdS/CFT correspondence between string theory in AdS space and conformal .eld theories in physical spacetime leads to an analytic, semi-classical model for strongly-coupled QCD which has scale invariance and dimensional counting at short distances and color confinement at large distances. Although QCD is not conformally invariant, one can nevertheless use the mathematical representation of the conformal group in five-dimensional anti-de Sitter space to construct a first approximation to the theory. The AdS/CFT correspondence also provides insights into the inherently non-perturbative aspects of QCD, such as the orbital and radial spectra of hadrons and the form of hadronic wavefunctions. In particular, we show that there is an exact correspondence between the fifth-dimensional coordinate of AdS space z and a specific impact variable ζ which measures the separation of the quark and gluonic constituents within the hadron in ordinary space-time. This connection allows one to compute the analytic form of the frame-independent light-front wavefunctions, the fundamental entities which encode hadron properties and allow the computation of decay constants, form factors, and other exclusive scattering amplitudes. New relativistic lightfront equations in ordinary space-time are found which reproduce the results obtained using the 5-dimensional theory. The effective light-front equations possess remarkable algebraic structures and integrability properties. Since they are complete and orthonormal, the AdS/CFT model wavefunctions can also be used as a basis for the diagonalization of the full light-front QCD Hamiltonian, thus systematically improving the AdS/CFT approximation

CFT and topological recursion

CERN Document Server

Kostov, Ivan

2010-01-01

We study the quasiclassical expansion associated with a complex curve. In a more specific context this is the 1/N expansion in U(N)-invariant matrix integrals. We compare two approaches, the CFT approach and the topological recursion, and show their equivalence. The CFT approach reformulates the problem in terms of a conformal field theory on a Riemann surface, while the topological recursion is based on a recurrence equation for the observables representing symplectic invariants on the complex curve. The two approaches lead to two different graph expansions, one of which can be obtained as a partial resummation of the other.

Effective AdS/renormalized CFT

OpenAIRE

Fan, JiJi

2011-01-01

For an effective AdS theory, we present a simple prescription to compute the renormalization of its dual boundary field theory. In particular, we define anomalous dimension holographically as the dependence of the wave-function renormalization factor on the radial cutoff in the Poincare patch of AdS. With this definition, the anomalous dimensions of both single- and double- trace operators are calculated. Three different dualities are considered with the field theory being CFT, CFT with a dou...

THE NISSL SUBSTANCE OF LIVING AND FIXED SPINAL GANGLION CELLS

Science.gov (United States)

Deitch, Arline D.; Moses, Montrose J.

1957-01-01

Living chick spinal ganglion neurons grown for 19 to 25 days in vitro were photographed with a color-translating ultraviolet microscope (UV-91) at 265, 287, and 310 mµ. This instrument was unique in permitting rapid accumulation of ultraviolet information with minimal damage to the cell. In the photographs taken at 265 mµ of the living neurons, discrete ultraviolet-absorbing cytoplasmic masses were observed which were found to be virtually unchanged in appearance after formalin fixation. These were identical with the Nissl bodies of the same cells seen after staining with basic dyes. The correlation of ultraviolet absorption, ribonuclease extraction, and staining experiments with acid and basic dyes confirmed the ribonucleoprotein nature of these Nissl bodies in the living and fixed cells. No change in distribution or concentration of ultraviolet-absorbing substance was observed in the first 12 ultraviolet photographs of a neuron, and it is concluded that the cells had not been subjected to significant ultraviolet damage during the period of photography. On the basis of these observations, as well as previous findings with phase contrast microscopy, it is concluded that Nissl bodies preexist in the living neuron as discrete aggregates containing high concentrations of nucleoprotein. PMID:13438929

Fermions in nonrelativistic AdS/CFT correspondence

International Nuclear Information System (INIS)

Akhavan, Amin; Alishahiha, Mohsen; Davody, Ali; Vahedi, Ali

2009-01-01

We extend the nonrelativistic AdS/CFT correspondence to the fermionic fields. In particular, we study the two point function of a fermionic operator in nonrelativistic CFTs by making use of a massive fermion propagating in geometries with Schroedinger group isometry. Although the boundary of the geometries with Schroedinger group isometry differ from that in AdS geometries where the dictionary of AdS/CFT is established, using the general procedure of AdS/CFT correspondence, we see that the resultant two point function has the expected form for fermionic operators in nonrelativistic CFTs, though a nontrivial regularization may be needed.

CFT13

DEFF Research Database (Denmark)

Carl, Michael; Martinez, Mercedes Garcia; Mesa-Lao, Bartolomé

2014-01-01

This paper describes the most recent dataset that has been added to the CRITT Translation Process Research Database (TPR-DB). Under the name CFT13, this new study contains user activity data (UAD) in the form of key-logging and eye-tracking collected during the second CasMaCat field trial in June...

The inside outs of AdS{sub 3}/CFT{sub 2}: exact AdS wormholes with entangled CFT duals

Energy Technology Data Exchange (ETDEWEB)

Mandal, Gautam; Sinha, Ritam; Sorokhaibam, Nilakash [Department of Theoretical Physics, Tata Institute of Fundamental Research,Mumbai 400005 (India)

2015-01-09

We present the complete family of solutions of 3D gravity (Λ<0) with two asymptotically AdS exterior regions. The solutions are constructed from data at the two boundaries, which correspond to two independent and arbitrary stress tensors T{sub R},T-bar{sub R}, and T{sub L},T-bar{sub L}. The two exteriors are smoothly joined on to an interior region through a regular horizon. We find CFT duals of these geometries which are entangled states of two CFT’s. We compute correlators between general operators at the two boundaries and find perfect agreement between CFT and bulk calculations. We calculate and match the CFT entanglement entropy (EE) with the holographic EE which involves geodesics passing through the wormhole. We also compute a holographic, non-equilibrium entropy for the CFT using properties of the regular horizon. The construction of the bulk solutions here uses an exact version of Brown-Henneaux type diffeomorphisms which are asymptotically nontrivial and transform the CFT states by two independent unitary operators on the two sides. Our solutions provide an infinite family of explicit examples of the ER=EPR relation of Maldacena and Susskind http://dx.doi.org/10.1002/prop.201300020.

Firewalls in AdS/CFT

Science.gov (United States)

Avery, Steven G.; Chowdhury, Borun D.

2014-10-01

Several recent papers argue against firewalls by relaxing the requirement for locality outside the stretched horizon. In the firewall argument, locality essentially serves the purpose of ensuring that the degrees of freedom required for infall are those in the proximity of the black hole and not the ones in the early radiation. We make the firewall argument sharper by utilizing the AdS/CFT framework and claim that the firewall argument essentially states that the dual to a thermal state in the CFT is a firewall.

Immunocytochemical detection of astrocytes in brain slices in combination with Nissl staining.

Science.gov (United States)

Korzhevskii, D E; Otellin, V A

2005-07-01

The present study was performed to develop a simple and reliable method for the combined staining of specimens to allow the advantages of immunocytochemical detection of astrocytes and assessment of the functional state of neurons by the Nissl method to be assessed simultaneously. The protocol suggested for processing paraffin sections allows preservation of tissue structure at high quality and allows the selective identification of astrocytes with counterstaining of neurons by the Nissl method. The protocol can be used without modification for processing brain specimens from humans and various mammals--except mice and rabbits.

Higher spin realization of the DS/CFT correspondence

International Nuclear Information System (INIS)

Anninos, Dionysios; Hartman, Thomas; Strominger, Andrew

2017-01-01

We conjecture that Vasiliev’s theory of higher spin gravity in four-dimensional de Sitter space (dS 4 ) is holographically dual to a three-dimensional conformal field theory (CFT 3 ) living on the spacelike boundary of dS 4 at future timelike infinity. The CFT 3 is the Euclidean Sp ( N ) vector model with anticommuting scalars. The free CFT 3 flows under a double-trace deformation to an interacting CFT 3 in the IR. We argue that both CFTs are dual to Vasiliev dS 4 gravity but with different future boundary conditions on the bulk scalar field. Our analysis rests heavily on analytic continuations of bulk and boundary correlators in the proposed duality relating the O ( N ) model with Vasiliev gravity in AdS 4 . (paper)

[Immunocytochemical demonstration of astrocytes in brain sections combined with Nissl staining].

Science.gov (United States)

Korzhevskiĭ, D E; Otellin, V A

2004-01-01

The aim of the present study was to develop an easy and reliable protocol of combined preparation staining, which would unite the advantages of immunocytochemical demonstration of astrocytes with the availability to evaluate functional state of neurons provided by Nissl technique. The presented protocol of paraffin sections processing allows to retain high quality of tissue structure and provides for selective demonstration of astrocytes using the monoclonal antibodies against glial fibrillary acidic protein and contrast Nissl staining of cells. The protocol can be used without any changes for processing of brain sections obtained from the humans and other mammals with the exception of mice and rabbits.

Calbindin-D28k is a more reliable marker of human Purkinje cells than standard Nissl stains: a stereological experiment.

Science.gov (United States)

Whitney, Elizabeth R; Kemper, Thomas L; Rosene, Douglas L; Bauman, Margaret L; Blatt, Gene J

2008-02-15

In a study of human Purkinje cell (PC) number, a striking mismatch between the number of PCs observed with the Nissl stain and the number of PCs immunopositive for calbindin-D28k (CB) was identified in 2 of the 10 brains examined. In the remaining eight brains this mismatch was not observed. Further, in these eight brains, analysis of CB immunostained sections counterstained with the Nissl stain revealed that more than 99% Nissl stained PCs were also immunopositive for CB. In contrast, in the two discordant brains, only 10-20% of CB immunopositive PCs were also identified with the Nissl stain. Although this finding was unexpected, a historical survey of the literature revealed that Spielmeyer [Spielmeyer W. Histopathologie des nervensystems. Julius Springer: Berlin; 1922. p. 56-79] described human cases with PCs that lacked the expected Nissl staining intensity, an important historical finding and critical issue when studying postmortem human brains. The reason for this failure in Nissl staining is not entirely clear, but it may result from premortem circumstances since it is not accounted for by postmortem delay or processing variables. Regardless of the exact cause, these observations suggest that Nissl staining may not be a reliable marker for PCs and that CB is an excellent alternative marker.

Scaling dimensions in hidden Kerr/CFT correspondence

International Nuclear Information System (INIS)

Lowe, David A.; Messamah, Ilies; Skanata, Antun

2011-01-01

It has been proposed that a hidden conformal field theory (CFT) governs the dynamics of low frequency scattering in a general Kerr black hole background. We further investigate this correspondence by mapping higher order corrections to the massless wave equations in a Kerr background to an expansion within the CFT in terms of higher dimension operators. This implies the presence of infinite towers of CFT primary operators with positive conformal dimensions compatible with unitarity. The exact Kerr background softly breaks the conformal symmetry and the scaling dimensions of these operators run with frequency. The scale-invariant fixed point is dual to a degenerate case of flat spacetime.

Introduction to the AdS/CFT correspondence

NARCIS (Netherlands)

de Boer, J.; Baulieu, L.; Benakli, K.; Douglas, M.R.; Mansoulié, B.; Rabinovici, E.; Cugliandolo, L.F.

2015-01-01

This chapter provides a summary of some of the most important aspects of the AdS/CFT correspondence, together with pointers to some of the vast number of papers that have been published on this subject. The AdS/CFT correspondence is one of the most exciting discoveries in theoretical physics of the

Demonstration of lipofuscin and Nissl bodies in crystal violet stained sections using a fluorescence technique or pyronin Y stain.

Science.gov (United States)

Terr, L I

1986-09-01

This paper presents two simple, reliable methods for identification of lipofuscin and Nissl bodies in the same section. One method shows that lipofuscin stained with crystal violet retains its ability to fluoresce and can be observed under the fluorescence microscope after the stain has faded. Fading is accompanied by a gradual increase in the intensity of the fluorescence and is complete in about 5 min. Exciting illumination from this part of the spectrum also substantially fades staining of other autofluorescing tissue elements, such as lipids. Nonfluorescing structures, such as Nissl bodies, remain stained. By changing from transillumination with tungsten light to epifluorescent illumination and vice versa, both types of structures--Nissl bodies and lipofuscin--can be identified in the same section. The second technique uses pyronin Y for staining Nissl bodies in preparations previously stained with crystal violet. Nissl bodies are stained pink but lipofuscin remains violet. Lipofuscin in these sections also remains autofluorescent after the crystal violet stain has faded under violet or near-UV light.

Algebraically special solutions in AdS/CFT

International Nuclear Information System (INIS)

Freitas, Gabriel Bernardi de; Reall, Harvey S.

2014-01-01

We investigate the AdS/CFT interpretation of the class of algebraically special solutions of Einstein gravity with a negative cosmological constant. Such solutions describe a CFT living in a 2+1 dimensional time-dependent geometry that, generically, has no isometries. The algebraically special condition implies that the expectation value of the CFT energy-momentum tensor is a local function of the boundary metric. When such a spacetime is slowly varying, the fluid/gravity approximation is valid and one can read off the values of certain higher order transport coefficients. To do this, we introduce a formalism for studying conformal, relativistic fluids in 2+1 dimensions that reduces everything to the manipulation of scalar quantities.

Algebraically special solutions in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Freitas, Gabriel Bernardi de; Reall, Harvey S. [Department of Applied Mathematics and Theoretical Physics, University of Cambridge,Centre for Mathematical Sciences, Wilberforce Road, Cambridge CB3 0WA (United Kingdom)

2014-06-26

We investigate the AdS/CFT interpretation of the class of algebraically special solutions of Einstein gravity with a negative cosmological constant. Such solutions describe a CFT living in a 2+1 dimensional time-dependent geometry that, generically, has no isometries. The algebraically special condition implies that the expectation value of the CFT energy-momentum tensor is a local function of the boundary metric. When such a spacetime is slowly varying, the fluid/gravity approximation is valid and one can read off the values of certain higher order transport coefficients. To do this, we introduce a formalism for studying conformal, relativistic fluids in 2+1 dimensions that reduces everything to the manipulation of scalar quantities.

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erichia coli CFT073] gb|AAN81970.1| Agmatinase ... [Escherichia coli CFT073] sp|Q8FE36|SPEB_ECOL6 ... Agmatinase (Agmat...ine ureohydrolase) (AUH) ... Length = 272 ... Query: 34 ... DWVITGVPFDMATSGRAGGRHG

A Phyletically Rare Gene Promotes the Niche-specific Fitness of an E. coli Pathogen during Bacteremia

Science.gov (United States)

Wiles, Travis J.; Lewis, Adam J.; Mobley, Harry L. T.; Casjens, Sherwood R.; Mulvey, Matthew A.

2013-01-01

In bacteria, laterally acquired genes are often concentrated within chromosomal regions known as genomic islands. Using a recently developed zebrafish infection model, we set out to identify unique factors encoded within genomic islands that contribute to the fitness and virulence of a reference urosepsis isolate—extraintestinal pathogenic Escherichia coli strain CFT073. By screening a series of deletion mutants, we discovered a previously uncharacterized gene, neaT, that is conditionally required by the pathogen during systemic infections. In vitro assays indicate that neaT can limit bacterial interactions with host phagocytes and alter the aggregative properties of CFT073. The neaT gene is localized within an integrated P2-like bacteriophage in CFT073, but was rarely found within other proteobacterial genomes. Sequence-based analyses revealed that neaT homologues are present, but discordantly conserved, within a phyletically diverse set of bacterial species. In CFT073, neaT appears to be unameliorated, having an exceptionally A+T-rich composition along with a notably altered codon bias. These data suggest that neaT was recently brought into the proteobacterial pan-genome from an extra-phyletic source. Interestingly, even in G+C-poor genomes, as found within the Firmicutes lineage, neaT-like genes are often unameliorated. Sequence-level features of neaT homologues challenge the common supposition that the A+T-rich nature of many recently acquired genes reflects the nucleotide composition of their genomes of origin. In total, these findings highlight the complexity of the evolutionary forces that can affect the acquisition, utilization, and assimilation of rare genes that promote the niche-dependent fitness and virulence of a bacterial pathogen. PMID:23459509

Uropathogenic Escherichia coli pathogenicity islands and other ExPEC virulence genes may contribute to the genome variability of enteroinvasive E. coli.

Science.gov (United States)

da Silva, Laís Cristina; de Mello Santos, Ana Carolina; Silva, Rosa Maria

2017-03-16

Enteroinvasive Escherichia coli (EIEC) may be the causative agent of part of those million cases of diarrhea illness reported worldwide every year and attributable to Shigella. That is because both enteropathogens have many common characteristics that difficult their identification either by traditional microbiological methods or by molecular tools used in the clinical laboratory settings. While Shigella has been extensively studied, EIEC remains barely characterized at the molecular level. Recent EIEC important outbreaks, apparently generating more life-threatening cases, have prompted us to screen EIEC for virulence traits usually related to extraintestinal pathogenic E. coli (ExPEC). That could explain the appearance of EIEC strains presenting higher virulence potential. EIEC strains were distributed mainly in three phylogroups in a serogroup-dependent manner. Serogroups O124, O136, O144, and O152 were exclusively classified in phylogroup A; O143 in group E; and O28ac and O29 in group B1. Only two serogroups showed diverse phylogenetic origin as follows: O164 was assigned to groups A, B1, C, and B2 (one strain each), and O167 in groups E (five strains), and A (one strain) (Table 1). Eleven of 20 virulence genes (VGs) searched were detected, and the majority of the 19 different VGs combinations found were serogroup-specific. Uropathogenic E. coli (UPEC) PAI genetic markers were detected in all EIEC strains. PAIs I J96 and II CFT073 were the most frequent (92.1 and 80.4%, respectively). PAI IV 536 was restricted to some serogroups from phylogroups A, B1 and E. PAI I CFT073 was uniquely detected in phylogroups B2 and E. A total of 45 (88%) strains presented multiple PAI markers (two to four). PAIs I J96 and II CFT073 were found together in 80% of strains. EIEC is a DEC pathovar that presents VGs and pathogenicity island genetic markers typically associated with ExPEC, especially UPEC. These features are distributed in a phylogenetic and serogroup-dependent manner

Kerr-CFT and gravitational perturbations

International Nuclear Information System (INIS)

Dias, Oscar J.C.; Reall, Harvey S.; Santos, Jorge E.

2009-01-01

Motivated by the Kerr-CFT conjecture, we investigate perturbations of the near-horizon extreme Kerr spacetime. The Teukolsky equation for a massless field of arbitrary spin is solved. Solutions fall into two classes: normal modes and traveling waves. Imposing suitable (outgoing) boundary conditions, we find that there are no unstable modes. The explicit form of metric perturbations is obtained using the Hertz potential formalism, and compared with the Kerr-CFT boundary conditions. The energy and angular momentum associated with scalar field and gravitational normal modes are calculated. The energy is positive in all cases. The behaviour of second order perturbations is discussed.

Introduction to AdS/CFT correspondence

CERN Document Server

Nastase, Horatiu

2015-01-01

Providing a pedagogical introduction to the rapidly developing field of AdS/CFT correspondence, this is one of the first texts to provide an accessible introduction to all the necessary concepts needed to engage with the methods, tools and applications of AdS/CFT. Without assuming anything beyond an introductory course in quantum field theory, it begins by guiding the reader through the basic concepts of field theory and gauge theory, general relativity, supersymmetry, supergravity, string theory and conformal field theory, before moving on to give a clear and rigorous account of AdS/CFT correspondence. The final section discusses the more specialised applications, including QCD, quark-gluon plasma and condensed matter. This book is self-contained and learner-focused, featuring numerous exercises and examples. It is essential reading for both students and researchers across the fields of particle, nuclear and condensed matter physics.

N=4 Superconformal Bootstrap of the K3 CFT

CERN Multimedia

CERN. Geneva

2015-01-01

We study two-dimensional (4,4) superconformal field theories of central charge c=6, corresponding to nonlinear σ models on K3 surfaces, using the superconformal bootstrap. This is made possible through a surprising relation between the BPS N=4 superconformal blocks with c=6 and bosonic Virasoro conformal blocks with c=28, and an exact result on the moduli dependence of a certain integrated BPS 4-point function. Nontrivial bounds on the non-BPS spectrum in the K3 CFT are obtained as functions of the CFT moduli, that interpolate between the free orbifold points and singular CFT points. We observe directly from the CFT perspective the signature of a continuous spectrum above a gap at the singular moduli, and find numerically an upper bound on this gap that is saturated by the A1 N=4 cigar CFT. We also derive an analytic upper bound on the first nonzero eigenvalue of the scalar Laplacian on K3 in the large volume regime, that depends on the K3 moduli data. As two byproducts, we find an exact equivalence...

E. coli Nissle 1917 Affects Salmonella adhesion to porcine intestinal epithelial cells.

Directory of Open Access Journals (Sweden)

Peter Schierack

Full Text Available BACKGROUND: The probiotic Escherichia coli strain Nissle 1917 (EcN has been shown to interfere in a human in vitro model with the invasion of several bacterial pathogens into epithelial cells, but the underlying molecular mechanisms are not known. METHODOLOGY/PRINCIPAL FINDINGS: In this study, we investigated the inhibitory effects of EcN on Salmonella Typhimurium invasion of porcine intestinal epithelial cells, focusing on EcN effects on the various stages of Salmonella infection including intracellular and extracellular Salmonella growth rates, virulence gene regulation, and adhesion. We show that EcN affects the initial Salmonella invasion steps by modulating Salmonella virulence gene regulation and Salmonella SiiE-mediated adhesion, but not extra- and intracellular Salmonella growth. However, the inhibitory activity of EcN against Salmonella invasion always correlated with EcN adhesion capacities. EcN mutants defective in the expression of F1C fimbriae and flagellae were less adherent and less inhibitory toward Salmonella invasion. Another E. coli strain expressing F1C fimbriae was also adherent to IPEC-J2 cells, and was similarly inhibitory against Salmonella invasion like EcN. CONCLUSIONS: We propose that EcN affects Salmonella adhesion through secretory components. This mechanism appears to be common to many E. coli strains, with strong adherence being a prerequisite for an effective reduction of SiiE-mediated Salmonella adhesion.

Large spin systematics in CFT

Energy Technology Data Exchange (ETDEWEB)

Alday, Luis F.; Bissi, Agnese; Łukowski, Tomasz [Mathematical Institute, University of Oxford,Andrew Wiles Building, Radcliffe Observatory Quarter,Woodstock Road, Oxford, OX2 6GG (United Kingdom)

2015-11-16

Using conformal field theory (CFT) arguments we derive an infinite number of constraints on the large spin expansion of the anomalous dimensions and structure constants of higher spin operators. These arguments rely only on analyticity, unitarity, crossing-symmetry and the structure of the conformal partial wave expansion. We obtain results for both, perturbative CFT to all order in the perturbation parameter, as well as non-perturbatively. For the case of conformal gauge theories this provides a proof of the reciprocity principle to all orders in perturbation theory and provides a new “reciprocity' principle for structure constants. We argue that these results extend also to non-conformal theories.

Large spin systematics in CFT

International Nuclear Information System (INIS)

Alday, Luis F.; Bissi, Agnese; Łukowski, Tomasz

2015-01-01

Using conformal field theory (CFT) arguments we derive an infinite number of constraints on the large spin expansion of the anomalous dimensions and structure constants of higher spin operators. These arguments rely only on analyticity, unitarity, crossing-symmetry and the structure of the conformal partial wave expansion. We obtain results for both, perturbative CFT to all order in the perturbation parameter, as well as non-perturbatively. For the case of conformal gauge theories this provides a proof of the reciprocity principle to all orders in perturbation theory and provides a new “reciprocity' principle for structure constants. We argue that these results extend also to non-conformal theories.

Propidium iodide (PI) stains Nissl bodies and may serve as a quick marker for total neuronal cell count.

Science.gov (United States)

Niu, Junfei; Li, Chunman; Wu, Haihui; Feng, Xianling; Su, Qingning; Li, Shihe; Zhang, Lihong; Yew, David Tai Wai; Cho, Eric Yu Pang; Sha, Ou

2015-03-01

Propidium iodide (PI) reacts with both DNA and RNA and is a commonly used fluorescent reagent for nucleic acid staining. The aim of the study was to compare the cellular staining patterns of PI with that of Nissl staining in rat nervous tissues and to report a modified staining method that selectively labels Nissl bodies in neurons. Cryosections and paraffin sections of different tissues of normal Sprague-Dawley rats, including trigeminal ganglia, dorsal root ganglia, spinal cord, liver, and small intestine, were stained by either PI or the hematoxylin and eosin method. Some sections were treated with RNase or DNase before the above staining, and some were double stained with PI and a Nissl stain. The sections were observed by light, fluorescence or confocal microscopy. Results showed strong PI signals detected as patterns of granules in the neuronal cytoplasm of all nervous tissues, whereas the staining of neuronal nuclei was weaker. In contrast, nuclei of neuroglial cells were strongly stained by PI, while the cytoplasm was not obviously stained. Pretreatment of the neural tissue with RNase abolished the PI signals. Furthermore, the PI positive granules in neuronal cytoplasm co-localized with Nissl bodies stained by the fluorescent Nissl stain. When the tissue was pretreated with DNase, PI only stained the cytoplasmic granules of neurons, but not that of glial cells. Our results show that PI stains Nissl bodies and may serve as an economical and convenient neuron marker for neuronal cell counting when specific neural markers such as antibodies are not readily available. Copyright © 2015. Published by Elsevier GmbH.

A combined Bodian-Nissl stain for improved network analysis in neuronal cell culture.

Science.gov (United States)

Hightower, M; Gross, G W

1985-11-01

Bodian and Nissl procedures were combined to stain dissociated mouse spinal cord cells cultured on coverslips. The Bodian technique stains fine neuronal processes in great detail as well as an intracellular fibrillar network concentrated around the nucleus and in proximal neurites. The Nissl stain clearly delimits neuronal cytoplasm in somata and in large dendrites. A combination of these techniques allows the simultaneous depiction of neuronal perikarya and all afferent and efferent processes. Costaining with little background staining by either procedure suggests high specificity for neurons. This procedure could be exploited for routine network analysis of cultured neurons.

Introduction to the AdS/CFT Correspondence

Science.gov (United States)

Nąstase, Horaǧiu

2015-09-01

Preface; Introduction; Part I. Background: 1. Elements of quantum field theory and gauge theory; 2. Basics of general relativity. Anti-de Sitter space; 3. Basics of supersymmetry; 4. Basics of supergravity; 5. Kaluza-Klein dimensional reduction; 6. Black holes and p-branes; 7. String theory actions and spectra; 8. Elements of conformal field theory; 9. D-branes; Part II. Basics of AdS/CFT for N = 4 SYM vs AdS5 × S5: 10. The AdS/CFT correspondence: motivation, definition and spectra; 11. Witten prescription and 3-point correlator calculations; 12. Holography in Lorentzian signature: Poincaré and global; 13. Solitonic objects in AdS/CFT; 14. Quarks and the Wilson loop; 15. Finite temperature and N = 4 SYM plasmas; 16. Scattering processes and gravitational shockwave limit; 17. The pp-wave correspondence; 18. Spin chains; Part III. AdS/CFT Developments and Gauge-Gravity Dualities: 19. Other conformal cases; 20. The 3 dimensional ABJM model vs. AdS4 × CP3; 21. Gravity duals; 22. Holographic renormalization; 23. RG flow between fixed points; 24. Phenomenological gauge-gravity duality I: AdS/QCD; 25. Phenomenological gauge-gravity duality II: AdS/CMT; 26. Gluon scattering: the Alday-Maldacena prescription; 27. Holographic entanglement entropy: the Ryu-Takayanagi prescription.

On CFT and quantum chaos

International Nuclear Information System (INIS)

Turiaci, Gustavo J.; Verlinde, Herman

2016-01-01

We make three observations that help clarify the relation between CFT and quantum chaos. We show that any 1+1-D system in which conformal symmetry is non-linearly realized exhibits two main characteristics of chaos: maximal Lyapunov behavior and a spectrum of Ruelle resonances. We use this insight to identify a lattice model for quantum chaos, built from parafermionic spin variables with an equation of motion given by a Y-system. Finally we point to a relation between the spectrum of Ruelle resonances of a CFT and the analytic properties of OPE coefficients between light and heavy operators. In our model, this spectrum agrees with the quasi-normal modes of the BTZ black hole.

On CFT and quantum chaos

Energy Technology Data Exchange (ETDEWEB)

Turiaci, Gustavo J. [Physics Department, Princeton University,Princeton NJ 08544 (United States); Verlinde, Herman [Physics Department, Princeton University,Princeton NJ 08544 (United States); Princeton Center for Theoretical Science, Princeton University,Princeton NJ 08544 (United States)

2016-12-21

We make three observations that help clarify the relation between CFT and quantum chaos. We show that any 1+1-D system in which conformal symmetry is non-linearly realized exhibits two main characteristics of chaos: maximal Lyapunov behavior and a spectrum of Ruelle resonances. We use this insight to identify a lattice model for quantum chaos, built from parafermionic spin variables with an equation of motion given by a Y-system. Finally we point to a relation between the spectrum of Ruelle resonances of a CFT and the analytic properties of OPE coefficients between light and heavy operators. In our model, this spectrum agrees with the quasi-normal modes of the BTZ black hole.

Chiral gravity, log gravity, and extremal CFT

International Nuclear Information System (INIS)

Maloney, Alexander; Song Wei; Strominger, Andrew

2010-01-01

We show that the linearization of all exact solutions of classical chiral gravity around the AdS 3 vacuum have positive energy. Nonchiral and negative-energy solutions of the linearized equations are infrared divergent at second order, and so are removed from the spectrum. In other words, chirality is confined and the equations of motion have linearization instabilities. We prove that the only stationary, axially symmetric solutions of chiral gravity are BTZ black holes, which have positive energy. It is further shown that classical log gravity--the theory with logarithmically relaxed boundary conditions--has finite asymptotic symmetry generators but is not chiral and hence may be dual at the quantum level to a logarithmic conformal field theories (CFT). Moreover we show that log gravity contains chiral gravity within it as a decoupled charge superselection sector. We formally evaluate the Euclidean sum over geometries of chiral gravity and show that it gives precisely the holomorphic extremal CFT partition function. The modular invariance and integrality of the expansion coefficients of this partition function are consistent with the existence of an exact quantum theory of chiral gravity. We argue that the problem of quantizing chiral gravity is the holographic dual of the problem of constructing an extremal CFT, while quantizing log gravity is dual to the problem of constructing a logarithmic extremal CFT.

Thermal geometry from CFT at finite temperature

Directory of Open Access Journals (Sweden)

Wen-Cong Gan

2016-09-01

Full Text Available We present how the thermal geometry emerges from CFT at finite temperature by using the truncated entanglement renormalization network, the cMERA. For the case of 2d CFT, the reduced geometry is the BTZ black hole or the thermal AdS as expectation. In order to determine which spacetimes prefer to form, we propose a cMERA description of the Hawking–Page phase transition. Our proposal is in agreement with the picture of the recent proposed surface/state correspondence.

Thermal geometry from CFT at finite temperature

Energy Technology Data Exchange (ETDEWEB)

Gan, Wen-Cong, E-mail: ganwencong@gmail.com [Department of Physics, Nanchang University, Nanchang 330031 (China); Center for Relativistic Astrophysics and High Energy Physics, Nanchang University, Nanchang 330031 (China); Shu, Fu-Wen, E-mail: shufuwen@ncu.edu.cn [Department of Physics, Nanchang University, Nanchang 330031 (China); Center for Relativistic Astrophysics and High Energy Physics, Nanchang University, Nanchang 330031 (China); Wu, Meng-He, E-mail: menghewu.physik@gmail.com [Department of Physics, Nanchang University, Nanchang 330031 (China); Center for Relativistic Astrophysics and High Energy Physics, Nanchang University, Nanchang 330031 (China)

2016-09-10

We present how the thermal geometry emerges from CFT at finite temperature by using the truncated entanglement renormalization network, the cMERA. For the case of 2d CFT, the reduced geometry is the BTZ black hole or the thermal AdS as expectation. In order to determine which spacetimes prefer to form, we propose a cMERA description of the Hawking–Page phase transition. Our proposal is in agreement with the picture of the recent proposed surface/state correspondence.

Epigenetic Mechanisms Regulate Innate Immunity against Uropathogenic and Commensal-Like Escherichia coli in the Surrogate Insect Model Galleria mellonella.

Science.gov (United States)

Heitmueller, Miriam; Billion, André; Dobrindt, Ulrich; Vilcinskas, Andreas; Mukherjee, Krishnendu

2017-10-01

Innate-immunity-related genes in humans are activated during urinary tract infections (UTIs) caused by pathogenic strains of Escherichia coli but are suppressed by commensals. Epigenetic mechanisms play a pivotal role in the regulation of gene expression in response to environmental stimuli. To determine whether epigenetic mechanisms can explain the different behaviors of pathogenic and commensal bacteria, we infected larvae of the greater wax moth, Galleria mellonella , a widely used model insect host, with a uropathogenic E. coli (UPEC) strain that causes symptomatic UTIs in humans or a commensal-like strain that causes asymptomatic bacteriuria (ABU). Infection with the UPEC strain (CFT073) was more lethal to larvae than infection with the attenuated ABU strain (83972) due to the recognition of each strain by different Toll-like receptors, ultimately leading to differential DNA/RNA methylation and histone acetylation. We used next-generation sequencing and reverse transcription (RT)-PCR to correlate epigenetic changes with the induction of innate-immunity-related genes. Transcriptomic analysis of G. mellonella larvae infected with E. coli strains CFT073 and 83972 revealed strain-specific variations in the class and expression levels of genes encoding antimicrobial peptides, cytokines, and enzymes controlling DNA methylation and histone acetylation. Our results provide evidence for the differential epigenetic regulation of transcriptional reprogramming by UPEC and ABU strains of E. coli in G. mellonella larvae, which may be relevant to understanding the different behaviors of these bacterial strains in the human urinary tract. Copyright © 2017 American Society for Microbiology.

N=4 superconformal bootstrap of the K3 CFT

Energy Technology Data Exchange (ETDEWEB)

Lin, Ying-Hsuan; Shao, Shu-Heng [Jefferson Physical Laboratory, Harvard University,17 Oxford Street, Cambridge, MA 02138 (United States); Simmons-Duffin, David [School of Natural Sciences, Institute for Advanced Study,1 Einstein Drive, Princeton, NJ 08540 (United States); Wang, Yifan [Center for Theoretical Physics, Massachusetts Institute of Technology,77 Massachusetts Ave, Cambridge, MA 02139 (United States); Yin, Xi [Jefferson Physical Laboratory, Harvard University,17 Oxford Street, Cambridge, MA 02138 (United States)

2017-05-23

We study two-dimensional (4,4) superconformal field theories of central charge c=6, corresponding to nonlinear sigma models on K3 surfaces, using the superconformal bootstrap. This is made possible through a surprising relation between the BPS N=4 superconformal blocks with c=6 and bosonic Virasoro conformal blocks with c=28, and an exact result on the moduli dependence of a certain integrated BPS 4-point function. Nontrivial bounds on the non-BPS spectrum in the K3 CFT are obtained as functions of the CFT moduli, that interpolate between the free orbifold points and singular CFT points. We observe directly from the CFT perspective the signature of a continuous spectrum above a gap at the singular moduli, and find numerically an upper bound on this gap that is saturated by the A{sub 1}N=4 cigar CFT. We also derive an analytic upper bound on the first nonzero eigenvalue of the scalar Laplacian on K3 in the large volume regime, that depends on the K3 moduli data. As two byproducts, we find an exact equivalence between a class of BPS N=2 superconformal blocks and Virasoro conformal blocks in two dimensions, and an upper bound on the four-point functions of operators of sufficiently low scaling dimension in three and four dimensional CFTs.

Activation of the NLRP3 Inflammasome Pathway by Uropathogenic Escherichia coli Is Virulence Factor-Dependent and Influences Colonization of Bladder Epithelial Cells

Directory of Open Access Journals (Sweden)

Isak Demirel

2018-03-01

Full Text Available The NLRP3 inflammasome and IL-1β release have recently been suggested to be important for the progression of urinary tract infection (UTI. However, much is still unknown regarding the interaction of UPEC and the NLRP3 inflammasome. The purpose of this study was to elucidate what virulence factors uropathogenic Escherichia coli (UPEC use to modulate NLRP3 inflammasome activation and subsequent IL-1β release and the role of NLRP3 for UPEC colonization of bladder epithelial cells. The bladder epithelial cell line 5637, CRISPR/Cas9 generated NLRP3, caspase-1 and mesotrypsin deficient cell lines and transformed primary bladder epithelial cells (HBLAK were stimulated with UPEC isolates and the non-pathogenic MG1655 strain. We found that the UPEC strain CFT073, but not MG1655, induced an increased caspase-1 activity and IL-1β release from bladder epithelial cells. The increase was shown to be mediated by α-hemolysin activation of the NLRP3 inflammasome in an NF-κB-independent manner. The effect of α-hemolysin on IL-1β release was biphasic, initially suppressive, later inductive. Furthermore, the phase-locked type-1-fimbrial ON variant of CFT073 inhibited caspase-1 activation and IL-1β release. In addition, the ability of CFT073 to adhere to and invade NLRP3 deficient cells was significantly reduced compare to wild-type cells. The reduced colonization of NLRP3-deficient cells was type-1 fimbriae dependent. In conclusion, we found that the NLRP3 inflammasome was important for type-1 fimbriae-dependent colonization of bladder epithelial cells and that both type-1 fimbriae and α-hemolysin can modulate the activity of the NLRP3 inflammasome.

Boundary multi-trace deformations and Opens in AdS/CFT correspondence

International Nuclear Information System (INIS)

Petkou, Anastasios C.

2002-01-01

We argue that multi-trace deformations of the boundary CFT in AdS/CFT correspondence can arise through the OPE of single-trace operators. We work out the example of a scalar field in AdS 5 with cubic self interaction. By an appropriate reparametrization of the boundary data we are able to deform the boundary CFT by a marginal operator that couples to the conformal anomaly. Our method can be used in the analysis of multi-trace deformations in N=4 SYM where the OPEs of various single-trace operators are known. (author)

Super-entropic black holes and the Kerr-CFT correspondence

Energy Technology Data Exchange (ETDEWEB)

Sinamuli, Musema [Department of Physics and Astronomy, University of Waterloo,200 University Ave., Waterloo, Ontario N2L 3G1 (Canada); Perimeter Institute for Theoretical Physics,31 Caroline St., Waterloo, Ontario, N2L 2Y5 (Canada); Mann, Robert B. [Department of Physics and Astronomy, University of Waterloo,200 University Ave., Waterloo, Ontario N2L 3G1 (Canada)

2016-08-24

We demonstrate that Kerr-CFT duality can be extended to super-entropic black holes, which have non-compact horizons with finite area. We demonstrate that this duality is robust insofar as the ultra-spinning limit of a Kerr-AdS black hole (which yields the super-entropic class) commutes with the near-horizon limit (which yields the Kerr-CFT duality). Consequently the Bekenstein-Hawking and the CFT entropies are equivalent. We show that the duality holds for both singly-spinning super-entropic black holes in 4 dimensions and for doubly-spinning super-entropic black holes of gauged supergravity in 5 dimensions. In both cases we obtain not only the expected left/right temperatures, but also temperatures associated with electric charge and with a new thermodynamic parameter specific to super-entropic black holes.

Super-entropic black holes and the Kerr-CFT correspondence

International Nuclear Information System (INIS)

Sinamuli, Musema; Mann, Robert B.

2016-01-01

We demonstrate that Kerr-CFT duality can be extended to super-entropic black holes, which have non-compact horizons with finite area. We demonstrate that this duality is robust insofar as the ultra-spinning limit of a Kerr-AdS black hole (which yields the super-entropic class) commutes with the near-horizon limit (which yields the Kerr-CFT duality). Consequently the Bekenstein-Hawking and the CFT entropies are equivalent. We show that the duality holds for both singly-spinning super-entropic black holes in 4 dimensions and for doubly-spinning super-entropic black holes of gauged supergravity in 5 dimensions. In both cases we obtain not only the expected left/right temperatures, but also temperatures associated with electric charge and with a new thermodynamic parameter specific to super-entropic black holes.

Census taking in the hat: FRW/CFT duality

International Nuclear Information System (INIS)

Sekino, Yasuhiro; Susskind, Leonard

2009-01-01

In this paper a holographic description of eternal inflation is developed. We focus on the description of an open Friedmann-Robertson-Walker (FRW) universe that results from a tunneling event in which a false vacuum with positive vacuum energy decays to a supersymmetric vacuum with vanishing cosmological constant. The observations of a 'census taker' in the final vacuum can be organized into a holographic dual conformal field theory that lives on the asymptotic boundary of space. We refer to this bulk-boundary correspondence as FRW/CFT duality. The dual conformal field theory (CFT) is a Euclidean two-dimensional theory that includes a Liouville 2D gravity sector describing geometric fluctuations of the boundary. The renormalization-group flow of the theory is richer than in the AdS/CFT correspondence, and generates two space-time dimensions--one spacelike and one timelike. We discuss a number of phenomena such as bubble collisions, and the Garriga, Guth Vilenkin 'persistence of memory', from the dual viewpoint.

Topologically massive gravity and the AdS/CFT correspondence

International Nuclear Information System (INIS)

Skenderis, Kostas; Taylor, Marika; Rees, Balt C. van

2009-01-01

We set up the AdS/CFT correspondence for topologically massive gravity (TMG) in three dimensions. The first step in this procedure is to determine the appropriate fall off conditions at infinity. These cannot be fixed a priori as they depend on the bulk theory under consideration and are derived by solving asymptotically the non-linear field equations. We discuss in detail the asymptotic structure of the field equations for TMG, showing that it contains leading and subleading logarithms, determine the map between bulk fields and CFT operators, obtain the appropriate counterterms needed for holographic renormalization and compute holographically one- and two-point functions at and away from the 'chiral point' (μ = 1). The 2-point functions at the chiral point are those of a logarithmic CFT (LCFT) with c L = 0,c R = 3l/G N and b = -3l/G N , where b is a parameter characterizing different c = 0 LCFTs. The bulk correlators away from the chiral point (μ ≠ 1) smoothly limit to the LCFT ones as μ → 1. Away from the chiral point, the CFT contains a state of negative norm and the expectation value of the energy momentum tensor in that state is also negative, reflecting a corresponding bulk instability due to negative energy modes.

The AdS/CFT correspondence

International Nuclear Information System (INIS)

Hubeny, Veronika E

2015-01-01

We give a brief review of the AdS/CFT correspondence, which posits the equivalence between a certain gravitational theory and a lower-dimensional non-gravitational one. This remarkable duality, formulated in 1997, has sparked a vigorous research program that has gained in breadth over the years, with applications to many aspects of theoretical (and even experimental) physics, not least to general relativity and quantum gravity. To put the AdS/CFT correspondence into historical context, we start by reviewing the relevant aspects of string theory (of which no prior knowledge is assumed). We then develop the statement of the correspondence, and explain how the two sides of the duality map into each other. Finally, we discuss the implications and applications of the correspondence, and indicate some of the current trends in this subject. The presentation attempts to convey the main concepts in a simple and self-contained manner, relegating supplementary remarks to footnotes. (paper)

Towards causal patch physics in dS/CFT

Science.gov (United States)

Neiman, Yasha

2018-01-01

This contribution is a status report on a research program aimed at obtaining quantum-gravitational physics inside a cosmological horizon through dS/CFT, i.e. through a holographic description at past/future infinity of de Sitter space. The program aims to bring together two main elements. The first is the observation by Anninos, Hartman and Strominger that Vasiliev's higher-spin gravity provides a working model for dS/CFT in 3+1 dimensions. The second is the proposal by Parikh, Savonije and Verlinde that dS/CFT may prove more tractable if one works in so-called "elliptic" de Sitter space - a folded-in-half version of global de Sitter where antipodal points have been identified. We review some relevant progress concerning quantum field theory on elliptic de Sitter space, higher-spin gravity and its holographic duality with a free vector model. We present our reasons for optimism that the approach outlined here will lead to a full holographic description of quantum (higher-spin) gravity in the causal patch of a de Sitter observer.

Condensed matter applications of AdS/CFT (I)

CERN Multimedia

CERN. Geneva

2009-01-01

These lectures will discuss the application of ads/cft techniques to condensed matter systems. After motivating this endeavor, I will review the basic features of the ads/cft correspondence that will be used. I will review the physics of spectral functions and how they can be computed via AdS/CFT. Holographic superconductors will be discussed. The lectures will conclude with a discussion of open questions and future directions. References: - Holographic Superconductors. Sean A. Hartnoll, Christopher P. Herzog, Gary T. Horowitz, JHEP 0812:015,2008, arXiv:0810.1563 [hep-th] - Ohm's Law at strong coupling: S duality and the cyclotron resonance, Sean A. Hartnoll, Christopher P. Herzog,  Phys.Rev.D76:106012,2007, arXiv:0706.3228 [hep-th] - Gravity duals for non-relativistic CFTs. Koushik Balasubramanian, John McGreevy,  Phys.Rev.Lett.101:061601,2008, arXiv:0804.4053 [hep-th] - Toward an AdS/cold atoms correspondence: A Geometric realization of the Schrodinger symmetry. D.T. Son, Phys.Rev.D78:0...

Improved Method for the Incorporation of Heme Cofactors into Recombinant Proteins Using Escherichia coli Nissle 1917.

Science.gov (United States)

Fiege, Kerstin; Querebillo, Christine Joy; Hildebrandt, Peter; Frankenberg-Dinkel, Nicole

2018-05-15

Recombinant production of heme proteins in Escherichia coli is often limited by the availability of heme in the host. Therefore, several methods, including the reconstitution of heme proteins after production but prior to purification or the HPEX system, conferring the ability to take up external heme have been developed and used in the past. Here we describe the use of the apathogenic E. coli strain Nissle 1917 (EcN) as a suitable host for the recombinant production of heme proteins. EcN has an advantage over commonly used lab strains in that it is able to take up heme from the environment through the heme receptor ChuA. Expression of several heme proteins from different prokaryotic sources led to high yield and quantitative incorporation of the cofactor when heme was supplied in the growth medium. Comparative UV-vis and resonance Raman measurements revealed that the method employed has significant influence on heme coordination with the EcN system representing the most native situation. Therefore, the use of EcN as a host for recombinant heme protein production represents an inexpensive and straightforward method to facilitate further investigations of structure and function.

Generalized Gribov-Lipatov Reciprocity and AdS/CFT

International Nuclear Information System (INIS)

Beccaria, M.; Macorini, G.; Forini, V.

2010-01-01

Planar □=4 SYM theory and QCD share the gluon sector, suggesting the investigation of Gribov-Lipatov reciprocity in the supersymmetric theory. Since the AdS/CFT correspondence links □=4 SYM and superstring dynamics on AdS 5 x S5, reciprocity is also expected to show up in the quantum corrected energies of certain classical string configurations dual to gauge theory twist-operators. We review recent results confirming this picture and revisiting the old idea of Gribov-Lipatov reciprocity as a modern theoretical tool useful for the study of open problems in AdS/CFT.

Accelerated detectors and worldsheet horizons in AdS/CFT

OpenAIRE

Chernicoff, Mariano; Paredes, Angel

2010-01-01

We use the AdS/CFT correspondence to discuss the response of an accelerated observer to the quantum vacuum fluctuations. In particular, we study heavy quarks probing a strongly coupled CFT by analysing strings moving in AdS. We propose that, in this context, a non-trivial detection rate is associated to the existence of a worldsheet horizon and we find an Unruh-like expression for the worldsheet temperature. Finally, by examining a rotating string in global AdS we find that there is a transit...

Ciprofloxacin and probiotic Escherichia coli Nissle add-on treatment in active ulcerative colitis

DEFF Research Database (Denmark)

Petersen, Andreas Munk; Mirsepasi, Hengameh; Halkjær, Sofie Ingdam

2014-01-01

BACKGROUND AND AIM: Ulcerative colitis (UC) is a chronic inflammatory bowel disease. The probiotic bacterium Escherichia coli Nissle 1917 (EcN) has been used to maintain and induce clinical remission in UC. Our aim was to test the effect of Ciprofloxacin and/or orally administered EcN as add...

Treatment of inflammatory bowel disease associated E. coli with ciprofloxacin and E. coli Nissle in the streptomycin-treated mouse intestine

DEFF Research Database (Denmark)

Petersen, Andreas Munk; Schjørring, Susanne; Gerstrøm, Sarah Choi

2011-01-01

E. coli belonging to the phylogenetic group B2 are linked to Inflammatory Bowel Disease (IBD). Studies have shown that antimicrobials have some effect in the treatment of IBD, and it has been demonstrated that E. coli Nissle has prophylactic abilities comparable to 5-aminosalicylic acid (5-ASA......) therapy in ulcerative colitis. The objective of this study was to test if ciprofloxacin and/or E. coli Nissle could eradicate IBD associated E. coli in the streptomycin-treated mouse intestine....

Bogoliubov coefficients for the twist operator in the D1D5 CFT

Directory of Open Access Journals (Sweden)

Zaq Carson

2014-12-01

Full Text Available The D1D5 CFT is a holographic dual of a near-extremal black hole in string theory. The interaction in this theory involves a twist operator which joins together different copies of a free CFT. Given a large number of D1 and D5 branes, the effective length of the circle on which the CFT lives is very large. We develop a technique to study the effect of the twist operator in the limit where the wavelengths of excitations are short compared to this effective length, which we call the ‘continuum limit’. The method uses Bogoliubov coefficients to compute the effect of the twist operator in this limit. For bosonic fields, we use the method to reproduce recent results describing the effect of the twist operator when it links together CFT copies with windings M and N, producing a copy of winding M+N. We also comment on possible generalizations of our results. The methods developed here may help in understanding the twist interaction at higher orders. This in turn should provide insight into the thermalization process in the D1D5 CFT, which gives a holographic description of black hole formation.

Null infinity and extremal horizons in AdS-CFT

International Nuclear Information System (INIS)

Hickling, Andrew; Wiseman, Toby; Lucietti, James

2015-01-01

We consider AdS gravity duals to CFT on background spacetimes with a null infinity. Null infinity on the conformal boundary may extend to an extremal horizon in the bulk. For example it does so for Poincaré–AdS, although does not for planar Schwarzschild–AdS. If null infinity does extend into an extremal horizon in the bulk, we show that the bulk near-horizon geometry is determined by the geometry of the boundary null infinity. Hence the ‘infra-red’ geometry of the bulk is fixed by the large scale behaviour of the CFT spacetime. In addition the boundary stress tensor must have a particular decay at null infinity. As an application, we argue that for CFT on asymptotically flat backgrounds, any static bulk dual containing an extremal horizon extending from the boundary null infinity, must have the near-horizon geometry of Poincaré–AdS. We also discuss a class of boundary null infinity that cannot extend to a bulk extremal horizon, although we give evidence that they can extend to an analogous null surface in the bulk which possesses an associated scale-invariant ‘near-geometry’. (paper)

AdS/CFT correspondence and supersymmetry

International Nuclear Information System (INIS)

Dobrev, V.K.

2002-05-01

We use the group-theoretic interpretation of the AdS/CFT correspondence which we proposed earlier in order to lift intertwining operators acting between boundary conformal representations to intertwining operators acting between bulk conformal representations. Further, we present the classification of the positive energy (lowest weight) unitary irreducible representations of the D=6 superconformal algebras osp(8*/2N). (author)

Histochemical alternations in the Nissl bodies and ribonucleic acid (RNA) in the spinal, gangalion neurones of gamma irradiated rats

International Nuclear Information System (INIS)

Mousa, Tohamy A.; Roushdy, Hamed M.; Raid, Nahed A.; Al-Zahaby, Al-Ahmady S.; Sanad, Samia M.

1984-01-01

Four groups of adult male albino rats were subjected to whole body gamma-irradiation at the exposure levels of 200, 400, 600 and 1000 rads and the spinal ganglia were dissected out after different intervals of 3 hr., 1, 3, 5, 7, 10, 15 and 30 days. Nissl bodies and ribonucleic acid were demonstrated histochemically. Gamma irradiation may cause a decrease in RNA synthesis which was reflected in a reduced amount of Nissl substance visible in toluidine blue stained you thick sections of spinal ganglion of gamma irradiated rats and in the total amount of cytoplasmic RNA in pyronin-methyl green stained sections compared with control animals

AdS/CFT and Light-Front QCD

International Nuclear Information System (INIS)

Brodsky, S

2008-01-01

The AdS/CFT correspondence between string theory in AdS space and conformal field theories in physical space-time leads to an analytic, semi-classical model for strongly-coupled QCD which has scale invariance and dimensional counting at short distances and color confinement at large distances. The AdS/CFT correspondence also provides insights into the inherently nonperturbative aspects of QCD such as the orbital and radial spectra of hadrons and the form of hadronic wavefunctions. In particular, we show that there is an exact correspondence between the fifth-dimensional coordinate of AdS space z and a specific impact variable ζ which measures the separation of the quark and gluonic constituents within the hadron in ordinary space-time. This connection leads to AdS/CFT predictions for the analytic form of the frame-independent light-front wavefunctions (LFWFs) of mesons and baryons, the fundamental entities which encode hadron properties. The LFWFs in turn predict decay constants and spin correlations, as well as dynamical quantities such as form factors, structure functions, generalized parton distributions, and exclusive scattering amplitudes. Relativistic light-front equations in ordinary space-time are found which reproduce the results obtained using the fifth-dimensional theory and have remarkable algebraic structures and integrability properties. As specific examples we describe the behavior of the pion form factor in the space and time-like regions and determine the Dirac nucleon form factors in the space-like region. An extension to nonzero quark mass is used to determine hadronic distribution amplitudes of all mesons, heavy and light. We compare our results with the moments of the distribution amplitudes which have recently been computed from lattice gauge theory

Double relaxation via AdS/CFT

Science.gov (United States)

Amiri-Sharifi, S.; Ali-Akbari, M.; Kishani-Farahani, A.; Shafie, N.

2016-08-01

We exploit the AdS/CFT correspondence to investigate thermalization in an N = 2 strongly coupled gauge theory including massless fundamental matter (quark). More precisely, we consider the response of a zero temperature state of the gauge theory under influence of an external electric field which leads to a time-dependent current. The holographic dual of the above set-up is given by introducing a time-dependent electric field on the probe D7-brane embedded in an AdS5 ×S5 background. In the dual gravity theory an apparent horizon forms on the brane which, according to AdS/CFT dictionary, is the counterpart of the thermalization process in the gauge theory side. We classify different functions for time-dependent electric field and study their effect on the apparent horizon formation. In the case of pulse functions, where the electric field varies from zero to zero, apart from non-equilibrium phase, we observe the formation of two separate apparent horizons on the brane. This means that the state of the gauge theory experiences two different temperature regimes during its time evolution.

An infalling observer in AdS/CFT

NARCIS (Netherlands)

Papadodimas, Kyriakos; Raju, Suvrat

2013-01-01

We describe the experience of an observer falling into a black hole using the AdS/CFT correspondence. In order to do this, we reconstruct the local bulk operators measured by the observer along his trajectory outside the black hole. We then extend our construction beyond the black hole horizon. We

CFT and Logarithmic Corrections to the Black Hole Entropy Product Formula

Directory of Open Access Journals (Sweden)

Parthapratim Pradhan

2017-01-01

Full Text Available We examine the logarithmic corrections to the black hole (BH entropy product formula of outer horizon and inner horizon by taking into account the effects of statistical quantum fluctuations around the thermal equilibrium and via conformal field theory (CFT. We argue that, in logarithmic corrections to the BH entropy product formula when calculated using CFT and taking into account the effects of quantum fluctuations around the thermal equilibrium, the formula should not be universal and it also should not be quantized. These results have been explicitly checked by giving several examples.

Logarithmic corrections to entropy and AdS/CFT

Indian Academy of Sciences (India)

Abstract. We calculate the correction to the Bekenstein-Hawking entropy formula for five-dimensional AdS-Schwarzschild black holes due to thermodynamic fluctuations. The result is then compared with the boundary gauge theory entropy corrections via AdS/CFT correspondence.

Accelerated detectors and worldsheet horizons in AdS/CFT

Science.gov (United States)

Chernicoff, Mariano; Paredes, Angel

2011-03-01

We use the AdS/CFT correspondence to discuss the response of an accelerated observer to the quantum vacuum fluctuations. In particular, we study heavy quarks probing a strongly coupled CFT by analysing strings moving in AdS. We propose that, in this context, a non-trivial detection rate is associated to the existence of a worldsheet horizon and we find an Unruh-like expression for the worldsheet temperature. Finally, by examining a rotating string in global AdS we find that there is a transition between string embeddings with and without worldsheet horizon. The dual picture corresponds to having non-trivial or trivial interaction with the quantum vacuum respectively. This is in qualitative agreement with results of Davies et al.

AdS/CFT correspondence in the Euclidean context

International Nuclear Information System (INIS)

Gottschalk, H.; Thaler, H.

2007-01-01

We study two possible prescriptions for AdS/CFT correspondence by means of functional integrals. The considerations are non-perturbative and reveal certain divergencies which turn out to be harmless, in the sense that reflection-positivity and conformal invariance are not destroyed. (orig.)

Extremal RN/CFT in both hands revisited

International Nuclear Information System (INIS)

Kuo, En-Jui; Yang, Yi

2016-01-01

We study RN/CFT correspondence for four dimensional extremal Reissner–Nordstrom black hole. We uplift the 4d RN black hole to a 5d rotating black hole and make a geometric regularization of the 5d space–time. Both hands central charges are obtained correctly at the same time by Brown–Henneaux technique.

CFT/gravity correspondence on the isolated horizon

Energy Technology Data Exchange (ETDEWEB)

Ghosh, Amit, E-mail: amit.ghosh@saha.ac.in [Saha Institute of Nuclear Physics, 1/AF Bidhan Nagar, 700064 Kolkata (India); Pranzetti, Daniele, E-mail: daniele.pranzetti@gravity.fau.de [Institute for Quantum Gravity, University of Erlangen-Nürnberg (FAU), Staudtstrasse 7/B2, 91058 Erlangen (Germany)

2014-12-15

A quantum isolated horizon can be modelled by an SU(2) Chern–Simons theory on a punctured 2-sphere. We show how a local 2-dimensional conformal symmetry arises at each puncture inducing an infinite set of new observables localised at the horizon which satisfy a Kac–Moody algebra. By means of the isolated horizon boundary conditions, we represent the gravitational flux degrees of freedom in terms of the zero modes of the Kac–Moody algebra defined on the boundary of a punctured disk. In this way, our construction encodes a precise notion of CFT/gravity correspondence. The higher modes in the algebra represent new nongeometric charges which can be represented in terms of free matter field degrees of freedom. When computing the CFT partition function of the system, these new states induce an extra degeneracy factor, representing the density of horizon states at a given energy level, which reproduces the Bekenstein's holographic bound for an imaginary Immirzi parameter. This allows us to recover the Bekenstein–Hawking entropy formula without the large quantum gravity corrections associated with the number of punctures.

Analog geometry in an expanding fluid from AdS/CFT perspective

Science.gov (United States)

Bilić, Neven; Domazet, Silvije; Tolić, Dijana

2015-04-01

The dynamics of an expanding hadron fluid at temperatures below the chiral transition is studied in the framework of AdS/CFT correspondence. We establish a correspondence between the asymptotic AdS geometry in the 4 + 1 dimensional bulk with the analog spacetime geometry on its 3 + 1 dimensional boundary with the background fluid undergoing a spherical Bjorken type expansion. The analog metric tensor on the boundary depends locally on the soft pion dispersion relation and the four-velocity of the fluid. The AdS/CFT correspondence provides a relation between the pion velocity and the critical temperature of the chiral phase transition.

Vacuum states and the S matrix in dS/CFT

International Nuclear Information System (INIS)

Spradlin, Marcus; Volovich, Anastasia

2002-01-01

We propose a definition of dS/CFT correlation functions by equating them to S-matrix elements for scattering particles from I - to I + . In planar coordinates, which cover half of de Sitter space, we consider instead the S vector obtained by specifying a fixed state on the horizon. We construct the one-parameter family of de Sitter invariant vacuum states for a massive scalar field in these coordinates, and show that the vacuum obtained by analytic continuation from the sphere has no particles on the past horizon. We use this formalism to provide evidence that the one-parameter family of vacua corresponds to marginal deformations of the CFT by computing a three-point function

The Goldstone equivalence theorem and AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Anand, Nikhil; Cantrell, Sean [Department of Physics & Astronomy, Johns Hopkins University,Baltimore, MD 21218 (United States)

2015-08-03

The Goldstone equivalence theorem allows one to relate scattering amplitudes of massive gauge fields to those of scalar fields in the limit of large scattering energies. We generalize this theorem under the framework of the AdS/CFT correspondence. First, we obtain an expression of the equivalence theorem in terms of correlation functions of creation and annihilation operators by using an AdS wave function approach to the AdS/CFT dictionary. It is shown that the divergence of the non-conserved conformal current dual to the bulk gauge field is approximately primary when computing correlators for theories in which the masses of all the exchanged particles are sufficiently large. The results are then generalized to higher spin fields. We then go on to generalize the theorem using conformal blocks in two and four-dimensional CFTs. We show that when the scaling dimensions of the exchanged operators are large compared to both their spins and the dimension of the current, the conformal blocks satisfy an equivalence theorem.

Analysis of thick brain sections by obverse-reverse computer microscopy: application of a new, high clarity Golgi-Nissl stain.

Science.gov (United States)

Glaser, E M; Van der Loos, H

1981-08-01

Exceptionally clear Golgi-Nissl sections of 300 micron thickness have been morphometrically studied by light microscopy using oil immersion objectives. The clarity results from a new variation of a staining procedure that combines Golgi and Nissl images in one section. A viewing technique has been developed that permits a histologic preparation to be examined from its obverse (or normally viewed) side and its reverse (or under) side. The technique was designed for use with a computer microscope but can be employed with any light microscope whose stage position can be measured within 100 micron. Sections thicker than 300 micron can be studied dependent on the working distance of the objective lens, provided that the clarity of the material permits it.

4D scattering amplitudes and asymptotic symmetries from 2D CFT

Science.gov (United States)

Cheung, Clifford; de la Fuente, Anton; Sundrum, Raman

2017-01-01

We reformulate the scattering amplitudes of 4D flat space gauge theory and gravity in the language of a 2D CFT on the celestial sphere. The resulting CFT structure exhibits an OPE constructed from 4D collinear singularities, as well as infinite-dimensional Kac-Moody and Virasoro algebras encoding the asymptotic symmetries of 4D flat space. We derive these results by recasting 4D dynamics in terms of a convenient foliation of flat space into 3D Euclidean AdS and Lorentzian dS geometries. Tree-level scattering amplitudes take the form of Witten diagrams for a continuum of (A)dS modes, which are in turn equivalent to CFT correlators via the (A)dS/CFT dictionary. The Ward identities for the 2D conserved currents are dual to 4D soft theorems, while the bulk-boundary propagators of massless (A)dS modes are superpositions of the leading and subleading Weinberg soft factors of gauge theory and gravity. In general, the massless (A)dS modes are 3D Chern-Simons gauge fields describing the soft, single helicity sectors of 4D gauge theory and gravity. Consistent with the topological nature of Chern-Simons theory, Aharonov-Bohm effects record the "tracks" of hard particles in the soft radiation, leading to a simple characterization of gauge and gravitational memories. Soft particle exchanges between hard processes define the Kac-Moody level and Virasoro central charge, which are thereby related to the 4D gauge coupling and gravitational strength in units of an infrared cutoff. Finally, we discuss a toy model for black hole horizons via a restriction to the Rindler region.

From gravity to thermal gauge theories. The AdS/CFT correspondence

International Nuclear Information System (INIS)

Papantonopoulos, Eleftherios

2011-01-01

The AdS/CFT correspondence is a powerful tool in studying strongly coupled phenomena in gauge field theories, using results from a weakly coupled gravity background studied in the realm of string theory. AdS/CFT was first successfully applied to the study of phenomena such as the quark-gluon plasma produced in heavy ions collisions. Soon it was realized that its applicability can be extended, in a more phenomenological approach, to condensed matter systems and to systems described by fluid dynamics. The set of tutorial reviews in this volume is intended as an introduction to and survey of the principle of the AdS/CFT correspondence in its field/string theoretic formulation, its applicability to holographic QCD and to heavy ions collisions, and to give a first account of processes in fluid dynamics and condensed matter physics, which can be studied with the use of this principle. Written by leading researchers in the field and cast into the form of a high-level but approachable multi-author textbook, this volume will be of benefit to all postgraduate students, and newcomers from neighboring disciplines wishing to find a comprehensive guide for their future research. (orig.)

AdS/CFT correspondence, quasinormal modes, and thermal correlators in N=4 SYM

OpenAIRE

Nunez, Alvaro; Starinets, Andrei O.

2003-01-01

We use the Lorentzian AdS/CFT prescription to find the poles of the retarded thermal Green's functions of ${\\cal N=4}$ SU(N) SYM theory in the limit of large N and large 't Hooft coupling. In the process, we propose a natural definition for quasinormal modes in an asymptotically AdS spacetime, with boundary conditions dictated by the AdS/CFT correspondence. The corresponding frequencies determine the dispersion laws for the quasiparticle excitations in the dual finite-temperature gauge theory...

Test of the local form of higher-spin equations via AdS/CFT

Directory of Open Access Journals (Sweden)

V.E. Didenko

2017-12-01

Full Text Available The local form of higher-spin equations found recently to the second order [1] is shown to properly reproduce the anticipated AdS/CFT correlators for appropriate boundary conditions. It is argued that consistent AdS/CFT holography for the parity-broken boundary models needs a nontrivial modification of the bosonic truncation of the original higher-spin theory with the doubled number of fields, as well as a nonlinear deformation of the boundary conditions in the higher orders.

A CFT perspective on gravitational dressing and bulk locality

Energy Technology Data Exchange (ETDEWEB)

Lewkowycz, Aitor; Turiaci, Gustavo J. [Physics Department, Princeton University,Princeton, NJ 08544 (United States); Verlinde, Herman [Physics Department, Princeton University,Princeton, NJ 08544 (United States); Princeton Center for Theoretical Science, Princeton University,Princeton, NJ 08544 (United States)

2017-01-02

We revisit the construction of local bulk operators in AdS/CFT with special focus on gravitational dressing and its consequences for bulk locality. Specializing to 2+1-dimensions, we investigate these issues via the proposed identification between bulk operators and cross-cap boundary states. We obtain explicit expressions for correlation functions of bulk fields with boundary stress tensor insertions, and find that they are free of non-local branch cuts but do have non-local poles. We recover the HKLL recipe for restoring bulk locality for interacting fields as the outcome of a natural CFT crossing condition. We show that, in a suitable gauge, the cross-cap states solve the bulk wave equation for general background geometries, and satisfy a conformal Ward identity analogous to a soft graviton theorem. Virasoro symmetry, the large N conformal bootstrap and the uniformization theorem all play a key role in our derivations.

Logarithmic sℓ-hat (2) CFT models from Nichols algebras: I

International Nuclear Information System (INIS)

Semikhatov, A M; Tipunin, I Yu

2013-01-01

We construct chiral algebras that centralize rank-2 Nichols algebras with at least one fermionic generator. This gives ‘logarithmic’ W-algebra extensions of a fractional-level sℓ-hat (2) algebra. We discuss crucial aspects of the emerging general relation between Nichols algebras and logarithmic conformal field theory (CFT) models: (i) the extra input, beyond the Nichols algebra proper, needed to uniquely specify a conformal model; (ii) a relation between the CFT counterparts of Nichols algebras connected by Weyl groupoid maps; and (iii) the common double bosonization U(X) of such Nichols algebras. For an extended chiral algebra, candidates for its simple modules that are counterparts of the U(X) simple modules are proposed, as a first step toward a functorial relation between U(X) and W-algebra representation categories. (paper)

2D CFT blocks for the 4D class Sk theories

International Nuclear Information System (INIS)

Mitev, Vladimir; Pomoni, Elli

2017-03-01

This is the first in a series of papers on the search for the 2D CFT description of a large class of 4D N=1 gauge theories. Here, we identify the 2D CFT symmetry algebra and its representations, namely the conformal blocks of the Virasoro/W-algebra, that underlie the 2D theory and reproduce the Seiberg-Witten curves of the N=1 gauge theories. We find that the blocks corresponding to the SU(N) S k gauge theories involve fields in certain non-unitary representations of the W kN algebra. These conformal blocks give a prediction for the instanton partition functions of the 4D N=1 SCFTs of class S k .

Comparing AdS/CFT dipole model to HERA F2 data

International Nuclear Information System (INIS)

LU Zhun

2010-01-01

We apply an AdS/CFT-inspired color-dipole model which contains only three free parameters to describe the HERA data for the inclusive structure function F 2 at small Bjorken-x and virtuality. We found that the saturation scale in our AdS/CFT-based parameterization varies in the range of 1-3 GeV becoming independent of energy/Bjorken-x at very small x. This leads to the prediction of x-independence of the structure functions at very small x. With the fitted parameters in our model, the predictions for F 2 , longitudinal structure function, charm structure function and total photo-production cross-sections in the kinematic regions of future experiments can be given. (authors)

A rapid method combining Golgi and Nissl staining to study neuronal morphology and cytoarchitecture.

Science.gov (United States)

Pilati, Nadia; Barker, Matthew; Panteleimonitis, Sofoklis; Donga, Revers; Hamann, Martine

2008-06-01

The Golgi silver impregnation technique gives detailed information on neuronal morphology of the few neurons it labels, whereas the majority remain unstained. In contrast, the Nissl staining technique allows for consistent labeling of the whole neuronal population but gives very limited information on neuronal morphology. Most studies characterizing neuronal cell types in the context of their distribution within the tissue slice tend to use the Golgi silver impregnation technique for neuronal morphology followed by deimpregnation as a prerequisite for showing that neuron's histological location by subsequent Nissl staining. Here, we describe a rapid method combining Golgi silver impregnation with cresyl violet staining that provides a useful and simple approach to combining cellular morphology with cytoarchitecture without the need for deimpregnating the tissue. Our method allowed us to identify neurons of the facial nucleus and the supratrigeminal nucleus, as well as assessing cellular distribution within layers of the dorsal cochlear nucleus. With this method, we also have been able to directly compare morphological characteristics of neuronal somata at the dorsal cochlear nucleus when labeled with cresyl violet with those obtained with the Golgi method, and we found that cresyl violet-labeled cell bodies appear smaller at high cellular densities. Our observation suggests that cresyl violet staining is inadequate to quantify differences in soma sizes.

One-loop transition amplitudes in the D1D5 CFT

Energy Technology Data Exchange (ETDEWEB)

Carson, Zaq; Hampton, Shaun; Mathur, Samir D. [Department of Physics, The Ohio State University,191 West Woodruff Ave, Columbus, OH 43210 (United States)

2017-01-02

We consider the issue of thermalization in the D1D5 CFT. Thermalization is expected to correspond to the formation of a black hole in the dual gravity theory. We start from the orbifold point, where the theory is essentially free, and does not thermalize. In earlier work it was noted that there was no clear thermalization effect when the theory was deformed off the orbifold point to first order in the relevant twist perturbation. In this paper we consider the deformation to second order in the twist, where we do find effects that can cause thermalization of an initial perturbation. We consider a 1-loop process where two untwisted copies of the CFT are twisted to one copy and then again untwisted to two copies. We start with a single oscillator excitation on the initial CFT, and compute the effect of the two twists on this state. We find simple approximate expressions for the Bogoliubov coefficients and the behavior of the single oscillator excitation in the continuum limit, where the mode numbers involved are taken to be much larger than unity. We also prove a number of useful relationships valid for processes with an arbitrary number of twist insertions.

One-loop transition amplitudes in the D1D5 CFT

Science.gov (United States)

Carson, Zaq; Hampton, Shaun; Mathur, Samir D.

2017-01-01

We consider the issue of thermalization in the D1D5 CFT. Thermalization is expected to correspond to the formation of a black hole in the dual gravity theory. We start from the orbifold point, where the theory is essentially free, and does not thermalize. In earlier work it was noted that there was no clear thermalization effect when the theory was deformed off the orbifold point to first order in the relevant twist perturbation. In this paper we consider the deformation to second order in the twist, where we do find effects that can cause thermalization of an initial perturbation. We consider a 1-loop process where two untwisted copies of the CFT are twisted to one copy and then again untwisted to two copies. We start with a single oscillator excitation on the initial CFT, and compute the effect of the two twists on this state. We find simple approximate expressions for the Bogoliubov coefficients and the behavior of the single oscillator excitation in the continuum limit, where the mode numbers involved are taken to be much larger than unity. We also prove a number of useful relationships valid for processes with an arbitrary number of twist insertions.

Aspects of warped AdS3/CFT2 correspondence

Science.gov (United States)

Chen, Bin; Zhang, Jia-Ju; Zhang, Jian-Dong; Zhong, De-Liang

2013-04-01

In this paper we apply the thermodynamics method to investigate the holographic pictures for the BTZ black hole, the spacelike and the null warped black holes in three-dimensional topologically massive gravity (TMG) and new massive gravity (NMG). Even though there are higher derivative terms in these theories, the thermodynamics method is still effective. It gives consistent results with the ones obtained by using asymptotical symmetry group (ASG) analysis. In doing the ASG analysis we develop a brute-force realization of the Barnich-Brandt-Compere formalism with Mathematica code, which also allows us to calculate the masses and the angular momenta of the black holes. In particular, we propose the warped AdS3/CFT2 correspondence in the new massive gravity, which states that quantum gravity in the warped spacetime could holographically dual to a two-dimensional CFT with {c_R}={c_L}=24 /{Gm{β^2√{{2( {21-4{β^2}} )}}}}.

Deformed D1D5 CFT: A Holographic Probe of Quantum Gravity

Science.gov (United States)

Jardine, Ian Theodore

One of the big unsolved questions in gravity research is the black hole information problem. This problem, which pits the unitarity of quantum field theory against smooth classical spacetime, must have a solution in a complete theory of quantum gravity. This thesis will explore aspects of one approach to this problem in the context of string theory. The approach imagines black hole microstates as string theoretic objects. We look at a prototype system, the D1D5 system, and exploit holography to examine the dual conformal field theory (CFT). Specifically, we examine the CFT deformed from the free orbifold point, dual to a very stringy bulk, using a twisted operator that will take us towards the point with the supergravity description. The effects of twisted operators in the CFT are key to understanding physical processes such as emission and thermalization in black hole microstates. We will propose a component twist method for examining the effects of bare twist operators for higher twists in the continuum limit. Our method builds higher twists from simple 2-cycle twists, whose effects are known. We will find that, in this limit, the coefficients describing general states will follow a conjectured general functional form. We then explore the deformed CFT directly by examining operator mixing for untwisted operators. We will exploit the operator product expansion on the covering space, where twist operators of the orbifold are resolved. We use this to examine the mixing of a general supergravity operator, specifically examine the dilaton, and finish with the mixing of a non-supersymmetric candidate operator. We conjecture that this method could be extended to include twisted operators. We will also examine the mixing of the non-supersymmetric candidate operator by examining three point functions. To automate the lengthy and repetitive computations, we wrote a Mathematica package to compute correlation functions and OPEs in the D1D5 CFT. We will explain some of the

Hawking radiation and quantum anomaly in AdS2/CFT1 correspondence

International Nuclear Information System (INIS)

Morita, Takeshi

2009-01-01

In order to understand a boundary description of Hawking radiation in the AdS/CFT correspondence, we investigate the trace anomaly method in AdS 2 space. In this method, Hawking radiation is derived from the trace anomaly of the energy-momentum tensor in the bulk. We find a correspondence between the energy-momentum tensor and a composite operator in CFT 1 and understand the anomalous properties of the energy-momentum tensor in terms of this composite operator. By using this correspondence, we reproduce Hawking radiation from the boundary description. In addition, we find a correspondence between higher-spin currents in the bulk and composite operators in the boundary.

Degenerate stars and gravitational collapse in AdS/CFT

NARCIS (Netherlands)

Arsiwala, X.; de Boer, J.; Papadodimas, K.; Verlinde, E.

2010-01-01

We construct composite CFT operators from a large number of fermionic primary fields corresponding to states that are holographically dual to a zero temperature Fermi gas in AdS space. We identify a large N regime in which the fermions behave as free particles. In the hydrodynamic limit the Fermi

Degenerate stars and gravitational collapse in AdS/CFT

NARCIS (Netherlands)

Arsiwalla, X.; de Boer, J.; Papadodimas, K.; Verlinde, E.

2011-01-01

We construct composite CFT operators from a large number of fermionic primary fields corresponding to states that are holographically dual to a zero temperature Fermi gas in AdS space. We identify a large N regime in which the fermions behave as free particles. In the hydrodynamic limit the Fermi

Degenerate stars and gravitational collapse in AdS/CFT

NARCIS (Netherlands)

Arsiwalla, Xerxes; de Boer, Jan; Papadodimas, Kyriakos; Verlinde, Erik

We construct composite CFT operators from a large number of fermionic primary fields corresponding to states that are holographically dual to a zero temperature Fermi gas in AdS space. We identify a large N regime in which the fermions behave as free particles. In the hydrodynamic limit the Fermi

A comment on the infra-red problem in the AdS/CFT correspondence

International Nuclear Information System (INIS)

Gottschalk, Hanno; Thaler, Horst

2008-01-01

In this note we report on some recent progress in proving the AdS/CFT correspondence for quantum fields using rigorously defined Euclidean path integrals. We also comment on the infra-red problem in the AdS/CFT correspondence and argue that it is different from the usual IR problem in constructive quantum field theory. To illustrate this, a triviality proof based on hypercontractivity estimates is given for the case of an ultraviolet regularized potential of type: φ 4 :. We also give a brief discussion on possible renormalization strategies and the specific problems that arise in this context. (orig.)

A comment on the infra-red problem in the AdS/CFT correspondence

Energy Technology Data Exchange (ETDEWEB)

Gottschalk, Hanno; Thaler, Horst

2008-03-15

In this note we report on some recent progress in proving the AdS/CFT correspondence for quantum fields using rigorously defined Euclidean path integrals. We also comment on the infra-red problem in the AdS/CFT correspondence and argue that it is different from the usual IR problem in constructive quantum field theory. To illustrate this, a triviality proof based on hypercontractivity estimates is given for the case of an ultraviolet regularized potential of type: {phi}{sup 4}:. We also give a brief discussion on possible renormalization strategies and the specific problems that arise in this context. (orig.)

Composite fields, generalized hypergeometric functions and the U(1)Y symmetry in the AdS/CFT correspondence

International Nuclear Information System (INIS)

Hoffmann, L.; Leonhardt, T.; Mesref, L.; Ruehl, W.

2001-01-01

We discuss the concept of composite fields in flat CFT as well as in the context of AdS/CFT. Furthermore we show how to represent Green functions using generalized hypergeometric functions and apply these techniques to four-point functions. Finally we prove an identity of U(1) Y symmetry for four-point functions

Composite fields, generalized hypergeometric functions and the U(1)Y symmetry in the AdS/CFT correspondence

Science.gov (United States)

Hoffmann, L.; Leonhardt, T.; Mesref, L.; Rühl, W.

2001-09-01

We discuss the concept of composite fields in flat CFT as well as in the context of AdS/CFT. Furthermore we show how to represent Green functions using generalized hypergeometric functions and apply these techniques to four-point functions. Finally we prove an identity of U(1)Y symmetry for four-point functions.

Modifications to holographic entanglement entropy in warped CFT

Energy Technology Data Exchange (ETDEWEB)

Song, Wei; Wen, Qiang; Xu, Jianfei [Yau Mathematical Sciences Center, Tsinghua University,Beijing 100084 (China)

2017-02-13

In https://www.doi.org/10.1103/PhysRevLett.117.011602 it was observed that asymptotic boundary conditions play an important role in the study of holographic entanglement beyond AdS/CFT. In particular, the Ryu-Takayanagi proposal must be modified for warped AdS{sub 3} (WAdS{sub 3}) with Dirichlet boundary conditions. In this paper, we consider AdS{sub 3} and WAdS{sub 3} with Dirichlet-Neumann boundary conditions. The conjectured holographic duals are warped conformal field theories (WCFTs), featuring a Virasoro-Kac-Moody algebra. We provide a holographic calculation of the entanglement entropy and Rényi entropy using AdS{sub 3}/WCFT and WAdS{sub 3}/WCFT dualities. Our bulk results are consistent with the WCFT results derived by Castro-Hofman-Iqbal using the Rindler method. Comparing with https://www.doi.org/10.1103/PhysRevLett.117.011602, we explicitly show that the holographic entanglement entropy is indeed affected by boundary conditions. Both results differ from the Ryu-Takayanagi proposal, indicating new relations between spacetime geometry and quantum entanglement for holographic dualities beyond AdS/CFT.

Indenopyride derivative RTI-4587-073(l): a candidate for male contraception in stallions.

Science.gov (United States)

Pozor, Malgorzata A; Macpherson, Margo L; McDonnell, Sue M; Nollin, Maggie; Roser, Janet F; Love, Charles; Runyon, Scott; Thomas, Brian F; Troedsson, Mats H

2013-12-01

The objective of this study was to determine whether an indenopyridine derivative RTI-4587-073(l) was a good candidate for male contraception in horses. We hypothesized that a single administration of RTI-4587-073(l) causes significant suppression of testicular function in stallions without affecting sexual behavior. Three Miniature horse stallions received a single dose of 12.5 mg/kg RTI-4587-073(l) orally (group "treated"), whereas three other Miniature horse stallions received placebo only (group "control"). Semen was collected and evaluated from all stallions twice a week for three baseline weeks and 13 post-treatment weeks. Sexual behavior was video-recorded and analyzed. Testicular dimensions were measured using ultrasonography, and blood samples were drawn for endocrine evaluation once before treatment and once a week during the post-treatment period. Single administration of RTI-4587-073(l) caused severe oligoasthenozoospermia (low sperm number and low motility), shedding large numbers of immature germ cells in semen, and increased FSH concentrations in treated stallions. These effects were fully reversible within ∼71 days. However, libido and copulatory behavior remained unchanged throughout the entire experiment. We concluded that RTI-4587-073(l) was a promising candidate for male contraceptive in domestic stallions. Further research should be performed to test this compound for fertility control in wildlife and humans. Copyright © 2013 Elsevier Inc. All rights reserved.

Capacidad resistente de pilas metálicas tubulares circulares rellenas de hormigón (CFT en puentes integrales

Directory of Open Access Journals (Sweden)

Chacón, R.

2012-09-01

Full Text Available In this paper, an in-depth analysis of the structural response of concrete-filled tubular structures (CFT is presented. The main objective of the study is to assess the resistance of these structural elements when subjected to lateral displacements. These displacements, together with the corresponding axial forces, represent the actions to which the integral bridges piers are subjected to. For the sake of studying this response, a numerical model is used as a simulation tool over an hypothetical matrix of CFT. These numerical studies together with a wide experimental database found in the literature have been useful for drawing conclusions concerning the cross-sectional capacity of the CFT. A design proposal for this cross-sectional capacity which accounts for confinement is given. This proposal has been compared structurally with the present formulation found in EN1994.

Se presenta el análisis estructural de pilas metálicas tubulares rellenas de hormigón (CFT sometidas a flexo-compresión. El objetivo principal es valorar los mecanismos resistentes de las pilas cuando se someten a un desplazamiento en cabeza. Estos desplazamientos, conjuntamente con el esfuerzo axil de compresión, que en este trabajo se aproxima con un porcentaje de la resistencia plástica a compresión de los CFT, representan las acciones a las cuales se ven sometidos los elementos de este estudio. Se utiliza una herramienta numérica sobre una base hipotética de prototipos de pilas. Los resultados numéricos obtenidos así como los resultados experimentales encontrados en la literatura han permitido extraer conclusiones relativas a la capacidad seccional de los CFT. Se proponen expresiones de diseño relativas a la capacidad resistente de los CFT considerando el efecto del confinamiento y se comparan con los resultados que se derivan de la formulación de EN1994.

1-loop partition function in AdS{sub 3}/CFT{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Chen, Bin [Department of Physics and State Key Laboratory of Nuclear Physics and Technology,Peking University,5 Yiheyuan Rd, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter,5 Yiheyuan Rd, Beijing 100871 (China); Center for High Energy Physics, Peking University,5 Yiheyuan Rd, Beijing 100871 (China); Wu, Jie-qiang [Department of Physics and State Key Laboratory of Nuclear Physics and Technology,Peking University,5 Yiheyuan Rd, Beijing 100871 (China)

2015-12-16

The 1-loop partition function of the handlebody solutions in the AdS{sub 3} gravity have been derived some years ago using the heat kernel techniques and the method of images. In the semiclassical limit, such partition function should correspond to the order O(c{sup 0}) part in the partition function of dual conformal field theory(CFT) on the boundary Riemann surface. The higher genus partition function could be computed by the multi-point functions in the Riemann sphere via sewing prescription. In the large central charge limit, the CFT is effectively free in the sense that to the leading order of c the multi-point function is further simplified to be a summation over the products of two-point functions of single-particle states. Correspondingly in the bulk, the graviton is freely propagating without interaction. Furthermore the product of the two-point functions may define the links, each of which is in one-to-one correspondence with the conjugacy class of the Schottky group of the Riemann surface. Moreover, the value of a link is determined by the multiplier of the element in the conjugacy class. This allows us to reproduce exactly the gravitational 1-loop partition function. The proof can be generalized to the higher spin gravity and its dual CFT.

The Kerr/CFT Correspondence and its Extensions

Directory of Open Access Journals (Sweden)

Geoffrey Compère

2012-10-01

Full Text Available We present a first-principles derivation of the main results of the Kerr/CFT correspondence and its extensions using only tools from gravity and quantum field theory, filling a few gaps in the literature when necessary. Firstly, we review properties of extremal black holes that imply, according to semi-classical quantization rules, that their near-horizon quantum states form a centrally-extended representation of the one-dimensional conformal group. This motivates the conjecture that the extremal Kerr and Reissner–Nordström black holes are dual to the chiral limit of a two-dimensional CFT. We also motivate the existence of an SL (2,ℤ family of two-dimensional CFTs, which describe in their chiral limit the extremal Kerr–Newman black hole. We present generalizations in anti-de Sitter spacetime and discuss other matter-coupling and higher-derivative corrections. Secondly, we show how a near-chiral limit of these CFTs reproduces the dynamics of near-superradiant probes around near-extremal black holes in the semi-classical limit. Thirdly, we review how the hidden conformal symmetries of asymptotically-flat black holes away from extremality, combined with their properties at extremality, allow for a microscopic accounting of the entropy of non-extremal asymptotically-flat rotating or charged black holes. We conclude with a list of open problems.

Intramacrophage survival of uropathogenic Escherichia coli: Differences between diverse clinical isolates and between mouse and human macrophages

DEFF Research Database (Denmark)

Bokil, Nilesh J.; Totsika, Makrina; Carey, Alison J.

2011-01-01

assays, CFT073 was able to survive within primary mouse bone marrow-derived macrophages (BMM) up to 24h post-infection. Three additional well-characterized clinical UPEC isolates associated with distinct UTI symptomatologies displayed variable long-term survival within BMM. UPEC strains UTI89 and VR50...... or initial uptake of bacteria. E. coli UTI89 localized to a Lamp1+ vesicular compartment within BMM. In contrast to survival within mouse BMM, intracellular bacterial loads of VR50 were low in both human monocyte-derived macrophages (HMDM) and in human T24 bladder epithelial cells. Collectively, these data...

Fermionic halos at finite temperature in AdS/CFT

Science.gov (United States)

Argüelles, Carlos R.; Grandi, Nicolás E.

2018-05-01

We explore the gravitational backreaction of a system consisting in a very large number of elementary fermions at finite temperature, in asymptotically AdS space. We work in the hydrodynamic approximation, and solve the Tolman-Oppenheimer-Volkoff equations with a perfect fluid whose equation of state takes into account both the relativistic effects of the fermionic constituents, as well as its finite temperature effects. We find a novel dense core-diluted halo structure for the density profiles in the AdS bulk, similarly as recently reported in flat space, for the case of astrophysical dark matter halos in galaxies. We further study the critical equilibrium configurations above which the core undergoes gravitational collapse towards a massive black hole, and calculate the corresponding critical central temperatures, for two qualitatively different central regimes of the fermions: the diluted-Fermi case, and the degenerate case. As a probe for the dual CFT, we construct the holographic two-point correlator of a scalar operator with large conformal dimension in the worldline limit, and briefly discuss on the boundary CFT effects at the critical points.

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available DDQQREKVVMGRGIGFQKRPGERINSSGIEKEYAL 60 ... MQITKIL ... IDDQQREKVVMGRGIGFQKRPGERINSS...GIEKEYAL Sbjct: 1 ... MQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRPGERINSSGIEKEYAL 50 ... ... operon Antiterminator [Escherichia coli CFT073] ... Length = 50 ... Query: 11 MQITKILXXXXXXXI

Scalar 3-point functions in CFT: renormalisation, beta functions and anomalies

Science.gov (United States)

Bzowski, Adam; McFadden, Paul; Skenderis, Kostas

2016-03-01

We present a comprehensive discussion of renormalisation of 3-point functions of scalar operators in conformal field theories in general dimension. We have previously shown that conformal symmetry uniquely determines the momentum-space 3-point functions in terms of certain integrals involving a product of three Bessel functions (triple- K integrals). The triple- K integrals diverge when the dimensions of operators satisfy certain relations and we discuss how to obtain renormalised 3-point functions in all cases. There are three different types of divergences: ultralocal, semilocal and nonlocal, and a given divergent triple- K integral may have any combination of them. Ultralocal divergences may be removed using local counterterms and this results in new conformal anomalies. Semilocal divergences may be removed by renormalising the sources, and this results in CFT correlators that satisfy Callan-Symanzik equations with beta functions. In the case of non-local divergences, it is the triple- K representation that is singular, not the 3-point function. Here, the CFT correlator is the coefficient of the leading nonlocal singularity, which satisfies all the expected conformal Ward identities. Such correlators exhibit enhanced symmetry: they are also invariant under dual conformal transformations where the momenta play the role of coordinates. When both anomalies and beta functions are present the correlators exhibit novel analytic structure containing products of logarithms of momenta. We illustrate our discussion with numerous examples, including free field realisations and AdS/CFT computations.

Discontinuity relations for the AdS{sub 4}/CFT{sub 3} correspondence

Energy Technology Data Exchange (ETDEWEB)

Cavaglià, Andrea, E-mail: Cavaglia@to.infn.it [Centre for Mathematical Science, City University London, Northampton Square, London EC1V 0HB (United Kingdom); Dipartimento di Fisica and INFN, Università di Torino, Via P. Giuria 1, 10125 Torino (Italy); Fioravanti, Davide, E-mail: Fioravanti@bo.infn.it [INFN-Bologna and Dipartimento di Fisica e Astronomia, Università di Bologna, Via Irnerio 46, 40126 Bologna (Italy); Tateo, Roberto, E-mail: Tateo@to.infn.it [Dipartimento di Fisica and INFN, Università di Torino, Via P. Giuria 1, 10125 Torino (Italy)

2013-12-21

We study in detail the analytic properties of the Thermodynamic Bethe Ansatz (TBA) equations for the anomalous dimensions of composite operators in the planar limit of the 3D N=6 superconformal Chern–Simons gauge theory and derive functional relations for the jump discontinuities across the branch cuts in the complex rapidity plane. These relations encode the analytic structure of the Y functions and are extremely similar to the ones obtained for the previously-studied AdS{sub 5}/CFT{sub 4} case. Together with the Y-system and more basic analyticity conditions, they are completely equivalent to the TBA equations. We expect these results to be useful to derive alternative nonlinear integral equations for the AdS{sub 4}/CFT{sub 3} spectrum.

The neuronal structure of paramamillary nuclei in Bison bonasus: Nissl and Golgi pictures.

Science.gov (United States)

Robak, A; Szteyn, S; Równiak, M

1998-01-01

The studies were carried out on the hypothalamus of bison bonasus aged 2 and 3 months. Sections were made by means of Bagiński's technique and Nissl and Klüver-Barrera methods. Four types of neurons were distinguished in the paramamillary nuclei: nucleus supramamillaris (Sm) and nucleus tuberomammillaris pars posterior (Tmp). Type I, small and medium-size, triangular or fusiform cells, which have 2-3 slender, poorly ramified dendrites; typical leptodendritic neurons. Type II, medium size neurons with quadrangular or spindle-shaped perikaryons. Most of them have 3-4 thick dendritic trunks with ramifying relatively long dendrites. These cells show stalked-appearance and possess different appendages sparsely distributed. Type III is similar to type II, but is made of medium-size to large multipolar cells having quadrangular, triangular or fusiform perikaryons and relatively short dendrites. Type IV, small and medium-size, globular cells with 2 or 3 dendritic trunks, which dichotomously subdivide into quaternary dendrites. In all types of neurons, axons emerge from the perikaryon or initial portion of a dendritic trunk. Type I was found in both studied nuclei. Types II and III constitute mainly the nucleus tuberomamillaris pars posterior. Type IV preponderate in the nucleus supramamillaris. The characteristic feature of Tmp cells, in Nissl picture was irregular contour of their somas and clumps of rough Nisls granules, which appear to lie outside the perikaryons. In Sm there were also lightly stained small rounded cells having both small amount of the cytoplasm and tigroid matter.

International Organization of Standardization (ISO) and Cambridge Filter Test (CFT) Smoking Regimen Data Comparisons in Tobacco Product Marketing Applications.

Science.gov (United States)

Chae, Changyu; Walters, Matthew J; Holman, Matthew R

2017-07-01

We investigated the differences in TNCO (tar, nicotine, and carbon monoxide) smoke yields generated under the International Organization of Standardization (ISO) and Federal Trade Commission (FTC) Cambridge Filter Test (CFT) smoking regimens. Twenty-nine commercial cigarette products from the US marketplace were acquired in 2015 and tested by measuring the TNCO smoke yields generated under these 2 nonintense smoking regimens. Data obtained demonstrated a linear relationship between the TNCO yields produced under the 2 smoking regimens (R 2 > 0.99). TNCO yields produced by each product were higher under the CFT smoking regimen than the ISO smoking regimen. We found that tar, nicotine, and carbon monoxide yields were consistently 10% to 13% higher under the CFT smoking regimen than under the ISO smoking regimen. This strong correlation indicates that the 2 smoking regimens can be used to apply a correlation correction to CFT TNCO data and allow its comparison to ISO TNCO data in tobacco product marketing applications.

Serological diagnosis of bovine brucellosis using B. melitensis strain B115.

Science.gov (United States)

Corrente, Marialaura; Desario, Costantina; Parisi, Antonio; Grandolfo, Erika; Scaltrito, Domenico; Vesco, Gesualdo; Colao, Valeriana; Buonavoglia, Domenico

2015-12-01

Bovine brucellosis is diagnosed by official tests, such as Rose Bengal plate test (RBPT) and Complement Fixation test (CFT). Both tests detect antibodies directed against the lipolysaccharide (LPS) of Brucella cell wall. Despite their good sensitivity, those tests do not discriminate between true positive and false positive serological reactions (FPSR), the latter being generated by animals infected with other Gram negative microorganisms that share components of Brucella LPS. In this study, an antigenic extract from whole Brucella melitensis B115 strain was used to set up an ELISA assay for the serological diagnosis of bovine brucellosis. A total of 148 serum samples from five different groups of animals were tested: Group A: 28 samples from two calves experimentally infected with Yersinia enterocolitica O:9; Group B: 30 samples from bovines infected with Brucella abortus; Group C: 50 samples from brucellosis-free herds; Group D: 20 samples RBPT positive and CFT negative; Group E: 20 samples both RBPT and CFT positive. Group D and Group E serum samples were from brucellosis-free herds. Positive reactions were detected only by RBPT and CFT in calves immunized with Y. enterocolitica O:9. Sera from Group B animals tested positive also in the ELISA assay, whereas sera from the remaining groups were all negative. The results obtained encourage the use of the ELISA assay to implement the serological diagnosis of brucellosis. Copyright © 2015 Elsevier B.V. All rights reserved.

Brain morphology imaging by 3D microscopy and fluorescent Nissl staining.

Science.gov (United States)

Lazutkin, A A; Komissarova, N V; Toptunov, D M; Anokhin, K V

2013-07-01

Modern optical methods (multiphoton and light-sheet fluorescent microscopy) allow 3D imaging of large specimens of the brain with cell resolution. It is therefore essential to refer the resultant 3D pictures of expression of transgene, protein, and other markers in the brain to the corresponding structures in the atlas. This implies counterstaining of specimens with morphological dyes. However, there are no methods for contrasting large samples of the brain without their preliminary slicing. We have developed a method for fluorescent Nissl staining of whole brain samples. 3D reconstructions of specimens of the hippocampus, olfactory bulbs, and cortex were created. The method can be used for morphological control and evaluation of the effects of various factors on the brain using 3D microscopy technique.

An alternative path to the boundary: The CFT as the Fourier space of AdS

Science.gov (United States)

Tolfree, Ian M.

2009-12-01

In this thesis we shed new light on the conjectured duality between an n + 1 dimensional theory of gravity in anti de Sitter space (AdS) and an n dimensional conformal field theory (CFT) by showing that the CFT can be interpreted as the Fourier space of AdS. We then make use of this to gain insight into the nature of black hole entropy. In the first part of this thesis, we give an introduction to the ideas of and review the basics of the AdS/CFT. In the next section we make use of well known integral geometry techniques to derive the Fourier transformation of a function on AdS and see it is a function with compact support on the boundary. Comparing this to the literature, we find that the Green's functions from the literature are actually the Fourier weights of the transformation and that the boundary values of fields appearing in the correspondence are the Fourier coefficients of the transformation. One is thus left to interpret the CFT as the quantized version of a classical theory in AdS and the dual operator as the Fourier coefficients. Group theoretic considerations are discussed in relation to the transformation and its potential use in constructing QCD like theories. In the last section, we then build upon this to study the BTZ black hole. Named after its authors, Banados, Teitelboim and Zanelli, the BTZ black hole is a three dimensional (two space plus one time dimension) black hole in anti de Sitter space. Following standard procedures for modifying Fourier Transformations to accommodate quotient spaces we arrive at a mapping in a black hole background consistent with known results that yields the exact micro-states of a scalar field in a black hole background. We find that the micro-states are the Fourier coefficients on the boundary, which transform under the principal series representation of SL(2, R). Using the knowledge of how to represent a bulk scalar field in the CFT, and knowing how a black hole interacts with a scalar field, we deduce the

Global gene expression profiling of asymptomatic bacteriuria Escherichia coli during biofilm growth in human urine

DEFF Research Database (Denmark)

Hancock, Viktoria; Klemm, Per

2007-01-01

Urinary tract infection (UTI) is an important health problem worldwide, with many millions of cases each year, and Escherichia coli is the most common organism causing UTI in humans. Also, E. coli is responsible for most infections in patients with chronic indwelling bladder catheter. The two...... asymptomatic bacteriuria (ABU) E. coli strains 83972 and VR50 are significantly better biofilm formers in their natural growth medium, human urine, than the two uropathogenic E. coli isolates CFT073 and 536. We used DNA microarrays to monitor the expression profile during biofilm growth in urine of the two ABU...... strains 83972 and VR50. Significant differences in expression levels were seen between the biofilm expression profiles of the two strains with the corresponding planktonic expression profiles in morpholinepropanesulfonic acid minimal laboratory medium and human urine; 417 and 355 genes were up- and down...

On AdS/CFT correspondence beyond SUGRA: plane waves, free CFTs and double-trace deformations

Energy Technology Data Exchange (ETDEWEB)

Diaz Vazquez, D.E.

2007-09-13

This thesis deals with three corners of the AdS/CFT Correspondence that lie one step beyond the classical supergravity (SUGRA) approximation. We first explore the BMN limit of the duality and study, in particular, the behavior of field theoretic propagators in the corresponding Penrose limit. We unravel the semiclassical (WKB-) exactness of the propagators in the resulting plane wave background metric. Then, we address the limit of vanishing coupling of the conformal field theory (CFT) at large N. In the simplified scenario of Higher Spin/O(N) Vector Model duality, the conformal partial wave (CPW) expansion of scalar four-point functions are reorganized to make them suggestive of a bulk interpretation in term of a consistent truncated massless higher spin theory and their corresponding exchange Witten graphs. We also explore the connection to the interacting O(N) Vector Model at its infra-red fixed point, at leading large N. Finally, coming back to the gauge theory, we study the effect of a relevant double-trace deformations of the boundary CFT on the partition function and its dual bulk interpretation. We show how the one-loop computation in the Anti-de Sitter (AdS) space correctly reproduces the partition function and conformal anomaly of the boundary theory. In all, we get a clean test of the duality beyond the classical SUGRA approximation in the AdS bulk and at the corresponding next-to-leading 1/N order of the CFT at the conformal boundary. (orig.)

On AdS/CFT correspondence beyond SUGRA: plane waves, free CFTs and double-trace deformations

International Nuclear Information System (INIS)

Diaz Vazquez, D.E.

2007-01-01

This thesis deals with three corners of the AdS/CFT Correspondence that lie one step beyond the classical supergravity (SUGRA) approximation. We first explore the BMN limit of the duality and study, in particular, the behavior of field theoretic propagators in the corresponding Penrose limit. We unravel the semiclassical (WKB-) exactness of the propagators in the resulting plane wave background metric. Then, we address the limit of vanishing coupling of the conformal field theory (CFT) at large N. In the simplified scenario of Higher Spin/O(N) Vector Model duality, the conformal partial wave (CPW) expansion of scalar four-point functions are reorganized to make them suggestive of a bulk interpretation in term of a consistent truncated massless higher spin theory and their corresponding exchange Witten graphs. We also explore the connection to the interacting O(N) Vector Model at its infra-red fixed point, at leading large N. Finally, coming back to the gauge theory, we study the effect of a relevant double-trace deformations of the boundary CFT on the partition function and its dual bulk interpretation. We show how the one-loop computation in the Anti-de Sitter (AdS) space correctly reproduces the partition function and conformal anomaly of the boundary theory. In all, we get a clean test of the duality beyond the classical SUGRA approximation in the AdS bulk and at the corresponding next-to-leading 1/N order of the CFT at the conformal boundary. (orig.)

Brucella abortus Strain RB51 Vaccine: Immune Response after Calfhood Vaccination and Field Investigation in Italian Cattle Population

Directory of Open Access Journals (Sweden)

Manuela Tittarelli

2008-01-01

Full Text Available Immune response to Brucella abortus strain RB51 vaccine was measured in cattle vaccinated at calfhood. After an increase at day 6 post-vaccination (pv, the antibody level recorded in the 10 vaccinated animals remained constant for two months, and then progressively decreased. All vaccinated animals remained negative from day 162 pv to the end of the study (day 300 pv. Only at days 13 and 14 pv the RB51-CFT showed 100% sensitivity (credibility interval (CI 76.2%–100%. The results indicate that the possibility to use RB51-CFT for the identification of cattle vaccinated at calfhood with RB51 is limited in time. A field investigation was carried out on 26,975 sera collected on regional basis from the Italian cattle population. The study outcomes indicate that in case of RB51-CFT positive results observed in officially Brucellosis-free (OBF areas and, in any case, when an illegal use of RB51 vaccine is suspected, the use of the RB51-CFT alone is not sufficient to identify all the vaccinated animals. The design of a more sophisticated diagnostic protocol including an epidemiological investigation, the use of RB51-CFT, and the use of the skin test with RB51 as antigen is deemed more appropriate for the identification of RB51 vaccinated animals.

Precursors, gauge invariance, and quantum error correction in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Freivogel, Ben; Jefferson, Robert A.; Kabir, Laurens [ITFA and GRAPPA, Universiteit van Amsterdam,Science Park 904, Amsterdam (Netherlands)

2016-04-19

A puzzling aspect of the AdS/CFT correspondence is that a single bulk operator can be mapped to multiple different boundary operators, or precursors. By improving upon a recent model of Mintun, Polchinski, and Rosenhaus, we demonstrate explicitly how this ambiguity arises in a simple model of the field theory. In particular, we show how gauge invariance in the boundary theory manifests as a freedom in the smearing function used in the bulk-boundary mapping, and explicitly show how this freedom can be used to localize the precursor in different spatial regions. We also show how the ambiguity can be understood in terms of quantum error correction, by appealing to the entanglement present in the CFT. The concordance of these two approaches suggests that gauge invariance and entanglement in the boundary field theory are intimately connected to the reconstruction of local operators in the dual spacetime.

Stability of Horava-Lifshitz black holes in the context of AdS/CFT

International Nuclear Information System (INIS)

Ong, Yen Chin; Chen, Pisin

2011-01-01

The anti-de Sitter/conformal field theory (AdS/CFT) correspondence is a powerful tool that promises to provide new insights toward a full understanding of field theories under extreme conditions, including but not limited to quark-gluon plasma, Fermi liquid, and superconductor. In many such applications, one typically models the field theory with asymptotically AdS black holes. These black holes are subjected to stringy effects that might render them unstable. Horava-Lifshitz gravity, in which space and time undergo different transformations, has attracted attention due to its power-counting renormalizability. In terms of AdS/CFT correspondence, Horava-Lifshitz black holes might be useful to model holographic superconductors with Lifshitz scaling symmetry. It is thus interesting to study the stringy stability of Horava-Lifshitz black holes in the context of AdS/CFT. We find that uncharged topological black holes in λ=1 Horava-Lifshitz theory are nonperturbatively stable, unlike their counterparts in Einstein gravity, with the possible exceptions of negatively curved black holes with detailed balance parameter ε close to unity. Sufficiently charged flat black holes for ε close to unity, and sufficiently charged positively curved black holes with ε close to zero, are also unstable. The implication to the Horava-Lifshitz holographic superconductor is discussed.

Characteristics of Escherichia coli causing persistence or relapse of urinary tract infections

DEFF Research Database (Denmark)

Ejrnæs, Karen; Stegger, Marc; Reisner, Andreas

2011-01-01

Recurrent urinary tract infections (RUTIs) pose a major problem but little is known about characteristics of Escherichia coli associated with RUTI. This study includes E. coli from 155 women with community-acquired lower urinary tract infections (UTIs) randomized to one of three dosing regiments...... of persistence or relapse of UTI compared with three days. In vitro biofilm formation was not higher among E. coli causing persistence or relapse. The presence of agn43a(CFT073) or agn43b(CFT073) was associated with biofilm forming capacity. In conclusion, our results show potential targets for prevention...... and treatment of persistence/relapse of UTI and potential markers for selecting treatment lengths and warrant studies of these and new VFGs....

A non-supersymmetric deformation of the AdS/CFT correspondence

International Nuclear Information System (INIS)

Babington, James; Crooks, David E.; Evans, Nick

2003-01-01

We deform the AdS/CFT Correspondence by the inclusion of a non-supersymmetric scalar mass operator. We discuss the behaviour of the dual 5 dimensional supergravity field then lift the full solution to 10 dimensions. Brane probing the resulting background reveals a potential consistent with the operator we wished to insert. (author)

Old and new diagnostic approaches for Q fever diagnosis: correlation among serological (CFT, ELISA) and molecular analyses.

Science.gov (United States)

Natale, A; Bucci, G; Capello, K; Barberio, A; Tavella, A; Nardelli, S; Marangon, S; Ceglie, L

2012-07-01

The objective of this study was to evaluate the performance of the complement fixation test (CFT) with respect to ELISA for the serological diagnosis of Q fever and to assess the role of serology as a tool for the identification of the shedder status. During 2009-2010, sera from 9635 bovines and 3872 small ruminants (3057 goats and 815 sheep) were collected and analyzed with CFT and ELISA. In addition, 2256 bovine, 139 caprine and 72 ovine samples (individual and bulk tank milk samples, fetuses, vaginal swabs and placentae) were analyzed with a real-time PCR kit. The relative sensitivity (Se) and specificity (Sp) of CFT with respect to ELISA were Se 26.56% and Sp 99.71% for cattle and Se 9.96% and Sp 99.94% for small ruminants. To evaluate the correlation between serum-positive status and shedder status, the ELISA, CFT and real-time PCR results were compared. Due to the sampling method and the data storage system, the analysis of individual associations between the serological and molecular tests was possible only for some of the bovine samples. From a statistical point of view, no agreement was observed between the serological and molecular results obtained for fetus and vaginal swab samples. Slightly better agreement was observed between the serological and molecular results obtained for the individual milk samples and between the serological (at least one positive in the examined group) and molecular results for the bulk tank milk (BTM) samples. The CFT results exhibited a better correlation with the shedder status than did the ELISA results. Copyright © 2012 Elsevier Ltd. All rights reserved.

The human amygdaloid complex: a cytologic and histochemical atlas using Nissl, myelin, acetylcholinesterase and nicotinamide adenine dinucleotide phosphate diaphorase staining.

Science.gov (United States)

Sims, K S; Williams, R S

1990-01-01

We examined the distribution of acetylcholinesterase and nicotinamide adenine dinucleotide phosphate diaphorase enzyme activity in the human amygdala using histochemical techniques. Both methods revealed compartments of higher or lower enzyme activity, in cells or neuropil, which corresponded to the nuclear subdivisions of the amygdala as defined with classical Nissl and myelin methods. The boundaries between the histochemical compartments were usually so sharp that the identification of these nuclear subdivisions was enhanced. There was also variation of staining intensity within many of the nuclear subdivisions, such as the lateral and central nuclei, anterior amygdaloid area and the intercalated groups. This histochemical difference corresponded to more subtle differences in Nissl and myelin staining patterns, and suggests further structural subdivisions of potential functional significance. We present a revised scheme of anatomical parcellation of the human amygdala based upon serial analysis with all four techniques. Our expectation is that this will allow the delineation of a clearer homology between the cytoarchitectonic subdivisions of the human amygdala and those of experimental animals.

Rotating strings in confining AdS/CFT backgrounds

International Nuclear Information System (INIS)

Armoni, Adi; Barbon, Jose L.F.; Petkou, Anastasios C.

2002-01-01

We study semiclassical rotating strings in AdS/CFT backgrounds that exhibit both confinement and finite-size effects. The energy versus spin dispersion relation for short strings is the expected Regge trajectory behaviour, with the same string tension as is measured by the Wilson loop. Long strings probe the interplay between confinement and finite-size effects. In particular, the dispersion relation for long strings shows a characteristic dependence on the string tension and the finite-size scale. (author)

New results for AdS/CFT and beyond

International Nuclear Information System (INIS)

Bertolini, M.; Bigazzi, F.; Cotrone, A.L.

2006-01-01

We report on some recent results within the string/gauge theory correspondence, both in the conformal and in the non conformal cases, for a recently found class of N=1 dual pairs. These results provide the first cross check of AdS/CFT and field theory techniques like a-maximization. Moreover, they furnish new examples of cascading gauge theories and the first instance of 4d dynamical supersymmetry breaking embedded in the correspondence. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

The Phase Transitions between H 0.27V 0.27W 0.73O 3· {1}/{3} H 2O and V 0.27W 0.73O 2.865: An X-Ray, Thermal Analysis, and HREM Study

Science.gov (United States)

Dupont, L.; Sundberg, M.

1998-03-01

A mixed vanadium-tungsten oxide hydrate (H 0.27V 0.27W 0.73O 3· {1}/{3}H 2O) has been synthesized by a soft chemistry method, and the phase transitions from the hydrate (precursor) to the final product V 0.27W 0.73O 2.865have been studied by thermal analysis, X-ray powder diffraction, and high-resolution electron microscopy (HREM) techniques. Supermetastable, metastable, and stable oxides have been observed. H 0.27V 0.27W 0.73O 3· {1}/{3}H 2O possesses a structure related to WO 3· {1}/{3}H 2O. Dehydration of the precursor leads to a supermetastable phase, H 0.27V 0.27W 0.73O 3, with a structure similar to that of the hydrate. At 350°C this phase transforms to the metastable H 0.27V 0.27W 0.73O 3, with a structure isotypic with WO 3(hex). The phase transition between the hydrate and H 0.27V 0.27W 0.73O 3is both pseudomorphous and topotactic. Removal of hydrogen and oxygen from the metastable oxide induces a second phase transition at 500°C to a more stable phase, V 0.27W 0.73O 2.865, with an oxygen-deficient WO 3-type structure. The monoclinic symmetry of the latter oxide increases at higher temperature, first to orthorhombic and then to tetragonal. This transition is not pseudomorphous but of a topotactic nature. The obtained results suggest that the hydrogen content stabilizes the WO 3(hex)-related structure of the metastable phase. A hypothetical model based on HREM observations is proposed for the structural transformation H 0.27V 0.27W 0.73O 3→V 0.27W 0.73O 2.865.

Sexual dimorphism in the volume of song control nuclei in European starlings: assessment by a Nissl stain and autoradiography for muscarinic cholinergic receptors.

Science.gov (United States)

Bernard, D J; Casto, J M; Ball, G F

1993-08-22

Previous studies have found that the volume of several song control nuclei is larger in male songbirds than in female songbirds. The degree of this volumetric sex difference within a given species appears to be systematically related to the degree of the behavioral sex difference. The largest volumetric differences have been reported in species in which the male sings and the female sings little, if at all, and the smallest sex differences in volume have been reported in species in which males and females both sing in nearly equal amounts. We compared the volume of three song control nuclei in male and female European starlings (Sturnus vulgaris), a species in which females are known to sing, though at a much lower rate than males. We investigated the volume of hyperstriatum ventrale, pars caudale, nucleus robustus archistriatalis, and area X of the lobus parolfactorius as defined with the use of a Nissl stain. In addition, we measured the volume of area X as defined by the density of muscarinic cholinergic receptors visualized by in vitro receptor autoradiographic methods. The volumes of all three of the song nuclei, as defined by Nissl staining, are significantly larger in males than in females. For area X, Nissl staining and receptor autoradiography indicate the same significant volumetric sex difference. The three nuclei are approximately one and one half to two times larger in males than in females, a degree of dimorphism that is intermediate to those reported for other species. Previous investigations of sex differences in the avian vocal control system have used only Nissl stains to define nuclear volumes. We demonstrate in this paper that receptor autoradiography can be used to assess dimorphisms in nuclear volume. Broad application of this approach to a number of neurotransmitter receptor systems will better characterize the dimorphisms in the song system, and therefore will provide greater insight into the neuroanatomical and neurochemical control of

AdS boundary conditions and the Topologically Massive Gravity/CFT correspondence

NARCIS (Netherlands)

Skenderis, K.; Taylor, M.; van Rees, B.C.

2009-01-01

The AdS/CFT correspondence provides a new perspective on recurrent questions in General Relativity such as the allowed boundary conditions at infinity and the definition of gravitational conserved charges. Here we review the main insights obtained in this direction over the last decade and apply the

2D CFT blocks for the 4D class S{sub k} theories

Energy Technology Data Exchange (ETDEWEB)

Mitev, Vladimir [Mainz Univ. (Germany). Inst. fuer Physik; Pomoni, Elli [DESY, Hamburg (Germany). Theory Group

2017-03-15

This is the first in a series of papers on the search for the 2D CFT description of a large class of 4D N=1 gauge theories. Here, we identify the 2D CFT symmetry algebra and its representations, namely the conformal blocks of the Virasoro/W-algebra, that underlie the 2D theory and reproduce the Seiberg-Witten curves of the N=1 gauge theories. We find that the blocks corresponding to the SU(N) S{sub k} gauge theories involve fields in certain non-unitary representations of the W{sub kN} algebra. These conformal blocks give a prediction for the instanton partition functions of the 4D N=1 SCFTs of class S{sub k}.

A Natural Language for AdS/CFT Correlators

Energy Technology Data Exchange (ETDEWEB)

Fitzpatrick, A.Liam; /Boston U.; Kaplan, Jared; /SLAC; Penedones, Joao; /Perimeter Inst. Theor. Phys.; Raju, Suvrat; /Harish-Chandra Res. Inst.; van Rees, Balt C.; /YITP, Stony Brook

2012-02-14

We provide dramatic evidence that 'Mellin space' is the natural home for correlation functions in CFTs with weakly coupled bulk duals. In Mellin space, CFT correlators have poles corresponding to an OPE decomposition into 'left' and 'right' sub-correlators, in direct analogy with the factorization channels of scattering amplitudes. In the regime where these correlators can be computed by tree level Witten diagrams in AdS, we derive an explicit formula for the residues of Mellin amplitudes at the corresponding factorization poles, and we use the conformal Casimir to show that these amplitudes obey algebraic finite difference equations. By analyzing the recursive structure of our factorization formula we obtain simple diagrammatic rules for the construction of Mellin amplitudes corresponding to tree-level Witten diagrams in any bulk scalar theory. We prove the diagrammatic rules using our finite difference equations. Finally, we show that our factorization formula and our diagrammatic rules morph into the flat space S-Matrix of the bulk theory, reproducing the usual Feynman rules, when we take the flat space limit of AdS/CFT. Throughout we emphasize a deep analogy with the properties of flat space scattering amplitudes in momentum space, which suggests that the Mellin amplitude may provide a holographic definition of the flat space S-Matrix.

Effects of hypoxic–ischemic brain injury on striatal dopamine transporter in newborn piglets: evaluation of 11C-CFT PET/CT for DAT quantification

International Nuclear Information System (INIS)

Zhang Yanfen; Wang Xiaoyu; Cao Li; Guo Qiyong; Wang Xiaoming

2011-01-01

Introduction: Alterations of dopamine in striatal presynaptic terminals play an important role in the hypoxic–ischemic (HI) brain injury. Quantification of DAT levels in the presynaptic site using 11 C-N-2-carbomethoxy-3-(4-fluorophenyl)-tropane ( 11 C-CFT) with positron emission tomography (PET) was applied in studies for Parkinson's disease. The current study investigated the changes in striatal DAT following HI brain injury in newborn piglets using 11 C-CFT PET. Methods: Newborn piglets were subjected to occlusion of bilateral common carotid arteries for 30 min and simultaneous peripheral hypoxia. Brain DAT imaging was performed using PET/CT with 11 C-CFT as the probe in each group (including the control group and HI insult groups). Brain tissues were collected for DAT immunohistochemical (IHC) analysis at each time point post the PET/CT procedure. Sham controls had some operation without HI procedure. Results: A few minutes after intravenous injection of 11 C-CFT, radioactive signals for DAT clearly appeared in the cortical area, striatum and cerebellum of newborn piglets of sham control group and HI insult groups. HI brain insult markedly increased striatal DAT at an early period (P 11 C-CFT PET imaging data and IHC DAT staining data were highly correlated (r=0.844, P 11 C-CFT PET/CT imaging data reflected the dynamic changes of DAT in the striatum in vivo.

Yangians, S-matrices and AdS/CFT

International Nuclear Information System (INIS)

Torrielli, Alessandro

2011-01-01

This review is meant to be an account of the properties of the infinite-dimensional quantum group (specifically, Yangian) symmetry lying behind the integrability of the AdS/CFT spectral problem. In passing, the chance is taken to give a concise anthology of basic facts concerning Yangians and integrable systems, and to store a series of remarks, observations and proofs the author has collected in a 5 year span of research on the subject. We hope this exercise will be useful for future attempts to study Yangians in field and string theories, with or without supersymmetry. (topical review)

Yangians, S-matrices and AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Torrielli, Alessandro, E-mail: alessandro.torrielli@york.ac.uk [Department of Mathematics, University of York, Heslington, York, YO10 5DD (United Kingdom)

2011-07-01

This review is meant to be an account of the properties of the infinite-dimensional quantum group (specifically, Yangian) symmetry lying behind the integrability of the AdS/CFT spectral problem. In passing, the chance is taken to give a concise anthology of basic facts concerning Yangians and integrable systems, and to store a series of remarks, observations and proofs the author has collected in a 5 year span of research on the subject. We hope this exercise will be useful for future attempts to study Yangians in field and string theories, with or without supersymmetry. (topical review)

The fate of Nissl-stained dark neurons following traumatic brain injury in rats: difference between neocortex and hippocampus regarding survival rate.

Science.gov (United States)

Ooigawa, Hidetoshi; Nawashiro, Hiroshi; Fukui, Shinji; Otani, Naoki; Osumi, Atsushi; Toyooka, Terushige; Shima, Katsuji

2006-10-01

We studied the fate of Nissl-stained dark neurons (N-DNs) following traumatic brain injury (TBI). N-DNs were investigated in the cerebral neocortex and the hippocampus using a rat lateral fluid percussion injury model. Nissl stain, acid fuchsin stain and immunohistochemistry with phosphorylated extracellular signal-regulated protein kinase (pERK) antibody were used in order to assess posttraumatic neurons. In the neocortex, the number of dead neurons at 24 h postinjury was significantly less than that of the observed N-DNs in the earlier phase. Only a few N-DNs increased their pERK immunoreactivity. On the other hand, in the hippocampus the number of dead neurons was approximately the same number as that of the N-DNs, and most N-DNs showed an increased pERK immunoreactivity. These data suggest that not all N-DNs inevitably die especially in the neocortex after TBI. The fate of N-DNs is thus considered to differ depending on brain subfields.

Probiotic Escherichia coli Nissle 1917 inhibits leaky gut by enhancing mucosal integrity.

Directory of Open Access Journals (Sweden)

Sya N Ukena

2007-12-01

Full Text Available Probiotics are proposed to positively modulate the intestinal epithelial barrier formed by intestinal epithelial cells (IECs and intercellular junctions. Disruption of this border alters paracellular permeability and is a key mechanism for the development of enteric infections and inflammatory bowel diseases (IBDs.To study the in vivo effect of probiotic Escherichia coli Nissle 1917 (EcN on the stabilization of the intestinal barrier under healthy conditions, germfree mice were colonized with EcN or K12 E. coli strain MG1655. IECs were isolated and analyzed for gene and protein expression of the tight junction molecules ZO-1 and ZO-2. Then, in order to analyze beneficial effects of EcN under inflammatory conditions, the probiotic was orally administered to BALB/c mice with acute dextran sodium sulfate (DSS induced colitis. Colonization of gnotobiotic mice with EcN resulted in an up-regulation of ZO-1 in IECs at both mRNA and protein levels. EcN administration to DSS-treated mice reduced the loss of body weight and colon shortening. In addition, infiltration of the colon with leukocytes was ameliorated in EcN inoculated mice. Acute DSS colitis did not result in an anion secretory defect, but abrogated the sodium absorptive function of the mucosa. Additionally, intestinal barrier function was severely affected as evidenced by a strong increase in the mucosal uptake of Evans blue in vivo. Concomitant administration of EcN to DSS treated animals resulted in a significant protection against intestinal barrier dysfunction and IECs isolated from these mice exhibited a more pronounced expression of ZO-1.This study convincingly demonstrates that probiotic EcN is able to mediate up-regulation of ZO-1 expression in murine IECs and confer protection from the DSS colitis-associated increase in mucosal permeability to luminal substances.

Note on non-vacuum conformal family contributions to Rényi entropy in two-dimensional CFT

Science.gov (United States)

Zhang, Jia-ju

2017-06-01

We calculate the contributions of a general non-vacuum conformal family to Rényi entropy in two-dimensional conformal field theory (CFT). The primary operator of the conformal family can be either non-chiral or chiral, and we denote its scaling dimension by Δ. For the case of two short intervals on a complex plane, we expand the Rényi mutual information by the cross ratio x to order x 2Δ+2. For the case of one interval on a torus with low temperature, we expand the Rényi entropy by q=exp(-2πβ/L), with β being the inverse temperature and L being the spatial period, to order q Δ+2. To make the result meaningful, we require that the scaling dimension Δ cannot be too small. For two intervals on a complex plane we need Δ > 1, and for one interval on a torus we need Δ > 2. We work in the small Newton constant limit on the gravity side and so a large central charge limit on the CFT side, and find matches of gravity and CFT results. Supported by ERC Starting Grant 637844-HBQFTNCER

The effects of boron on Tb0.27Dy0.73Fe2 compound

International Nuclear Information System (INIS)

Wu Lei; Chen Xicheng; Chen Xishen

1995-01-01

The magnetostrictive properties and microstructure of Tb 0.27 Dy 0.73 Fe 2 B x (x=0, 0.05, 0.1, 0.15, 0.2) have been investigated. Measurement of magnetic properties, X-ray diffraction and magnetostriction were made on Tb 0.27 Dy 0.73 Fe 2 B x polycrystalline samples prepared by arc melting. With the increase of boron content x, the iron-rich phase which leads to the detriment of magnetostrictive properties, decreases. The matrix phase of these alloys also has the MgCu 2 structure. The lattice constant and Curie transition temperature change only slightly. The doping of boron in the Tb 0.27 Dy 0.73 Fe 2 alloy can restrain the emergence of the iron-rich phase. The peritectic region probably shifts slightly with the addition of boron. ((orig.))

Schwinger-Keldysh propagators from AdS/CFT correspondence

International Nuclear Information System (INIS)

Herzog, C.P.; Son, D.T.

2003-01-01

We demonstrate how to compute real-time Green's functions for a class of finite temperature field theories from their AdS gravity duals. In particular, we reproduce the two-by-two Schwinger-Keldysh matrix propagator from a gravity calculation. Our methods should work also for computing higher point lorentzian signature correlators. We elucidate the boundary condition subtleties which hampered previous efforts to build a lorentzian-signature AdS/CFT correspondence. For two-point correlators, our construction is automatically equivalent to the previously formulated prescription for the retarded propagator. (author)

QGP thermodynamics and Meson spectroscopy with AdS/CFT

Science.gov (United States)

Erdmenger, J.; Kaminski, M.; Rust, F.

In this talk we present applications of the AdS/CFT correspondence to strongly coupled sys- tems at finite temperature and particle density. The model we investigate contains adjoint matter described by the gauge multiplet of N = 4, as well as fundamental matter given by the hyper- multiplet of N = 2 Super Yang-Mills theory. In some aspects these systems can be thought of as models for the quark-gluon plasma. In the first part we review some properties of meson spectra obtained from these holographic models. We discuss the implications of finite temperature and particle density in these string- theory motivated setups. In particular, we find a broadening of the vector meson peaks in the relevant spectral function at finite density. However, we do not observe a movement of the reso- nances to lower frequencies. Moreover, we analyze the effects of strong coupling on heavy meson diffusion in medium. To do so we make use of an effective model with dipole interaction, which is valid for heavy quarks at arbitrary coupling strength. We calculate the momentum broadening — normalized to the in-medium mass shift — and compare the large ’t Hooft coupling AdS/CFT result with a perturbative result for weak coupling. We find that the momentum broadening is reduced at large ’t Hooft coupling, leading to increased relaxation time.

Design, analysis and application of innovative composite PR connections between steel beams and CFT columns

International Nuclear Information System (INIS)

Hu, Jong Wan; Leon, Roberto T; Choi, Eunsoo

2011-01-01

In this research, three structural design concepts are integrated: the use of composite concrete-filled tube (CFT) columns, the use of partially restrained (PR) connections and the introduction of innovative materials (shape memory alloys) in the connection design. These concepts are used to enhance the robustness and performance of composite-special moment frames. These innovative connections intend to exploit the recentering properties of super-elastic SMA tension bars, the energy dissipation capacity of low-carbon steel bars and the toughness of CFT columns. PR-CFT connection prototypes were designed based on a hierarchy of strength models for each connection component. Simplified user joint elements based on the mechanical modeling approach were formulated in an effort to simulate the realistic behavior of bolted connections. The application of new connections to low-rise PR composite frames is illustrated by designing four buildings in both 2D and 3D for the western US region. The performance of these composite frames was compared with those with conventional welded frames in terms of strength, ductility and recentering behavior. In all three areas, frames with the PR composite connections showed superior performance. This is due primarily to the capability of this system to redistribute inter-story drift more evenly through the height of the frame

Logarithmic corrections to black hole entropy from Kerr/CFT

Energy Technology Data Exchange (ETDEWEB)

Pathak, Abhishek [Center for the Fundamental Laws of Nature, Harvard University,Cambridge, MA 02138 (United States); Porfyriadis, Achilleas P. [Center for the Fundamental Laws of Nature, Harvard University,Cambridge, MA 02138 (United States); Department of Physics, UCSB,Santa Barbara, CA 93106 (United States); Strominger, Andrew [Center for the Fundamental Laws of Nature, Harvard University,Cambridge, MA 02138 (United States); Varela, Oscar [Center for the Fundamental Laws of Nature, Harvard University,Cambridge, MA 02138 (United States); Max-Planck-Institut für Gravitationsphysik (Albert-Einstein-Institut),Am Mühlenberg 1, D-14476 Potsdam (Germany); Department of Physics, Utah State University,Logan, UT 84322 (United States)

2017-04-14

It has been shown by A. Sen that logarithmic corrections to the black hole area-entropy law are entirely determined macroscopically from the massless particle spectrum. They therefore serve as powerful consistency checks on any proposed enumeration of quantum black hole microstates. Sen’s results include a macroscopic computation of the logarithmic corrections for a five-dimensional near extremal Kerr-Newman black hole. Here we compute these corrections microscopically using a stringy embedding of the Kerr/CFT correspondence and find perfect agreement.

Logarithmic corrections to black hole entropy from Kerr/CFT

International Nuclear Information System (INIS)

Pathak, Abhishek; Porfyriadis, Achilleas P.; Strominger, Andrew; Varela, Oscar

2017-01-01

It has been shown by A. Sen that logarithmic corrections to the black hole area-entropy law are entirely determined macroscopically from the massless particle spectrum. They therefore serve as powerful consistency checks on any proposed enumeration of quantum black hole microstates. Sen’s results include a macroscopic computation of the logarithmic corrections for a five-dimensional near extremal Kerr-Newman black hole. Here we compute these corrections microscopically using a stringy embedding of the Kerr/CFT correspondence and find perfect agreement.

Real-time response in AdS/CFT with application to spinors

International Nuclear Information System (INIS)

Iqbal, N.; Liu, H.

2009-01-01

We discuss a simple derivation of the real-time AdS/CFT prescription as an analytic continuation of the corresponding problem in Euclidean signature. We then extend the formalism to spinor operators and apply it to the examples of real-time fermionic correlators in CFTs dual to pure AdS and the BTZ black hole. (Abstract Copyright [2009], Wiley Periodicals, Inc.)

New Penrose limits and AdS/CFT

DEFF Research Database (Denmark)

Grignani, Gianluca; Harmark, Troels; Marini, Andrea

2010-01-01

We find a new Penrose limit of AdS 5 × S 5 giving the maximally supersymmetric pp-wave background with two explicit space-like isometries. This is an important missing piece in studying the AdS/CFT correspondence in certain subsectors. In particular whereas the Penrose limit giving one space......-like isometry is useful for the SU(2) sector of N = 4 SYM, this new Penrose limit is instead useful for studying the SU(2|3) and SU(1, 2|3) sectors. In addition to the new Penrose limit of AdS 5 × S 5 we also find a new Penrose limit of AdS4 × ℂP 3....

The lightcone bootstrap and the spectrum of the 3d Ising CFT

Energy Technology Data Exchange (ETDEWEB)

Simmons-Duffin, David [School of Natural Sciences, Institute for Advanced Study, Princeton, New Jersey 08540 (United States); Walter Burke Institute for Theoretical Physics, Caltech, Pasadena, California 91125 (United States)

2017-03-15

We compute numerically the dimensions and OPE coefficients of several operators in the 3d Ising CFT, and then try to reverse-engineer the solution to crossing symmetry analytically. Our key tool is a set of new techniques for computing infinite sums of SL(2,ℝ) conformal blocks. Using these techniques, we solve the lightcone bootstrap to all orders in an asymptotic expansion in large spin, and suggest a strategy for going beyond the large spin limit. We carry out the first steps of this strategy for the 3d Ising CFT, deriving analytic approximations for the dimensions and OPE coefficients of several infinite families of operators in terms of the initial data {Δ_σ,Δ_ϵ,f_σ_σ_ϵ,f_ϵ_ϵ_ϵ,c_T}. The analytic results agree with numerics to high precision for about 100 low-twist operators (correctly accounting for O(1) mixing effects between large-spin families). Plugging these results back into the crossing equations, we obtain approximate analytic constraints on the initial data.

Using Natural Products to Treat Resistant and Persistent Bacterial Infections

Science.gov (United States)

Deering, Robert W.

-lactams, tetracyclines, aminoglycosides, and chloramphenicol. The efflux pump inhibitory mechanism was further proved through an accumulation assay with the Hoechst dye 33342. In chapter three, we report the discovery of a 1,2-benzisoxazole with new antibacterial activity against MDR A. baumannii, a pathogen with a critical need of new treatments. This compound was produced by bacterial fermentation and synthetic preparation and shows minimum inhibitory concentrations as low as 6.25 ?g/mL against a panel of four clinically relevant A. baumannii strains. Key structure activity relationships were demonstrated using synthetic analogs of the lead 1,2-benzisoxazole. We advocate for further studies to advance the development of this compound. The third study, describes an in vitro quiescent state of uropathogenic E. coli (UPEC) and bacteria-produced signals that can prevent this state. Quiescence was seen in the classic UPEC strain CFT073 only when grown on glucose M9 minimal medium agar plates seeded with ≤10 6 CFU. Interestingly, this quiescent state is seen in 80% of E. coli phylogenetic group B2 multilocus sequence type 73 strains, as well as 22.5% of randomly selected UPEC strains isolated from community acquired urinary tract infections in Denmark. Furthermore, it was determined that CFT073 forms a high persister cell fraction under these growth conditions. Both the persistent and quiescent states were inhibited significantly by a cocktail of lysine, tyrosine, and methionine at concentrations relevant to those in human urine. The use of CFT073 mini-Tn5 metabolic mutants ( gnd, gdhA, pykF, sdhA, and zwf) showed that both quiescence and persistence require a complete TCA cycle, but that the dormant states differ in that persistence requires a non-functional rpoS gene and quiescence does not. These results suggest that interference with these central metabolic pathways may be able to mitigate UPEC infections. In the fifth chapter, cranberry oligosaccharides and related compounds were

Five loop Konishi from AdS/CFT

International Nuclear Information System (INIS)

Bajnok, Zoltan; Hegedus, Arpad; Janik, Romuald A.; Lukowski, Tomasz

2010-01-01

We derive the perturbative five loop anomalous dimension of the Konishi operator in N=4 SYM theory from the integrable string sigma model by evaluating finite size effects using Luescher formulas adapted to multimagnon states at weak coupling. In addition, we derive the five loop wrapping contribution for the L=2 single impurity state in the β deformed theory, which may be within reach of a direct perturbative computation. The Konishi expression exhibits two new features - a modification of Asymptotic Bethe Ansatz quantization and sensitiveness to an infinite set of coefficients of the BES/BHL dressing phase. The result satisfies nontrivial self-consistency conditions - simple transcendentality structure and cancellation of μ-term poles. It may be a testing ground for the proposed AdS/CFT TBA systems.

A quantum check of AdS/dCFT

DEFF Research Database (Denmark)

Buhl-Mortensen, Isak; de Leeuw, Marius; Ipsen, Asger C.

2017-01-01

-time dependence of the theory’s Minkowski space propagators is handled by reformulating these as propagators in an effective AdS4. Subsequently, we initiate the computation of quantum corrections. The one-loop correction to the one-point function of any local gauge-invariant scalar operator is shown to receive......We build the framework for performing loop computations in the defect version of N = 4 super Yang-Mills theory which is dual to the probe D5-D3 brane system with background gauge-field flux. In this dCFT, a codimension-one defect separates two regions of space-time with different ranks of the gauge...

The AdS/CFT Correspondence and Holographic QCD

International Nuclear Information System (INIS)

Erlich, J.

2012-01-01

Holographic QCD is an extra-dimensional approach to modeling QCD resonances and their interactions. Holographic models encode information about chiral symmetry breaking, Weinberg sum rules, vector meson dominance, and other phenomenological features of QCD. There are two complementary approaches to holographic model building: a top-down approach which begins with string-theory brane configurations, and a bottom-up approach which is more phenomenological. In this talk I will describe the AdS/CFT correspondence, which motivates Holographic QCD, and the techniques used to build holographic models of QCD and to calculate observables in those models. I will also discuss an intriguing light cone approach to Holographic QCD discovered by Brodsky and De Teramond. (author)

Extremely Short Optical Pulses and Ads/CFT Compliance

Directory of Open Access Journals (Sweden)

Konobeeva N.N.

2015-01-01

Full Text Available Dynamics of few cycle optical pulses in non-Fermi liquid was considered. Energy spectrum of non-Fermi liquid was taken from the AdS/CFT compliance. Conditions of quasiparticle excitation existence were defined. Non-Fermi liquid parameters impact on the shape of few cycle pulses were estimated. It was shown that extremely short optical pulse propagation in the non-Fermi liquid is a stable pattern. The value of chemical potential has a significant impact on extremely short pulse shape. An increase in initial pulse amplitude does not result in pulse-shape distortions under its propagation in considered medium that is why the non-Fermi liquid can be used in applications inherent in extremely short pulse processing.

New Perspectives for QCD from AdS/CFT

International Nuclear Information System (INIS)

Brodsky, S

2006-01-01

The AdS/CFT correspondence between conformal field theory and string states in an extended space-time has provided new insights into not only hadron spectra, but also their light-front wavefunctions. We show that there is an exact correspondence between the fifth-dimensional coordinate of anti-de Sitter space z and a specific impact variable ζ which measures the separation of the constituents within the hadron in ordinary space-time. This connection allows one to predict the form of the light-front wavefunctions of mesons and baryons, the fundamental entities which encode hadron properties and scattering amplitudes. A new relativistic Schroedinger light-cone equation is found which reproduces the results obtained using the fifth-dimensional theory

Integrable theories that are asymptotically CFT

CERN Document Server

Evans, J M; Jonathan M Evans; Timothy J Hollowood

1995-01-01

A series of sigma models with torsion are analysed which generate their mass dynamically but whose ultra-violet fixed points are non-trivial conformal field theories -- in fact SU(2) WZW models at level k. In contrast to the more familiar situation of asymptotically free theories in which the fixed points are trivial, the sigma models considered here may be termed ``asymptotically CFT''. These theories have previously been conjectured to be quantum integrable; we confirm this by proposing a factorizable S-matrix to describe their infra-red behaviour and then carrying out a stringent test of this proposal. The test involves coupling the theory to a conserved charge and evaluating the response of the free-energy both in perturbation theory to one loop and directly from the S-matrix via the Thermodynamic Bethe Ansatz with a chemical potential at zero temperature. Comparison of these results provides convincing evidence in favour of the proposed S-matrix; it also yields the universal coefficients of the beta-func...

Fake gaps in AdS{sub 3}/CFT{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Belin, Alexandre [Department of Physics, Stanford University,Stanford, CA 94305-4060 (United States); Castro, Alejandra [Institute for Theoretical Physics, University of Amsterdam,Science Park 904, Postbus 94485, 1090 GL Amsterdam (Netherlands); Hung, Ling-Yan [Department of Physics and Center for Field Theory and Particle Physics, Fudan University,220 Handan Road, 200433 Shanghai (China); Collaborative Innovation Center of Advanced Microstructures, Fudan University,220 Handan Road, 200433 Shanghai (China)

2015-11-23

We discuss properties of interpolating geometries in three dimensional gravity in the presence of a chiral anomaly. This anomaly, which introduces an unbalance between left and right central charges, is protected under RG flows. For this simple reason it is impossible to gap a system with such an anomaly. Our goal is to discuss how holography captures this basic and robust feature. We demonstrate the absence of a mass gap by analysing the linearized spectrum and holographic entanglement entropy of these backgrounds in the context of AdS{sub 3}/CFT{sub 2}.

Ricci solitons, Ricci flow and strongly coupled CFT in the Schwarzschild Unruh or Boulware vacua

International Nuclear Information System (INIS)

Figueras, Pau; Lucietti, James; Wiseman, Toby

2011-01-01

The elliptic Einstein-DeTurck equation may be used to numerically find Einstein metrics on Riemannian manifolds. Static Lorentzian Einstein metrics are considered by analytically continuing to Euclidean time. The Ricci-DeTurck flow is a constructive algorithm to solve this equation, and is simple to implement when the solution is a stable fixed point, the only complication being that Ricci solitons may exist which are not Einstein. Here we extend previous work to consider the Einstein-DeTurck equation for Riemannian manifolds with boundaries, and those that continue to static Lorentzian spacetimes which are asymptotically flat, Kaluza-Klein, locally AdS or have extremal horizons. Using a maximum principle, we prove that Ricci solitons do not exist in these cases and so any solution is Einstein. We also argue that the Ricci-DeTurck flow preserves these classes of manifolds. As an example, we simulate the Ricci-DeTurck flow for a manifold with asymptotics relevant for AdS 5 /CFT 4 . Our maximum principle dictates that there are no soliton solutions, and we give strong numerical evidence that there exists a stable fixed point of the flow which continues to a smooth static Lorentzian Einstein metric. Our asymptotics are such that this describes the classical gravity dual relevant for the CFT on a Schwarzschild background in either the Unruh or Boulware vacua. It determines the leading O(N 2 c ) part of the CFT stress tensor, which interestingly is regular on both the future and past Schwarzschild horizons. (paper)

Membranes from monopole operators in ABJM theory: Large angular momentum and M-theoretic AdS4/CFT3

International Nuclear Information System (INIS)

Kovacs, Stefano; Sato, Yuki; Shimada, Hidehiko

2014-01-01

We study the duality between M-theory in AdS 4 ×S 7 /ℤ k and the ABJM N=6 Chern–Simons-matter theory with gauge group U(N)×U(N) and level k, taking N large and k of order 1. In this M-theoretic regime the lack of an explicit formulation of M-theory in AdS 4 ×S 7 /ℤ k makes the gravity side difficult, while the CFT is strongly coupled and the planar approximation is not applicable. We focus on states on the gravity side with large angular momentum J≫1 associated with a single plane of rotation in S 7 and identify their dual operators in the CFT. We show that natural approximation schemes arise on both sides thanks to the presence of the small parameter 1/J. On the AdS side, we use the matrix model of M-theory on the maximally supersymmetric pp-wave background with matrices of size J/k. A perturbative treatment of this matrix model provides a good approximation to M-theory in AdS 4 ×S 7 /ℤ k when N 1/3 ≪J≪N 1/2 . On the CFT side, we study the theory on S 2 ×ℝ with magnetic flux J/k. A Born–Oppenheimer-type expansion arises naturally for large J in spite of the theory being strongly coupled. The energy spectra on the two sides agree at leading order. This provides a non-trivial test of the AdS 4 /CFT 3 correspondence including near-BPS observables associated with membrane degrees of freedom, thus verifying the duality beyond the previously studied sectors corresponding to either BPS observables or the type IIA string regime

Classical/quantum integrability in AdS/CFT

International Nuclear Information System (INIS)

Kazakov, V.A.; Marshakov, A.; Minahan, J.A.; Zarembo, K.

2004-01-01

We discuss the AdS/CFT duality from the perspective of integrable systems and establish a direct relationship between the dimension of single trace local operators composed of two types of scalar fields in N=4 super Yang-Mills and the energy of their dual semiclassical string states in AdS(5) x S(5). The anomalous dimensions can be computed using a set of Bethe equations, which for 'long' operators reduces to a Riemann-Hilbert problem. We develop a unified approach to the long wavelength Bethe equations, the classical ferromagnet and the classical string solutions in the SU(2) sector and present a general solution, governed by complex curves endowed with meromorphic differentials with integer periods. Using this solution we compute the anomalous dimensions of these long operators up to two loops and demonstrate that they agree with string-theory predictions. (author)

The complexity of identifying Ryu-Takayanagi surfaces in AdS{sub 3}/CFT{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Bao, N.; Chatwin-Davies, A. [Walter Burke Institute for Theoretical Physics, California Institute of Technology,Pasadena, CA 91125 (United States)

2016-11-07

We present a constructive algorithm for the determination of Ryu-Takayanagi surfaces in AdS{sub 3}/CFT{sub 2} which exploits previously noted connections between holographic entanglement entropy and max-flow/min-cut. We then characterize its complexity as a polynomial time algorithm.

Propagation of few cycle optical pulses in marginal Fermi liquid and ADS/CFT correspondence

Energy Technology Data Exchange (ETDEWEB)

Konobeeva, N.N., E-mail: yana_nn@inbox.ru [Volgograd State University, University Avenue 100, Volgograd 400062 (Russian Federation); Belonenko, M.B. [Volgograd State University, University Avenue 100, Volgograd 400062 (Russian Federation); Volgograd Institute of Business, Uzhno-ukrainskaya str., Volgograd 400048 (Russian Federation)

2015-12-01

Absract: The paper considers features of few cycle optical pulse propagation in marginal Fermi liquid. The Green functions whose poles are responsible for the dispersion law excitation states of the liquid have been derived within the framework of ADS/CFT correspondence. Marginal Fermi liquid parameters influence on the pulse shape was defined.

Propagation of few cycle optical pulses in marginal Fermi liquid and ADS/CFT correspondence

International Nuclear Information System (INIS)

Konobeeva, N.N.; Belonenko, M.B.

2015-01-01

Absract: The paper considers features of few cycle optical pulse propagation in marginal Fermi liquid. The Green functions whose poles are responsible for the dispersion law excitation states of the liquid have been derived within the framework of ADS/CFT correspondence. Marginal Fermi liquid parameters influence on the pulse shape was defined.

Condensed matter applications of AdS/CFT (III)

CERN Multimedia

CERN. Geneva

2009-01-01

AdS/CFT. Holographic superconductors will be discussed. The lectures will conclude with a discussion of open questions and future directions. References: - Holographic Superconductors. Sean A. Hartnoll, Christopher P. Herzog, Gary T. Horowitz, JHEP 0812:015,2008, arXiv:0810.1563 [hep-th] - Ohm's Law at strong coupling: S duality and the cyclotron resonance, Sean A. Hartnoll, Christopher P. Herzog, Phys.Rev.D76:106012,2007, arXiv:0706.3228 [hep-th] - Gravity duals for non-relativistic CFTs. Koushik Balasubramanian, John McGreevy, Phys.Rev.Lett.101:061601,2008, arXiv:0804.4053 [hep-th] - Toward an AdS/cold atoms correspondence: A Geometric realization of the Schrodinger symmetry. D.T. Son, Phys.Rev.D78:046003,2008, arXi...

Loop effects in AdS/CFT and beyond

International Nuclear Information System (INIS)

Gubser, Steven S.

2003-01-01

Double-trace operators which are relevant deformations of large N conformal field theories give rise to renormalization group flows that can be studied on both sides of the AdS/CFT duality. One-loop calculations in AdS can be compared successfully to results derived in field theory using the Hubbard-Stratonovich transformation. The calculations do not rely on supersymmetry, and they apply in any dimension, provided the original conformal field theory and its AdS dual are well-defined. A speculative idea is proposed for solving the cosmological constant problem based on non-gravitational strings that become light as the universe expands. This is a summary of my talk presented at the Nishinomiya-Yukawa Symposium in Nishinomiya, Japan. (author)

Causal hydrodynamics of gauge theory plasmas from AdS/CFT duality

International Nuclear Information System (INIS)

Natsuume, Makoto; Okamura, Takashi

2008-01-01

We study causal hydrodynamics (Israel-Stewart theory) of gauge theory plasmas from the AdS/CFT duality. Causal hydrodynamics requires new transport coefficients (relaxation times) and we compute them for a number of supersymmetric gauge theories including the N=4 super Yang-Mills theory. However, the relaxation times obtained from the 'shear mode' do not agree with the ones from the 'sound mode', which implies that the Israel-Stewart theory is not a sufficient framework to describe the gauge theory plasmas.

Intestinal Anti-inflammatory Effects of Outer Membrane Vesicles from Escherichia coli Nissle 1917 in DSS-Experimental Colitis in Mice

Directory of Open Access Journals (Sweden)

María-José Fábrega

2017-07-01

Full Text Available Escherichia coli Nissle 1917 (EcN is a probiotic strain with proven efficacy in inducing and maintaining remission of ulcerative colitis. However, the microbial factors that mediate these beneficial effects are not fully known. Gram-negative bacteria release outer membrane vesicles (OMVs as a direct pathway for delivering selected bacterial proteins and active compounds to the host. In fact, vesicles released by gut microbiota are emerging as key players in signaling processes in the intestinal mucosa. In the present study, the dextran sodium sulfate (DSS-induced colitis mouse model was used to investigate the potential of EcN OMVs to ameliorate mucosal injury and inflammation in the gut. The experimental protocol involved pre-treatment with OMVs for 10 days before DSS intake, and a 5-day recovery period. Oral administration of purified EcN OMVs (5 μg/day significantly reduced DSS-induced weight loss and ameliorated clinical symptoms and histological scores. OMVs treatment counteracted altered expression of cytokines and markers of intestinal barrier function. This study shows for the first time that EcN OMVs can mediate the anti-inflammatory and barrier protection effects previously reported for this probiotic in experimental colitis. Remarkably, translation of probiotics to human healthcare requires knowledge of the molecular mechanisms involved in probiotic–host interactions. Thus, OMVs, as a non-replicative bacterial form, could be explored as a new probiotic-derived therapeutic approach, with even lower risk of adverse events than probiotic administration.

In Vitro Evaluation of the Impact of the Probiotic E. coli Nissle 1917 on Campylobacter jejuni's Invasion and Intracellular Survival in Human Colonic Cells.

Science.gov (United States)

Helmy, Yosra A; Kassem, Issmat I; Kumar, Anand; Rajashekara, Gireesh

2017-01-01

Campylobacter jejuni is a leading cause of bacterial food poisoning in humans. Due to the rise in antibiotic-resistant Campylobacter , there exists a need to develop antibiotic-independent interventions to control infections in humans. Here, we evaluated the impact of Escherichia coli Nissle 1917 (EcN), a probiotic strain, on C. jejuni's invasion and intracellular survival in polarized human colonic cells (HT-29). To further understand how EcN mediates its impact, the expression of 84 genes associated with tight junctions and cell adhesion was profiled in HT-29 cells after treatment with EcN and challenge with C. jejuni . The pre-treatment of polarized HT-29 cells with EcN for 4 h showed a significant effect on C. jejuni 's invasion (∼2 log reduction) of the colonic cells. Furthermore, no intracellular C. jejuni were recovered from EcN pre-treated HT-29 cells at 24 h post-infection. Other probiotic strains tested had no significant impact on C. jejuni invasion and intracellular survival. C. jejuni decreased the expression of genes associated with epithelial cells permeability and barrier function in untreated HT-29 cells. However, EcN positively affected the expression of genes that are involved in enhanced intestinal barrier function, decreased cell permeability, and increased tight junction integrity. The results suggest that EcN impedes C. jejuni invasion and subsequent intracellular survival by affecting HT-29 cells barrier function and tight junction integrity. We conclude that EcN might be a viable alternative for controlling C. jejuni infections.

Countermeasures and Functional Testing in Head-Down Tilt Bed Rest (CFT 70)

Science.gov (United States)

Cromwell, Ronita L.

2013-01-01

This 70-day bed rest campaign was comprised of 6 integrated studies and conducted at the NASA Flight Analogs Research Unit (FARU). The FARU is located at the University of Texas Medical Branch, Galveston, Texas and is a satellite unit of the Institute for Translational Sciences - Clinical Research Center. This presentation will describe the FARU, discuss the utility of the bed rest platform for use in these studies, and introduce the studies that participated in the CFT 70 bed rest campaign. Information in this presentation will serve as the background for subsequent talks from each individual study. Individual study presentations will discuss preliminary results from completed subjects. Studies included in CFT70 were: ? Physiological Factors Contributing to Post Flight Changes in Functional Performance. J. Bloomberg, NASA ? Integrated Resistance and Aerobic Training Study. L. Ploutz-Snyder, USRA ? Testosterone Supplementation as a Countermeasure Against Musculoskeletal losses during Space Exploration. R. Urban, University of Texas Medical Branch ? Effects of Retronasal Smelling, Variety and Choice on Appetite & Satiety. J. Hunter, Cornell University ? AD ASTRA: Automated Detection of Attitudes and States through Transaction Recordings Analysis. C. Miller, Smart Information Flow Technologies, LLC ? Bed Rest as a Spaceflight Analog to Study Neuro-cognitive Changes: Extent, Longevity, and Neural Bases. R. Seidler, University of Michigan

Protected string spectrum in AdS{sub 3}/CFT{sub 2} from worldsheet integrability

Energy Technology Data Exchange (ETDEWEB)

Baggio, Marco [Instituut voor Theoretische Fysica, KU Leuven,Celestijnenlaan 200D, B-3001 Leuven (Belgium); Sax, Olof Ohlsson [Nordita, Stockholm University and KTH Royal Institute of Technology,Roslagstullsbacken 23, SE-106 91 Stockholm (Sweden); Sfondrini, Alessandro [Institut für Theoretische Physik, ETH Zürich,Wolfgang-Pauli-Str. 27, 8093 Zürich (Switzerland); Stefański, Bogdan Jr. [Centre for Mathematical Science, City, University of London,Northampton Square, EC1V 0HB London (United Kingdom); Torrielli, Alessandro [Department of Mathematics, University of Surrey,Guildford, GU2 7XH (United Kingdom)

2017-04-14

We derive the protected closed-string spectra of AdS{sub 3}/CFT{sub 2} dual pairs with 16 supercharges at arbitrary values of the string tension and of the three-form fluxes. These follow immediately from the all-loop Bethe equations for the spectra of the integrable worldsheet theories. Further, representing the underlying integrable systems as spin chains, we find that their dynamics involves length-changing interactions and that protected states correspond to gapless excitations above the Berenstein-Maldacena-Nastase vacuum. In the case of AdS{sub 3}×S{sup 3}×T{sup 4} the degeneracies of such operators precisely match those of the dual CFT{sub 2} and the supergravity spectrum. On the other hand, we find that for AdS{sub 3}×S{sup 3}×S{sup 3}×S{sup 1} there are fewer protected states than previous supergravity calculations had suggested. In particular, protected states have the same su(2) charge with respect to the two three-spheres.

Integrability for the full spectrum of planar AdS/CFT

International Nuclear Information System (INIS)

Gromov, Nikolay; Kazakov, Vladimir; Vieira, Pedro; Porto Univ.

2009-03-01

We present a set of functional equations defining the anomalous dimensions of arbitrary local single trace operators in planar N=4 SYM theory. It takes the form of a Y-system based on the integrability of the dual superstring σ-model on the AdS 5 x S 5 background. This Y-system passes some very important tests: it incorporates the full asymptotic Bethe ansatz at large length of operator L, including the dressing factor, and it confirms all recently found wrapping corrections. The recently proposed AdS 4 /CFT 3 duality is also treated in a similar fashion. (orig.)

AdS/CFT correspondence, quasinormal modes, and thermal correlators in N=4 supersymmetric Yang-Mills theory

Science.gov (United States)

Núñez, Alvaro; Starinets, Andrei O.

2003-06-01

We use the Lorentzian AdS/CFT prescription to find the poles of the retarded thermal Green’s functions of N=4 SU(N) supersymmetric Yang-Mills theory in the limit of large N and large ’t Hooft coupling. In the process, we propose a natural definition for quasinormal modes in an asymptotically AdS spacetime, with boundary conditions dictated by the AdS/CFT correspondence. The corresponding frequencies determine the dispersion laws for the quasiparticle excitations in the dual finite-temperature gauge theory. Correlation functions of operators dual to massive scalar, vector and gravitational perturbations in a five-dimensional AdS-Schwarzschild background are considered. We find asymptotic formulas for quasinormal frequencies in the massive scalar and tensor cases, and an exact expression for vector perturbations. In the long-distance, low-frequency limit we recover results of the hydrodynamic approximation to thermal Yang-Mills theory.

AdS/CFT correspondence, quasinormal modes, and thermal correlators in N=4 supersymmetric Yang-Mills theory

International Nuclear Information System (INIS)

Nunez, Alvaro; Starinets, Andrei O.

2003-01-01

We use the Lorentzian AdS/CFT prescription to find the poles of the retarded thermal Green's functions of N=4 SU(N) supersymmetric Yang-Mills theory in the limit of large N and large 't Hooft coupling. In the process, we propose a natural definition for quasinormal modes in an asymptotically AdS spacetime, with boundary conditions dictated by the AdS/CFT correspondence. The corresponding frequencies determine the dispersion laws for the quasiparticle excitations in the dual finite-temperature gauge theory. Correlation functions of operators dual to massive scalar, vector and gravitational perturbations in a five-dimensional AdS-Schwarzschild background are considered. We find asymptotic formulas for quasinormal frequencies in the massive scalar and tensor cases, and an exact expression for vector perturbations. In the long-distance, low-frequency limit we recover results of the hydrodynamic approximation to thermal Yang-Mills theory

Human metabolites of synthetic cannabinoids JWH-018 and JWH-073 bind with high affinity and act as potent agonists at cannabinoid type-2 receptors

International Nuclear Information System (INIS)

Rajasekaran, Maheswari; Brents, Lisa K.; Franks, Lirit N.; Moran, Jeffery H.; Prather, Paul L.

2013-01-01

K2 or Spice is an emerging drug of abuse that contains synthetic cannabinoids, including JWH-018 and JWH-073. Recent reports indicate that monohydroxylated metabolites of JWH-018 and JWH-073 retain high affinity and activity at cannabinoid type-1 receptors (CB 1 Rs), potentially contributing to the enhanced toxicity of K2 compared to marijuana. Since the parent compounds also bind to cannabinoid type-2 receptors (CB 2 Rs), this study investigated the affinity and intrinsic activity of JWH-018, JWH-073 and several monohydroxylated metabolites at human CB 2 Rs (hCB 2 Rs). The affinity of cannabinoids for hCB 2 Rs was determined by competition binding studies employing CHO-hCB 2 membranes. Intrinsic activity of compounds was assessed by G-protein activation and adenylyl cyclase (AC)-inhibition in CHO-hCB 2 cells. JWH-073, JWH-018 and several of their human metabolites exhibit nanomolar affinity and act as potent agonists at hCB 2 Rs. Furthermore, a major omega hydroxyl metabolite of JWH-073 (JWH-073-M5) binds to CB 2 Rs with 10-fold less affinity than the parent molecule, but unexpectedly, is equipotent in regulating AC-activity when compared to the parent molecule. Finally, when compared to CP-55,940 and Δ 9 -tetrahydrocannabinol (Δ 9 -THC), JWH-018, JWH-018-M5 and JWH-073-M5 require significantly less CB 2 R occupancy to produce similar levels of AC-inhibition, indicating that these compounds may more efficiently couple CB 2 Rs to AC than the well characterized cannabinoid agonists examined. These results indicate that JWH-018, JWH-073 and several major human metabolites of these compounds exhibit high affinity and demonstrate distinctive signaling properties at CB 2 Rs. Therefore, future studies examining pharmacological and toxicological properties of synthetic cannabinoids present in K2 products should consider potential actions of these drugs at both CB 1 and CB 2 Rs. - Highlights: • JWH-018 and JWH-073 are synthetic cannabinoids present in abused K2

On periodically driven AdS/CFT

CERN Document Server

Auzzi, Roberto; Gudnason, Sven Bjarke; Rabinovici, Eliezer

2013-01-01

We use the AdS/CFT correspondence to study a thermally isolated conformal field theory in four dimensions which undergoes a repeated deformation by an external periodic time-dependent source coupled to an operator of dimension Delta. The initial state of the theory is taken to be at a finite temperature. We compute the energy dissipated in the system as a function of the frequency and of the dimension Delta of the perturbing operator. This is done in the linear response regime. In order to study the details of thermalization in the dual field theory, the leading-order backreaction on the AdS black brane metric is computed. The evolution of the event and the apparent horizons is monitored; the increase of area in each cycle coincides with the increase in the equilibrium entropy corresponding to the amount of energy dissipated. The time evolution of the entanglement entropy of a spherical region and that of the two-points function of a probe operator with a large dimension are also inspected; we find a delay in...

Condensed matter applications of AdS/CFT (II)

CERN Multimedia

CERN. Geneva

2009-01-01

AdS/CFT. Holographic superconductors will be discussed. The lectures will conclude with a discussion of open questions and future directions. References: - Holographic Superconductors. Sean A. Hartnoll, Christopher P. Herzog, Gary T. Horowitz, JHEP 0812:015,2008, arXiv:0810.1563 [hep-th] - Ohm's Law at strong coupling: S duality and the cyclotron resonance, Sean A. Hartnoll, Christopher P. Herzog,  Phys.Rev.D76:106012,2007, arXiv:0706.3228 [hep-th] - Gravity duals for non-relativistic CFTs. Koushik Balasubramanian, John McGreevy,  Phys.Rev.Lett.101:061601,2008, arXiv:0804.4053 [hep-th] - Toward an AdS/cold atoms correspondence: A Geometric realization of the Schrodinger symmetry. D.T. Son, Phys.Rev.D78:0...

Condensed matter applications of AdS/CFT (IV)

CERN Multimedia

CERN. Geneva

2009-01-01

AdS/CFT. Holographic superconductors will be discussed. The lectures will conclude with a discussion of open questions and future directions. References: - Holographic Superconductors. Sean A. Hartnoll, Christopher P. Herzog, Gary T. Horowitz, JHEP 0812:015,2008, arXiv:0810.1563 [hep-th] - Ohm's Law at strong coupling: S duality and the cyclotron resonance, Sean A. Hartnoll, Christopher P. Herzog,  Phys.Rev.D76:106012,2007, arXiv:0706.3228 [hep-th] - Gravity duals for non-relativistic CFTs. Koushik Balasubramanian, John McGreevy,  Phys.Rev.Lett.101:061601,2008, arXiv:0804.4053 [hep-th] - Toward an AdS/cold atoms correspondence: A Geometric realization of the Schrodinger symmetry. D.T. Son, Phys.Rev.D78:0...

Instantons on D7 brane probes and AdS/CFT with flavour

International Nuclear Information System (INIS)

Apreda, R.; Erdmenger, J.; Grosse, J.; Evans, N.; Guralnik, Z.

2006-01-01

Recent work on adding flavour to the generalized AdS/CFT correspondence is reviewed. In particular, we consider instanton configurations on two coincident D7 brane probes. These are matched to the Higgs branch of the dual field theory. In AdS 5 x S 5 , the instanton generates a flow of the meson spectrum. For non-supersymmetric gravity backgrounds, the Higgs branch is lifted by a potential with non-trivial physical implications. (Abstract Copyright [2006], Wiley Periodicals, Inc.)

Escherichia coli Probiotic Strain ED1a in Pigs Has a Limited Impact on the Gut Carriage of Extended-Spectrum-β-Lactamase-Producing E. coli

Science.gov (United States)

Mourand, G.; Paboeuf, F.; Fleury, M. A.; Jouy, E.; Bougeard, S.; Denamur, E.

2016-01-01

ABSTRACT Four trials were conducted to evaluate the impact of Escherichia coli probiotic strain ED1a administration to pigs on the gut carriage or survival in manure of extended-spectrum-β-lactamase-producing E. coli. Groups of pigs were orally inoculated with strain E. coli M63 carrying the blaCTX-M-1 gene (n = 84) or used as a control (n = 26). In the first two trials, 24 of 40 E. coli M63-inoculated pigs were given E. coli ED1a orally for 6 days starting 8 days after oral inoculation. In the third trial, 10 E. coli M63-inoculated pigs were given either E. coli ED1a or probiotic E. coli Nissle 1917 for 5 days. In the fourth trial, E. coli ED1a was given to a sow and its 12 piglets, and these 12 piglets plus 12 piglets that had not received E. coli ED1a were then inoculated with E. coli M63. Fecal shedding of cefotaxime-resistant Enterobacteriaceae (CTX-RE) was studied by culture, and blaCTX-M-1 genes were quantified by PCR. The persistence of CTX-RE in manure samples from inoculated pigs or manure samples inoculated in vitro with E. coli M63 with or without probiotics was studied. The results showed that E. coli M63 and ED1a were good gut colonizers. The reduction in the level of fecal excretion of CTX-RE in E. coli ED1a-treated pigs compared to that in nontreated pigs was usually less than 1 log10 CFU and was mainly observed during the probiotic administration period. The results obtained with E. coli Nissle 1917 did not differ significantly from those obtained with E. coli ED1a. CTX-RE survival did not differ significantly in manure samples with or without probiotic treatment. In conclusion, under our experimental conditions, E. coli ED1a and E. coli Nissle 1917 could not durably prevent CTX-RE colonization of the pig gut. PMID:27795372

Escherichia coli Probiotic Strain ED1a in Pigs Has a Limited Impact on the Gut Carriage of Extended-Spectrum-β-Lactamase-Producing E. coli.

Science.gov (United States)

Mourand, G; Paboeuf, F; Fleury, M A; Jouy, E; Bougeard, S; Denamur, E; Kempf, I

2017-01-01

Four trials were conducted to evaluate the impact of Escherichia coli probiotic strain ED1a administration to pigs on the gut carriage or survival in manure of extended-spectrum-β-lactamase-producing E. coli Groups of pigs were orally inoculated with strain E. coli M63 carrying the bla CTX-M-1 gene (n = 84) or used as a control (n = 26). In the first two trials, 24 of 40 E. coli M63-inoculated pigs were given E. coli ED1a orally for 6 days starting 8 days after oral inoculation. In the third trial, 10 E. coli M63-inoculated pigs were given either E. coli ED1a or probiotic E. coli Nissle 1917 for 5 days. In the fourth trial, E. coli ED1a was given to a sow and its 12 piglets, and these 12 piglets plus 12 piglets that had not received E. coli ED1a were then inoculated with E. coli M63. Fecal shedding of cefotaxime-resistant Enterobacteriaceae (CTX-RE) was studied by culture, and bla CTX-M-1 genes were quantified by PCR. The persistence of CTX-RE in manure samples from inoculated pigs or manure samples inoculated in vitro with E. coli M63 with or without probiotics was studied. The results showed that E. coli M63 and ED1a were good gut colonizers. The reduction in the level of fecal excretion of CTX-RE in E. coli ED1a-treated pigs compared to that in nontreated pigs was usually less than 1 log 10 CFU and was mainly observed during the probiotic administration period. The results obtained with E. coli Nissle 1917 did not differ significantly from those obtained with E. coli ED1a. CTX-RE survival did not differ significantly in manure samples with or without probiotic treatment. In conclusion, under our experimental conditions, E. coli ED1a and E. coli Nissle 1917 could not durably prevent CTX-RE colonization of the pig gut. Copyright © 2016 American Society for Microbiology.

Human metabolites of synthetic cannabinoids JWH-018 and JWH-073 bind with high affinity and act as potent agonists at cannabinoid type-2 receptors

Energy Technology Data Exchange (ETDEWEB)

Rajasekaran, Maheswari; Brents, Lisa K.; Franks, Lirit N. [Department of Pharmacology and Toxicology, University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States); Moran, Jeffery H. [Department of Pharmacology and Toxicology, University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States); Arkansas Department of Public Health, Public Health Laboratory, Little Rock, AR 72205 (United States); Prather, Paul L., E-mail: pratherpaull@uams.edu [Department of Pharmacology and Toxicology, University of Arkansas for Medical Sciences, Little Rock, AR 72205 (United States)

2013-06-01

K2 or Spice is an emerging drug of abuse that contains synthetic cannabinoids, including JWH-018 and JWH-073. Recent reports indicate that monohydroxylated metabolites of JWH-018 and JWH-073 retain high affinity and activity at cannabinoid type-1 receptors (CB{sub 1}Rs), potentially contributing to the enhanced toxicity of K2 compared to marijuana. Since the parent compounds also bind to cannabinoid type-2 receptors (CB{sub 2}Rs), this study investigated the affinity and intrinsic activity of JWH-018, JWH-073 and several monohydroxylated metabolites at human CB{sub 2}Rs (hCB{sub 2}Rs). The affinity of cannabinoids for hCB{sub 2}Rs was determined by competition binding studies employing CHO-hCB{sub 2} membranes. Intrinsic activity of compounds was assessed by G-protein activation and adenylyl cyclase (AC)-inhibition in CHO-hCB{sub 2} cells. JWH-073, JWH-018 and several of their human metabolites exhibit nanomolar affinity and act as potent agonists at hCB{sub 2}Rs. Furthermore, a major omega hydroxyl metabolite of JWH-073 (JWH-073-M5) binds to CB{sub 2}Rs with 10-fold less affinity than the parent molecule, but unexpectedly, is equipotent in regulating AC-activity when compared to the parent molecule. Finally, when compared to CP-55,940 and Δ{sup 9}-tetrahydrocannabinol (Δ{sup 9}-THC), JWH-018, JWH-018-M5 and JWH-073-M5 require significantly less CB{sub 2}R occupancy to produce similar levels of AC-inhibition, indicating that these compounds may more efficiently couple CB{sub 2}Rs to AC than the well characterized cannabinoid agonists examined. These results indicate that JWH-018, JWH-073 and several major human metabolites of these compounds exhibit high affinity and demonstrate distinctive signaling properties at CB{sub 2}Rs. Therefore, future studies examining pharmacological and toxicological properties of synthetic cannabinoids present in K2 products should consider potential actions of these drugs at both CB{sub 1} and CB{sub 2}Rs. - Highlights: • JWH-018

Real-time detection of antibiotic activity by measuring nanometer-scale bacterial deformation

Science.gov (United States)

Iriya, Rafael; Syal, Karan; Jing, Wenwen; Mo, Manni; Yu, Hui; Haydel, Shelley E.; Wang, Shaopeng; Tao, Nongjian

2017-12-01

Diagnosing antibiotic-resistant bacteria currently requires sensitive detection of phenotypic changes associated with antibiotic action on bacteria. Here, we present an optical imaging-based approach to quantify bacterial membrane deformation as a phenotypic feature in real-time with a nanometer scale (˜9 nm) detection limit. Using this approach, we found two types of antibiotic-induced membrane deformations in different bacterial strains: polymyxin B induced relatively uniform spatial deformation of Escherichia coli O157:H7 cells leading to change in cellular volume and ampicillin-induced localized spatial deformation leading to the formation of bulges or protrusions on uropathogenic E. coli CFT073 cells. We anticipate that the approach will contribute to understanding of antibiotic phenotypic effects on bacteria with a potential for applications in rapid antibiotic susceptibility testing.

Multi-trace deformations in AdS/CFT. Exploring the vacuum structure of the deformed CFT

Energy Technology Data Exchange (ETDEWEB)

Papadimitriou, I. [Deutsches Elektronen-Synchrotron (DESY), Hamburg (Germany)]|[Center for Mathematical Physics, Hamburg (Germany)

2007-03-15

We present a general and systematic treatment of multi-trace deformations in the AdS/CFT correspondence in the large N limit, pointing out and clarifying subtleties relating to the formulation of the boundary value problem on a conformal boundary. We then apply this method to study multi-trace deformations in the presence of a scalar VEV, which requires the coupling to gravity to be taken into account. We show that supergravity solutions subject to 'mixed' boundary conditions are in one-to-one correspondence with critical points of the holographic effective action of the dual theory in the presence of a multi-trace deformation, and we find a number of new exact analytic solutions involving a minimally or conformally coupled scalar field satisfying 'mixed' boundary conditions. These include the generalization to any dimension of the instanton solution recently found in hep-th/0611315. Finally, we provide a systematic method for computing the holographic effective action in the presence of a multi-trace deformation in a derivative expansion away from the conformal vacuum using Hamilton-Jacobi theory. Requiring that this effective action exists and is bounded from below reproduces recent results on the stability of the AdS vacuum in the presence of 'mixed' boundary conditions. (orig.)

Multi-trace deformations in AdS/CFT. Exploring the vacuum structure of the deformed CFT

International Nuclear Information System (INIS)

Papadimitriou, I.

2007-03-01

We present a general and systematic treatment of multi-trace deformations in the AdS/CFT correspondence in the large N limit, pointing out and clarifying subtleties relating to the formulation of the boundary value problem on a conformal boundary. We then apply this method to study multi-trace deformations in the presence of a scalar VEV, which requires the coupling to gravity to be taken into account. We show that supergravity solutions subject to 'mixed' boundary conditions are in one-to-one correspondence with critical points of the holographic effective action of the dual theory in the presence of a multi-trace deformation, and we find a number of new exact analytic solutions involving a minimally or conformally coupled scalar field satisfying 'mixed' boundary conditions. These include the generalization to any dimension of the instanton solution recently found in hep-th/0611315. Finally, we provide a systematic method for computing the holographic effective action in the presence of a multi-trace deformation in a derivative expansion away from the conformal vacuum using Hamilton-Jacobi theory. Requiring that this effective action exists and is bounded from below reproduces recent results on the stability of the AdS vacuum in the presence of 'mixed' boundary conditions. (orig.)

Gravitational collapse, chaos in CFT correlators and the information paradox

Energy Technology Data Exchange (ETDEWEB)

Farahi, Arya, E-mail: aryaf@umich.edu; Pando Zayas, Leopoldo A., E-mail: lpandoz@umich.edu

2014-06-27

We consider gravitational collapse of a massless scalar field in asymptotically anti-de Sitter spacetime. Following the AdS/CFT dictionary we further study correlations in the field theory side by way of the Klein–Gordon equation of a probe scalar field in the collapsing background. We present evidence that in a certain regime the probe scalar field behaves chaotically, thus supporting Hawking's argument in the black hole information paradox proposing that although the information can be retrieved in principle, deterministic chaos impairs, in practice, the process of unitary extraction of information from a black hole. We emphasize that quantum chaos will change this picture.

Constructing an explicit AdS/CFT correspondence with Cartan geometry

Directory of Open Access Journals (Sweden)

Jeffrey S. Hazboun

2018-04-01

Full Text Available An explicit AdS/CFT correspondence is shown for the Lie group SO(4,2. The Lie symmetry structures allow for the construction of two physical theories through the tools of Cartan geometry. One is a gravitational theory that has anti-de Sitter symmetry. The other is also a gravitational theory but is conformally symmetric and lives on 8-dimensional biconformal space. These “extra” four dimensions have the degrees of freedom used to construct a Yang–Mills theory. The two theories, based on AdS or conformal symmetry, have a natural correspondence in the context of their Lie algebras alone where neither SUSY, nor holography, is necessary.

Interacting fields in real-time AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Botta-Cantcheff, Marcelo; Martínez, Pedro J. [Instituto de Física de La Plata, CCT La Plata, CONICET & Departamento de Física,Universidad Nacional de La Plata, C.C. 67, 1900 La Plata (Argentina); Silva, Guillermo A. [Instituto de Física de La Plata, CCT La Plata, CONICET & Departamento de Física,Universidad Nacional de La Plata, C.C. 67, 1900 La Plata (Argentina); Abdus Salam International Centre for Theoretical Physics, Associate Scheme,Strada Costiera 11, 34151 Trieste (Italy)

2017-03-28

We compute time-ordered 2- and 3-pt correlation functions of CFT scalar operators between generic in/out states. The calculation is holographically carried out by considering a non backreacting AdS scalar field with a λϕ{sup 3} self-interaction term on a combination of Euclidean and Lorentzian AdS sections following the Skenderis-van Rees prescription. We show that, although working in an essentially different set up, the final result for the 3-pt correlators agree with those of Rastelli et al. for Euclidean AdS. By analyzing the inner product between the in/out excited states in the large N approximation, we argue that a cubic bulk interaction deforms the excited states from coherent into squeezed. Finally, a diagrammatic interpretation of the results suggests some general properties for the n-point correlation functions between excited states.

Dual QED_3 at “N_F=1/2” is an interacting CFT in the infrared

International Nuclear Information System (INIS)

Roscher, Dietrich; Torres, Emilio; Strack, Philipp

2016-01-01

We study the fate of weakly coupled dual QED_3 in the infrared, that is, a single two-component Dirac fermion coupled to an emergent U(1) gauge field, but without Chern-Simons term. This theory has recently been proposed as a dual description of 2D surfaces of certain topological insulators. Using the renormalization group, we find that the interplay of gauge fluctuations with generated interactions in the four-fermi sector stabilizes an interacting conformal field theory (CFT) with finite four-fermi coupling in the infrared. The emergence of this CFT is due to cancellations in the β-function of the four-fermi coupling special to “N_F=1/2”. We also quantify how a possible “strong” Dirac fermion duality between a free Dirac cone and dual QED_3 would constrain the universal constants of the topological current correlator of the latter.

Bulk locality and entanglement swapping in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Kelly, William R. [Center for Quantum Mathematics and Physics (QMAP),Department of Physics, University of California,Davis, CA 95616 (United States)

2017-03-29

Localized bulk excitations in AdS/CFT are produced by operators which modify the pattern of entanglement in the boundary state. We show that simple models — consisting of entanglement swapping operators acting on a qubit system or a free field theory — capture qualitative features of gravitational backreaction and reproduce predictions of the Ryu-Takayanagi formula. These entanglement swapping operators naturally admit multiple representations associated with different degrees of freedom, thereby reproducing the code subspace structure emphasized by Almheiri, Dong, and Harlow. We also show that the boundary Reeh-Schlieder theorem implies that equivalence of certain operators on a code subspace necessarily breaks down when non-perturbative effects are taken into account (as is expected based on bulk arguments).

Cusp anomalous dimension and rotating open strings in AdS/CFT

Science.gov (United States)

Espíndola, R.; García, J. Antonio

2018-03-01

In the context of AdS/CFT we provide analytical support for the proposed duality between a Wilson loop with a cusp, the cusp anomalous dimension, and the meson model constructed from a rotating open string with high angular momentum. This duality was previously studied using numerical tools in [1]. Our result implies that the minimum of the profile function of the minimal area surface dual to the Wilson loop, is related to the inverse of the bulk penetration of the dual string that hangs from the quark-anti-quark pair (meson) in the gauge theory.

A universal feature of CFT Rényi entropy

Energy Technology Data Exchange (ETDEWEB)

Perlmutter, Eric [DAMTP, Centre for Mathematical Sciences, University of Cambridge,Cambridge, CB3 0WA (United Kingdom)

2014-03-26

We show that for a d-dimensional CFT in flat space, the Rényi entropy S{sub q} across a spherical entangling surface has the following property: in an expansion around q=1, the first correction to the entanglement entropy is proportional to C{sub T}, the coefficient of the stress tensor vacuum two-point function, with a fixed d-dependent coefficient. This is equivalent to a similar statement about the free energy of CFTs living on S{sup 1}×ℍ{sup d−1} with inverse temperature β=2πq. In addition to furnishing a direct argument applicable to all CFTs, we exhibit this result using a handful of gravity and field theory computations. Knowledge of C{sub T} thus doubles as knowledge of Rényi entropies in the neighborhood of q=1, which we use to establish new results in 3d vector models at large N.

GIPSy

DEFF Research Database (Denmark)

Soares, Siomar C; Geyik, Hakan; Ramos, Rommel T J

2016-01-01

in Escherichia coli CFT073; 1 MI for Burkholderia pseudomallei K96243, which seems to be a miscellaneous island; 1 RI of Acinetobacter baumannii AYE, named AbaR1; and, 1 SI of Mesorhizobium loti MAFF303099 presenting a mosaic structure. GIPSy is the first life-style-specific genomic island prediction software...

Exact correlators on the Wilson loop in N=4 SYM: localization, defect CFT, and integrability

Science.gov (United States)

Giombi, Simone; Komatsu, Shota

2018-05-01

We compute a set of correlation functions of operator insertions on the 1 /8 BPS Wilson loop in N=4 SYM by employing supersymmetric localization, OPE and the Gram-Schmidt orthogonalization. These correlators exhibit a simple determinant structure, are position-independent and form a topological subsector, but depend nontrivially on the 't Hooft coupling and the rank of the gauge group. When applied to the 1 /2 BPS circular (or straight) Wilson loop, our results provide an infinite family of exact defect CFT data, including the structure constants of protected defect primaries of arbitrary length inserted on the loop. At strong coupling, we show precise agreement with a direct calculation using perturbation theory around the AdS2 string worldsheet. We also explain the connection of our results to the "generalized Bremsstrahlung functions" previously computed from integrability techniques, reproducing the known results in the planar limit as well as obtaining their finite N generalization. Furthermore, we show that the correlators at large N can be recast as simple integrals of products of polynomials (known as Q-functions) that appear in the Quantum Spectral Curve approach. This suggests an interesting interplay between localization, defect CFT and integrability.

Magnetocrystalline anisotropy in a (110) (Tb0.27Dy0.73)Fe2 thin-film

International Nuclear Information System (INIS)

Fuente, C de la; Arnaudas, J I; Benito, L; Ciria, M; Moral, A del; Dufour, C; Dumesnil, K

2004-01-01

Magnetic anisotropy measurements performed in a (110) (Tb 0.27 Dy 0.73 )Fe 2 (Terfenol-D) film epitaxially grown on a sapphire substrate are presented. The magnetic torque curves have been determined by using a vectorial vibrating sample magnetometer, which allows us to measure the angular dependence of magnetization components parallel, M parallel , and perpendicular, M perp , to the applied field up to 2 T. The fourfold symmetry associated with the cubic structure within the (110) plane is clearly observed. The analysis of the experimental torque has been carried out considering magnetocrystalline anisotropy up to sixth order and magnetoelastic energy up to second order; so, the magnetocrystalline anisotropy constants in the (110) plane of the film, K 1 and K 2 , have been obtained. This allows us to determine the direction of the magnetization easy axis for (110) Terfenol-D thin-film: it is [1bar12] at RT, passes through [3bar34] at 140 K and then changes to [1bar20] at 40 K. It was completely impossible to explain the angular dependence of the experimental magnetic torque without including shear and tetragonal magnetoelastic stress parameters, b 2 and b 1 , respectively. This confirms the paramount role of the strain in the determination of the magnetic properties in this kind of Terfenol-D thin film

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

Effects of CFT Legumine (5% Rotenone) on tadpole survival and metamorphosis of Chiricahua leopard frogs Lithobates chiricahuensis, Northern leopard frogs L. pipiens, and American bullfrogs L. catesbeianus

Science.gov (United States)

Alvarez, Guillermo; Caldwell, Colleen A.; Kruse, Carter G.

2017-01-01

Amphibians may experience collateral effects if exposed to CFT Legumine (5% rotenone), a piscicide that is used to remove invasive fish. A series of 48-h static toxicity tests assessed the acute effects of CFT Legumine on multi-aged tadpoles of the federally listed Chiricahua leopard frog Lithobates chiricahuensis, the widespread northern leopard frog L. pipiens, and the increasingly invasive American bullfrog L. catesbeianus. At the earliest Gosner stages (GS 21–25), Chiricahua leopard frogs were more sensitive to CFT Legumine (median lethal concentration [LC50] = 0.41–0.58 mg/L) than American bullfrogs (LC50 = 0.63–0.69 mg/L) and northern leopard frogs (LC50 = 0.91 and 1.17 mg/L). As tadpoles developed (i.e., increase in GS), their sensitivity to rotenone decreased. In a separate series of 48-h static nonrenewal toxicity tests, tadpoles (GS 21–25 and GS 31–36) of all three species were exposed to piscicidal concentrations of CFT Legumine (0.5, 1.0, and 2.0 mg/L) to assess postexposure effects on metamorphosis. In survivors of all three species at both life stages, the time to tail resorption was nearly doubled in comparison with that of controls. For example, mid-age (GS 31–36) Chiricahua leopard frog tadpoles required 210.7 h to complete tail resorption, whereas controls required 108.5 h. However, because tail resorption is a relatively short period in metamorphosis, the total duration of development (days from posthatch to complete metamorphosis) and the final weight did not differ in either age-group surviving nominal concentrations of 0.5-, 1.0-, and 2.0-mg/L CFT Legumine relative to controls. This research demonstrates that the CFT Legumine concentrations commonly used in field applications to remove unwanted fish could result in considerable mortality of the earliest stages of Lithobates species. In addition to acute lethality, piscicide treatments may result in delayed tail resorption, which places the tadpoles at risk by increasing

Can sea trout Salmo trutta compromise successful eradication of Gyrodactylus salaris by hiding from CFT Legumin (rotenone) treatments?

DEFF Research Database (Denmark)

Davidsen, J. G.; Thorstad, E. B.; Baktoft, H.

2013-01-01

In this study, 34 anadromous brown trout (sea trout) Salmo trutta were equipped with acoustic transmitters in order to examine whether they performed avoidance behaviour in response to a CFT Legumin (rotenone) treatment in the Norwegian River Vefsna. Migratory behaviour of the S. trutta was monit...

Functional perturbative RG and CFT data in the ε-expansion

Energy Technology Data Exchange (ETDEWEB)

Codello, A. [Southern Denmark Univ., Odense (Denmark). CP3-Origins; INFN-Sezione di Bologna, Bologna (Italy); Safari, M. [INFN-Sezione di Bologna, Bologna (Italy); Bologna Univ. (Italy). Dipt di Fisica e Astronomia; Vacca, G.P. [INFN-Sezione di Bologna, Bologna (Italy); Zanusso, O. [INFN-Sezione di Bologna, Bologna (Italy); Jena Univ. (Germany). Theoretisch-Physikalisches Inst.

2018-01-15

We show how the use of standard perturbative RG in dimensional regularization allows for a renormalization group-based computation of both the spectrum and a family of coefficients of the operator product expansion (OPE) for a given universality class. The task is greatly simplified by a straightforward generalization of perturbation theory to a functional perturbative RG approach. We illustrate our procedure in the ε-expansion by obtaining the next-to-leading corrections for the spectrum and the leading corrections for the OPE coefficients of Ising and Lee-Yang universality classes and then give several results for the whole family of renormalizable multi-critical models φ{sup 2n}. Whenever comparison is possible our RG results explicitly match the ones recently derived in CFT frameworks. (orig.)

Functional perturbative RG and CFT data in the ϵ -expansion

DEFF Research Database (Denmark)

Codello, A.; Safari, M.; Vacca, G. P.

2018-01-01

We show how the use of standard perturbative RG in dimensional regularization allows for a renormalization group-based computation of both the spectrum and a family of coefficients of the operator product expansion (OPE) for a given universality class. The task is greatly simplified by a straight......We show how the use of standard perturbative RG in dimensional regularization allows for a renormalization group-based computation of both the spectrum and a family of coefficients of the operator product expansion (OPE) for a given universality class. The task is greatly simplified...... several results for the whole family of renormalizable multi-critical models ϕ2 n. Whenever comparison is possible our RG results explicitly match the ones recently derived in CFT frameworks....

On excited states in real-time AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Botta-Cantcheff, Marcelo; Martínez, Pedro J.; Silva, Guillermo A. [Instituto de Física de La Plata - CONICET & Departamento de Física - UNLP,C.C. 67, 1900 La Plata (Argentina)

2016-02-25

The Skenderis-van Rees prescription, which allows the calculation of time-ordered correlation functions of local operators in CFT’s using holographic methods is studied and applied for excited states. Calculation of correlators and matrix elements of local CFT operators between generic in/out states are carried out in global Lorentzian AdS. We find the precise form of such states, obtain an holographic formula to compute the inner product between them, and using the consistency with other known prescriptions, we argue that the in/out excited states built according to the Skenderis-Van Rees prescription correspond to coherent states in the (large-N) AdS-Hilbert space. This is confirmed by explicit holographic computations. The outcome of this study has remarkable implications on generalizing the Hartle-Hawking construction for wave functionals of excited states in AdS quantum gravity.

Solvable spectral problems from 2d CFT and \\mathscr{N} = 2 gauge theories

Science.gov (United States)

Piątek, M. R.; Pietrykowski, A. R.

2018-02-01

The so-called 2d/4d correspondences connect two-dimensional conformal field theory (2d CFT), \\mathscr{N} = 2 supersymmetric gauge theories and quantum integrable systems. The latter in the simplest case of the SU(2) gauge group are nothing but the quantum-mechanical systems. In the present article we summarize our recent results and list open problems concerning an application of the aforementioned dualities in the studies of spectral problems for some Schrödinger operators with Mathieu-type periodic, periodic PT-symmetric and (Heun’s) elliptic potentials.

Light-cone AdS/CFT-adapted approach to AdS fields/currents, shadows, and conformal fields

Energy Technology Data Exchange (ETDEWEB)

Metsaev, R.R. [Department of Theoretical Physics, P.N. Lebedev Physical Institute, Leninsky prospect 53, Moscow 119991 (Russian Federation)

2015-10-16

Light-cone gauge formulation of fields in AdS space and conformal field theory in flat space adapted for the study of AdS/CFT correspondence is developed. Arbitrary spin mixed-symmetry fields in AdS space and arbitrary spin mixed-symmetry currents, shadows, and conformal fields in flat space are considered on an equal footing. For the massless and massive fields in AdS and the conformal fields in flat space, simple light-cone gauge actions leading to decoupled equations of motion are found. For the currents and shadows, simple expressions for all 2-point functions are also found. We demonstrate that representation of conformal algebra generators on space of currents, shadows, and conformal fields can be built in terms of spin operators entering the light-cone gauge formulation of AdS fields. This considerably simplifies the study of AdS/CFT correspondence. Light-cone gauge actions for totally symmetric arbitrary spin long conformal fields in flat space are presented. We apply our approach to the study of totally antisymmetric (one-column) and mixed-symmetry (two-column) fields in AdS space and currents, shadows, and conformal fields in flat space.

Area 3a in the cat. I. A reevaluation of its location and architecture on the basis of Nissl, myelin, acetylcholinesterase, and cytochrome oxidase staining.

Science.gov (United States)

Avendaño, C; Verdu, A

1992-07-15

Current knowledge on the anatomy of area 3a of the cat mainly derives from the cyto- and myeloarchitectonic study of Hassler and Muhs-Clement (J Hirnforsch 6:377, 1964). Previous investigations in the cat had failed to identify a cortical region comparable to monkey's area 3a. In the present study, Nissl, myelin, acetylcholinesterase, and cytochrome oxidase staining techniques were applied to coronal and sagittal serial sections of the cat brain. Area 3a appears as a slender band of cortex between areas 4 and 3b, and in Nissl-stained sections it is mainly characterized by an attenuated granular layer IV, overlying a thin layer V with pyramidal cells of various sizes, including a few large ones. These cytoarchitectonic features are sufficient to differentiate area 3a from neighboring areas, although the borders between them are not sharp in many cases. After the Nissl staining, the acetylcholinesterase staining proved to be the most helpful in defining the structure and borders of area 3a. Acetylcholinesterase staining was dense in layer I (in contrast with a lighter staining of outer layer I in area 4), and light in layers II and IIIa, changing to moderate in IIIc and IV (a pattern which is accentuated in area 3b). Myelin and cytochrome oxidase techniques also yielded differential staining patterns of area 3a and neighboring areas 4 and 3b, although the borders were not easily drawn with these techniques. Whereas our cyto- and myeloarchitectonic findings were comparable to those of Hassler and Muhs-Clement ('64) and applied well to area 3a in the convexity of the hemisphere, we found that most of the area 3a described by these authors in the medial face of the hemisphere had a number of distinguishing architectonic (as well as connectional and physiological) features which enabled us to define it as a separate area (7m). The techniques we used to delineate area 3a are compatible with most current procedures of histo- and immunohistochemical staining of the brain

Revisiting AdS/CFT at a finite radial cut-off

Energy Technology Data Exchange (ETDEWEB)

Mandal, Gautam; Nayak, Pranjal [Department of Theoretical Physics,Tata Institute of Fundamental Research, Mumbai 400005 (India)

2016-12-22

We revisit AdS/CFT at a finite radial cut-off, specifically in the context of double trace perturbations, O{sub n}= O(x)(∂{sup 2}){sup n}O(x), with arbitrary powers n. As well-known, the standard GKPW prescription, applied to a finite radial cut-off, leads to contact terms in correlators. de Haro et al. http://dx.doi.org/10.1007/s002200100381 introduced bulk counterterms to remove these. This prescription, however, yields additional terms in the correlator corresponding to spurious double trace deformations. Further, if we view the GKPW prescription coupled with the prescription in http://dx.doi.org/10.1007/s002200100381, in terms of a boundary wavefunction, we find that it is incompatible with radial Schrödinger evolution (in the spirit of holographic Wilsonian RG). We consider a more general wavefunction satisfying the Schrödinger equation, and find that generically such wavefunctions generate both (a) double trace deformations and (b) contact terms. However, we find that there exist special choices of these wavefunctions, amounting to a new AdS/CFT prescription at a finite cut-off, so that both (a) and (b) are removed and we obtain a pure power law behaviour for the correlator. We compare these special wavefunctions with a specific RG scheme in field theory. We give a geometric interpretation of these wavefunctions; these correspond to some specific smearing of boundary points in the Witten diagrams. We present a comprehensive calculation of exact double-trace beta-functions for all couplings O{sub n} and match with a holographic computation using the method described above. The matching works with a mapping between the field theory and bulk couplings; such a map is highly constrained because the beta-functions are quadratic and exact on both sides. Our discussions include a generalization of the standard double-trace Wilson-Fisher flow to the space of the infinite number of couplings.

Heisenberg saturation of the Froissart bound from AdS-CFT

International Nuclear Information System (INIS)

Kang, Kyungsik; Nastase, Horatiu

2005-01-01

In a previous paper, we have analyzed high energy QCD from AdS-CFT and proved the saturation of the Froissart bound (a purely QCD proof of which is still lacking). In this Letter we describe the calculation in more physical terms and map it to QCD language. We find a remarkable agreement with the 1952 Heisenberg description of the saturation (pre-QCD!) in terms of shockwave collisions of pion field distributions. It provides a direct map between gauge theory physics and the gravitational physics on the IR brane of the Randall-Sundrum model. Saturation occurs through black hole production on the IR brane, which is in QCD production of a nonlinear pion field soliton of a Born-Infeld action in the hadron collision, that decays into free pions

Reliability assessment of a bi-material notch: Strain energy density factor approach

Czech Academy of Sciences Publication Activity Database

Klusák, Jan; Knésl, Zdeněk

2010-01-01

Roč. 53, č. 2 (2010), s. 89-93 ISSN 0167-8442 R&D Projects: GA ČR GAP108/10/2049; GA ČR GA101/08/0994 Institutional research plan: CEZ:AV0Z20410507 Keywords : crack initiation * bi-material notch * strain energy density factor Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 1.073, year: 2010

Comments on Cosmic Censorship in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Hubeny, V.

2004-04-06

Recently Hertog, Horowitz, and Maeda (HHM) (hep-th/0310054) have proposed that cosmic censorship can be violated in the AdS/CFT context. They argue that for certain initial data there is insufficient energy available to make a black hole whose horizon is big enough to cloak the singularity that forms. We have investigated this proposal in the models HHM discuss and have thus far been unable to find initial data that provably satisfy this criterion, despite our development of an improved lower bound on the size of the singular region. This is consistent with recent numerical results (hep-th/0402109). For certain initial data, the energies of our configurations are not far above the lower bound on the requisite black hole mass, and so it is possible that in the exact time development naked singularities do form. We go on to argue that the finite radius cut-off AdS5 situation discussed by HHM displays instabilities when the full 10D theory is considered. We propose an AdS3 example that may well be free of this instability.

Comments on Cosmic Censorship in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Hubeny, Veronika E.; Liu, Xiao; Rangamani, Mukund; Shenker, Stephen

2004-03-21

Recently Hertog, Horowitz, and Maeda (HHM) (hep-th/0310054) have proposed that cosmic censorship can be violated in the AdS/CFT context. They argue that for certain initial data there is insufficient energy available to make a black hole whose horizon is big enough to cloak the singularity that forms. We have investigated this proposal in the models HHM discuss and have thus far been unable to find initial data that provably satisfy this criterion, despite our development of an improved lower bound on the size of the singular region. This is consistent with recent numerical results (hep-th/0402109). For certain initial data, the energies of our configurations are not far above the lower bound on the requisite black hole mass, and so it is possible that in the exact time development naked singularities do form. We go on to argue that the finite radius cut-off AdS_5 situation discussed by HHM displays instabilities when the full 10D theory is considered. We propose an AdS_3 example that may well be free of this instability.

Comments on cosmic censorship in AdS/CFT

International Nuclear Information System (INIS)

Hubeny, Veronika E.; Shenker, Stephen; Liu Xiao; Rangamani, Mukund

2004-01-01

Recently Hertog, Horowitz, and Maeda (HHM) have proposed that cosmic censorship can be violated in the AdS/CFT context. They argue that for certain initial data there is insufficient energy available to make a black hole whose horizon is big enough to cloak the singularity that forms. We have investigated this proposal in the models HHM discuss and have thus far been unable to find initial data that provably satisfy this criterion, despite our development of an improved lower bound on the size of the singular region. This is consistent with recent numerical results. For certain initial data, the energies of our configurations are not far above the lower bound on the requisite black hole mass, and so it is possible that in the exact time development naked singularities do form. We go on to argue that the finite radius cut-off AdS 5 situation discussed by HHM displays instabilities when the full 10D theory is considered. We propose an AdS 3 example that may well be free of this instability. (author)

Comments on cosmic censorship in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Hubeny, Veronika E. [Department of Physics, Stanford University, Stanford, CA 94305 (United States)]. E-mail: veronika@itp.stanford.edu; Shenker, Stephen [Department of Physics, Stanford University, Stanford, CA 94305 (United States); Liu Xiao [Department of Physics, Stanford University, Stanford, CA 94305 (United States); SLAC, Stanford University, Stanford, CA 94309 (United States); Rangamani, Mukund [Department of Physics, University of California, Berkeley, CA 94720 (United States); Theoretical Physics Group, LBNL, Berkeley, CA 94720 (United States)

2004-12-01

Recently Hertog, Horowitz, and Maeda (HHM) have proposed that cosmic censorship can be violated in the AdS/CFT context. They argue that for certain initial data there is insufficient energy available to make a black hole whose horizon is big enough to cloak the singularity that forms. We have investigated this proposal in the models HHM discuss and have thus far been unable to find initial data that provably satisfy this criterion, despite our development of an improved lower bound on the size of the singular region. This is consistent with recent numerical results. For certain initial data, the energies of our configurations are not far above the lower bound on the requisite black hole mass, and so it is possible that in the exact time development naked singularities do form. We go on to argue that the finite radius cut-off AdS{sub 5} situation discussed by HHM displays instabilities when the full 10D theory is considered. We propose an AdS{sub 3} example that may well be free of this instability. (author)

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... CFT073] ref|NP_415411.1| periplasmic chaperone effects ... translocation... ... periplasmic protein effects translocation of ... lipoproteins from inner membrane to outer; pe...riplasmic ... chaperone effects translocation of lipoproteins from ... ...78.1| periplasmic protein effects translocation ... of lipoproteins from i...nner membrane to outer ... [Escherichia coli O157:H7 EDL933] dbj|BAB34399.1| ... periplasmic protein effects

Ultrathin epidermal strain sensor based on an elastomer nanosheet with an inkjet-printed conductive polymer

Science.gov (United States)

Tetsu, Yuma; Yamagishi, Kento; Kato, Akira; Matsumoto, Yuya; Tsukune, Mariko; Kobayashi, Yo; Fujie, Masakatsu G.; Takeoka, Shinji; Fujie, Toshinori

2017-08-01

To minimize the interference that skin-contact strain sensors cause natural skin deformation, physical conformability to the epidermal structure is critical. Here, we developed an ultrathin strain sensor made from poly(3,4-ethylenedioxythiophene):poly(styrene sulfonate) (PEDOT:PSS) inkjet-printed on a polystyrene-polybutadiene-polystyrene (SBS) nanosheet. The sensor, whose total thickness and gauge factor were ˜1 µm and 0.73 ± 0.10, respectively, deeply conformed to the epidermal structure and successfully detected the small skin strain (˜2%) while interfering minimally with the natural deformation of the skin. Such an epidermal strain sensor will open a new avenue for precisely detecting the motion of human skin and artificial soft-robotic skin.

Bariones y gravitones gigantes en el marco de la correspondencia AdS/CFT

OpenAIRE

Picos Sol, Marco Antonio

2012-01-01

Se construyen y analizan dos tipos de configuraciones que pueden construirse en el espacio dual a la teoría ABJM (en la dualidad AdS_4/CFT_3): gravitones gigantes y vértices bariónicos. Ambas configuraciones hacen uso de la posibilidad de enrrollar branas en ciclos topológicamente no triviales en el lado gravitatorio de la dualidad. Los vértices bariónicos están formados por branas enrrolladas atadas a cuerdas que se extienden hasta la frontera de AdS, y son vistos desde el lado gauge com...

American experience in the implementation of AML / CFT system

Directory of Open Access Journals (Sweden)

Larin Dmitry

2016-01-01

Full Text Available This article presents a research into very specific matters and issues of creating and further improvement of Anti-Money Laundering and Combating the Financing of Terrorism system (abbreviated as AML/CFT in the USA. In contains a precise analysis of key elements of this system, as well as a deep look into the nature and purposes of financial intelligence “FinCEN”. Strong emphasis is laid on The US Foreign Account Tax Compliance Act (FATCA for the reason that, according to this Act, any foreign financial institution is legitimately forced to sign a special agreement with The US Internal Revenue Service (IRS, giving the Service power to maintain control over any American asset within its equity. The latter is understood as a legal right to investigate not only the accounts and property of American taxpayers, but to investigate any account or capital of any foreign institution having American shares or stocks.

Aspects of AdS, CFT. Black solutions in gauged supergravity and holographic conductivities

International Nuclear Information System (INIS)

Barisch-Dick, Susanne

2013-01-01

We have met some interesting results within the wide subject of the AdS/CFT correspondence. We have seen how to apply AdS/CFT techniques to calculate the frequency dependent conductivity tensor for field theories dual to a black hole in Einstein-Yang-Mills theory with SU(2) gauge group. Further, we have constructed several new black solutions in N=2 U(1) gauged supergravity in four and five dimensions. The larger part of these solutions behave asymptotically like AdS which makes them interesting within the AdS/CFT context. In addition we found extremal black branes with zero entropy density - the Nernst branes. Nonetheless we are left with some yet unsolved problems. It is very interesting to see what causes the negative entropy production rate we found in chapter 4 for the normal state of the field theory. The next task is to see whether we can find an instability on the gravity side looking at the full Einstein-Yang-Mills equations. Also our work on supergravity solutions in four and five dimension exhibits some ''loose ends''. Since all our four-dimensional Nernst solutions were axion-free it would be nice to find one with axions excited. Moreover, it would be interesting to see whether the singular solutions with flowing γ could be cured by taking into account higher derivative corrections or whether there exist non-singular solutions with non-constant γ. In five dimensions we met problems when adding electric charge. At present we could not find a dyonic solution and we had the impression that having electric charges and having magnetic fields seemed to be somehow complementary to each other. We saw these difficulties even at the beginning when we performed the first-order rewriting since the first-order rewriting in chapter 6 leads to flow equations for the scalars X A which only contain magnetic fields and fluxes but no electric charges. The latter only influence the equations of motion for the X A in an indirect way. However it is possible to find

Einstein black holes, free scalars, and AdS/CFT correspondence

International Nuclear Information System (INIS)

Louko, Jorma; Wisniewski, Jacek

2004-01-01

We investigate AdS/CFT correspondence for two families of Einstein black holes in d≥4 dimensions, modeling the boundary conformal field theory by a free conformal scalar field and evaluating the boundary two-point function in the bulk geodesic approximation. For the d≥4 counterpart of the nonrotating Banados-Teitelboim-Zanelli hole and for its Z 2 quotient, the boundary state is thermal in the expected sense, and its stress-energy reflects the properties of the bulk geometry and suggests a novel definition for the mass of the hole. For the generalized Schwarzschild-AdS hole with a flat horizon of topology R d-2 , the boundary stress-energy has a thermal form with energy density proportional to the hole Arnowitt-Deser-Misner mass, but stress-energy corrections from compactified horizon dimensions cannot be consistently included at least for d=5

In vivo effects of synthetic cannabinoids JWH-018 and JWH-073 and phytocannabinoid Δ9-THC in mice: inhalation versus intraperitoneal injection.

Science.gov (United States)

Marshell, R; Kearney-Ramos, T; Brents, L K; Hyatt, W S; Tai, S; Prather, P L; Fantegrossi, W E

2014-09-01

Human users of synthetic cannabinoids (SCBs) JWH-018 and JWH-073 typically smoke these drugs, but preclinical studies usually rely on injection for drug delivery. We used the cannabinoid tetrad and drug discrimination to compare in vivo effects of inhaled drugs with injected doses of these two SCBs, as well as with the phytocannabinoid Δ(9)-tetrahydrocannabinol (Δ(9)-THC). Mice inhaled various doses of Δ(9)-THC, JWH-018 or JWH-073, or were injected intraperitoneally (IP) with these same compounds. Rectal temperature, tail flick latency in response to radiant heat, horizontal bar catalepsy, and suppression of locomotor activity were assessed in each animal. In separate studies, mice were trained to discriminate Δ(9)-THC (IP) from saline, and tests were performed with inhaled or injected doses of the SCBs. Both SCBs elicited Δ(9)-THC-like effects across both routes of administration, and effects following inhalation were attenuated by pretreatment with the CB1 antagonist/inverse agonist rimonabant. No cataleptic effects were observed following inhalation, but all compounds induced catalepsy following injection. Injected JWH-018 and JWH-073 fully substituted for Δ(9)-THC, but substitution was partial (JWH-073) or required relatively higher doses (JWH-018) when drugs were inhaled. These studies demonstrate that the SCBs JWH-018 and JWH-073 elicit dose-dependent, CB1 receptor-mediated Δ(9)-THC-like effects in mice when delivered via inhalation or via injection. Across these routes of administration, differences in cataleptic effects and, perhaps, discriminative stimulus effects, may implicate the involvement of active metabolites of these compounds. Copyright © 2014 Elsevier Inc. All rights reserved.

Compliance with the AM+L4776L/CFT International Standard; Lessons from a Cross-Country Analysis

OpenAIRE

Concha Verdugo Yepes

2011-01-01

This paper assesses countries' compliance with the Anti-Money Laundering and Combating the Financing of Terrorism (AML/CFT) international standard during the period 2004 to 2011. We find that overall compliance is low; there is an adverse impact on financial transparency created by the cumulative effects of poor implementation of standards on customer identification; and the current measurements of compliance do not take into account an analysis of ML/FT risk, thereby undermining their credib...

A SIMPLE DERIVATION OF FINITE-TEMPERATURE CFT CORRELATORS FROM THE BTZ BLACK HOLE

Directory of Open Access Journals (Sweden)

Satoshi Ohya

2014-04-01

Full Text Available We present a simple Lie-algebraic approach to momentum-space two-point functions of two-dimensional conformal field theory at finite temperature dual to the BTZ black hole. Making use of the real-time prescription of AdS/CFT correspondence and ladder equations of the Lie algebra so(2,2 ∼= sl(2,RL⊕sl(2,RR, we show that the finite-temperature two-point functions in momentum space satisfy linear recurrence relations with respect to the left and right momenta. These recurrence relations are exactly solvable and completely determine the momentum-dependence of retarded and advanced two-point functions of finite-temperature conformal field theory.

AdS5/CFT4 four-point functions of chiral primary operators: Cubic vertices

International Nuclear Information System (INIS)

Lee, Sangmin

1999-01-01

We study the exchange diagrams in the computation of four-point functions of all chiral primary operators in D=4, N=4 super Yang-Mills using AdS/CFT correspondence. We identify all supergravity fields that can be exchanged and compute the cubic couplings. As a byproduct, we also rederive the normalization of the quadratic action of the exchanged fields. The cubic couplings computed in this paper and the propagators studied extensively in the literature can be used to compute almost all the exchange diagrams explicitly. Some issues in computing the complete four-point function in the 'massless sector' are discussed

Aspects of AdS, CFT. Black solutions in gauged supergravity and holographic conductivities

Energy Technology Data Exchange (ETDEWEB)

Barisch-Dick, Susanne

2013-04-26

We have met some interesting results within the wide subject of the AdS/CFT correspondence. We have seen how to apply AdS/CFT techniques to calculate the frequency dependent conductivity tensor for field theories dual to a black hole in Einstein-Yang-Mills theory with SU(2) gauge group. Further, we have constructed several new black solutions in N=2 U(1) gauged supergravity in four and five dimensions. The larger part of these solutions behave asymptotically like AdS which makes them interesting within the AdS/CFT context. In addition we found extremal black branes with zero entropy density - the Nernst branes. Nonetheless we are left with some yet unsolved problems. It is very interesting to see what causes the negative entropy production rate we found in chapter 4 for the normal state of the field theory. The next task is to see whether we can find an instability on the gravity side looking at the full Einstein-Yang-Mills equations. Also our work on supergravity solutions in four and five dimension exhibits some ''loose ends''. Since all our four-dimensional Nernst solutions were axion-free it would be nice to find one with axions excited. Moreover, it would be interesting to see whether the singular solutions with flowing γ could be cured by taking into account higher derivative corrections or whether there exist non-singular solutions with non-constant γ. In five dimensions we met problems when adding electric charge. At present we could not find a dyonic solution and we had the impression that having electric charges and having magnetic fields seemed to be somehow complementary to each other. We saw these difficulties even at the beginning when we performed the first-order rewriting since the first-order rewriting in chapter 6 leads to flow equations for the scalars X{sup A} which only contain magnetic fields and fluxes but no electric charges. The latter only influence the equations of motion for the X{sup A} in an indirect way. However

Boost-invariant early time dynamics from AdS/CFT

International Nuclear Information System (INIS)

Beuf, Guillaume; Peschanski, Robi; Heller, Michal P.; Janik, Romuald A.

2009-01-01

Boost-invariant dynamics of a strongly-coupled conformal plasma is studied in the regime of early proper-time using the AdS/CFT correspondence. It is shown, in contrast with the late-time expansion, that a scaling solution does not exist. The boundary dynamics in this regime depends on initial conditions encoded in the bulk behavior of a Fefferman-Graham metric coefficient at initial proper-time. The relation between the early-time expansion of the energy density and initial conditions in the bulk of AdS is provided. As a general result it is proven that a singularity of some metric coefficient in Fefferman-Graham frame exists at all times. Requiring that this singularity at τ = 0 is a mere coordinate singularity without the curvature blow-up gives constraints on the possible boundary dynamics. Using a simple Pade resummation for solutions satisfying the regularity constraint, the features of a transition to local equilibrium, and thus to the hydrodynamical late-time regime, have been observed. The impact of this study on the problem of thermalization is discussed.

Increasing Incidence of Linezolid-Intermediate or -Resistant, Vancomycin-Resistant Enterococcus faecium Strains Parallels Increasing Linezolid Consumption▿

OpenAIRE

Scheetz, Marc H.; Knechtel, Stephanie A.; Malczynski, Michael; Postelnick, Michael J.; Qi, Chao

2008-01-01

Clinical enterococcal resistance to linezolid is defined by the presence of the G2576T mutation. We evaluated the incidence of genetically proven linezolid resistance among vancomycin-resistant Enterococcus faecium strains and linezolid consumption for a possible association. A relationship was found (r2 = 0.73, P = 0.03) and predicts increasing resistance with current trends of linezolid use.

Leading CFT constraints on multi-critical models in d>2

Energy Technology Data Exchange (ETDEWEB)

Codello, Alessandro [CP-Origins, University of Southern Denmark,Campusvej 55, 5230 Odense M (Denmark); INFN - Sezione di Bologna,via Irnerio 46, 40126 Bologna (Italy); Safari, Mahmoud [INFN - Sezione di Bologna,via Irnerio 46, 40126 Bologna (Italy); Dipartimento di Fisica e Astronomia, Università di Bologna,via Irnerio 46, 40126 Bologna (Italy); Vacca, Gian Paolo [INFN - Sezione di Bologna,via Irnerio 46, 40126 Bologna (Italy); Zanusso, Omar [Theoretisch-Physikalisches Institut, Friedrich-Schiller-Universität Jena,Max-Wien-Platz 1, 07743 Jena (Germany); INFN - Sezione di Bologna,via Irnerio 46, 40126 Bologna (Italy)

2017-04-21

We consider the family of renormalizable scalar QFTs with self-interacting potentials of highest monomial ϕ{sup m} below their upper critical dimensions d{sub c}=((2m)/(m−2)), and study them using a combination of CFT constraints, Schwinger-Dyson equation and the free theory behavior at the upper critical dimension. For even integers m≥4 these theories coincide with the Landau-Ginzburg description of multi-critical phenomena and interpolate with the unitary minimal models in d=2, while for odd m the theories are non-unitary and start at m=3 with the Lee-Yang universality class. For all the even potentials and for the Lee-Yang universality class, we show how the assumption of conformal invariance is enough to compute the scaling dimensions of the local operators ϕ{sup k} and of some families of structure constants in either the coupling’s or the ϵ-expansion. For all other odd potentials we express some scaling dimensions and structure constants in the coupling’s expansion.

Leading CFT constraints on multi-critical models in d > 2

DEFF Research Database (Denmark)

Codello, Alessandro; Safari, Mahmoud; Vacca, Gian Paolo

2017-01-01

We consider the family of renormalizable scalar QFTs with self-interacting potentials of highest monomial ϕm below their upper critical dimensions dc=2mm−2, and study them using a combination of CFT constraints, Schwinger-Dyson equation and the free theory behavior at the upper critical dimension....... For even integers m ≥ 4 these theories coincide with the Landau-Ginzburg description of multi-critical phenomena and interpolate with the unitary minimal models in d = 2, while for odd m the theories are non-unitary and start at m = 3 with the Lee-Yang universality class. For all the even potentials...... and for the Lee-Yang universality class, we show how the assumption of conformal invariance is enough to compute the scaling dimensions of the local operators ϕk and of some families of structure constants in either the coupling’s or the ϵ-expansion. For all other odd potentials we express some scaling dimensions...

Non-equilibrium scalar two point functions in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Keränen, Ville [Rudolf Peierls Centre for Theoretical Physics, University of Oxford,1 Keble Road, Oxford OX1 3NP (United Kingdom); Kleinert, Philipp [Rudolf Peierls Centre for Theoretical Physics, University of Oxford,1 Keble Road, Oxford OX1 3NP (United Kingdom); Merton College, University of Oxford,Merton Street, Oxford OX1 4JD (United Kingdom)

2015-04-22

In the first part of the paper, we discuss different versions of the AdS/CFT dictionary out of equilibrium. We show that the Skenderis-van Rees prescription and the “extrapolate” dictionary are equivalent at the level of “in-in” two point functions of free scalar fields in arbitrary asymptotically AdS spacetimes. In the second part of the paper, we calculate two point correlation functions in dynamical spacetimes using the “extrapolate” dictionary. These calculations are performed for conformally coupled scalar fields in examples of spacetimes undergoing gravitational collapse, the AdS{sub 2}-Vaidya spacetime and the AdS{sub 3}-Vaidya spacetime, which allow us to address the problem of thermalization following a quench in the boundary field theory. The computation of the correlators is formulated as an initial value problem in the bulk spacetime. Finally, we compare our results for AdS{sub 3}-Vaidya to results in the previous literature obtained using the geodesic approximation and we find qualitative agreement.

T\\overline{T} -deformations, AdS/CFT and correlation functions

Science.gov (United States)

Giribet, Gaston

2018-02-01

A solvable irrelevant deformation of AdS3/CFT2 correspondence leading to a theory with Hagedorn spectrum at high energy has been recently proposed. It consists of a single trace deformation of the boundary theory, which is inspired by the recent work on solvable T\\overline{T} deformations of two-dimensional CFTs. Thought of as a worldsheet σ-model, the interpretation of the deformed theory from the bulk viewpoint is that of string theory on a background that interpolates between AdS3 in the IR and a linear dilaton vacuum of little string theory in the UV. The insertion of the operator that realizes the deformation in the correlation functions produces a logarithmic divergence, leading to the renormalization of the primary operators, which thus acquire an anomalous dimension. We compute this anomalous dimension explicitly, and this provides us with a direct way of determining the spectrum of the theory. We discuss this and other features of the correlation functions in presence of the deformation.

Non-equilibrium scalar two point functions in AdS/CFT

International Nuclear Information System (INIS)

Keränen, Ville; Kleinert, Philipp

2015-01-01

In the first part of the paper, we discuss different versions of the AdS/CFT dictionary out of equilibrium. We show that the Skenderis-van Rees prescription and the “extrapolate” dictionary are equivalent at the level of “in-in” two point functions of free scalar fields in arbitrary asymptotically AdS spacetimes. In the second part of the paper, we calculate two point correlation functions in dynamical spacetimes using the “extrapolate” dictionary. These calculations are performed for conformally coupled scalar fields in examples of spacetimes undergoing gravitational collapse, the AdS 2 -Vaidya spacetime and the AdS 3 -Vaidya spacetime, which allow us to address the problem of thermalization following a quench in the boundary field theory. The computation of the correlators is formulated as an initial value problem in the bulk spacetime. Finally, we compare our results for AdS 3 -Vaidya to results in the previous literature obtained using the geodesic approximation and we find qualitative agreement.

Giant magnons and spiky strings in the Schrödinger/dipole-deformed CFT correspondence

Science.gov (United States)

Georgiou, George; Zoakos, Dimitrios

2018-02-01

We construct semi-classical string solutions of the Schrödinger Sch 5 × S 5 spacetime, which is conjectured to be the gravity dual of a non-local dipole-deformed CFT. They are the counterparts of the giant magnon and spiky string solutions of the undeformed AdS 5 × S 5 to which they flow when the deformation parameter is turned off. They live in an S 3 subspace of the five-sphere along the directions of which the B-field has non-zero components, having also extent in the Sch 5 part of the metric. Finally, we speculate on the form of the dual field theory operators.

Closed String Tachyons, AdS/CFT, and QCD

International Nuclear Information System (INIS)

Silverstein, Eva M

2001-01-01

We find that tachyonic orbifold examples of AdS/CFT have corresponding instabilities at small radius, and can decay to more generic gauge theories. We do this by computing a destabilizing Coleman-Weinberg effective potential for twisted operators of the corresponding quiver gauge theories, generalizing calculations of Tseytlin and Zarembo and interpreting them in terms of the large-N behavior of twisted-sector modes. The dynamically generated potential involves double-trace operators, which affect large-N correlators involving twisted fields but not those involving only untwisted fields, in line with large-N inheritance arguments. We point out a simple reason that no such small radius instability exists in gauge theories arising from freely acting orbifolds, which are tachyon-free at large radius. When an instability is present, twisted gauge theory operators with the quantum numbers of the large-radius tachyons acquire VEVs, leaving a gauge theory with fewer degrees of freedom in the infrared, analogous to but less extreme than ''decays to nothing'' studied in other systems with broken supersymmetry. In some cases one is left with pure glue QCD plus decoupled matter and U(1) factors in the IR, which we thus conjecture is described by the corresponding (possibly strongly coupled) endpoint of tachyon condensation in the M/String-theory dual

Integrability and the AdS/CFT correspondence

International Nuclear Information System (INIS)

Serban, Didina

2011-01-01

The description of gauge theories at strong coupling is one of the long-standing problems in theoretical physics. The idea of a relation between strongly coupled gauge theories and string theory was pioneered by 't Hooft, Wilson and Polyakov. A decade ago, Maldacena made this relation explicit by conjecturing the exact equivalence of a conformally invariant theory in four dimensions, the maximally supersymmetric Yang-Mills theory, with string theory in the AdS 5 x S 5 background. Other examples of correspondence between a conformally invariant theory and string theory in an AdS background were discovered recently. The comparison of the two sides of the correspondence requires the use of non-perturbative methods. The discovery of integrable structures in gauge theory and string theory led to the conjecture that the two theories are integrable for any value of the coupling constant and that they share the same integrable structure defined non-perturbatively. The last 8 years brought remarkable progress in identifying this solvable model and in explicitly solving the problem of computing the spectrum of conformal dimensions of the theory. The progress came from the identification of the dilatation operator with an integrable spin chain and from the study of the string sigma model. In this review, I present the evolution of the concept of integrability in the framework of the AdS/CFT correspondence and the main results obtained using this approach. (review)

Influence of scanning time window on the binding potentials of dopamine transporter in the brain of healthy volunteers with 11C-CFT PET imaging

International Nuclear Information System (INIS)

Qiu Chun; Zuo Chuantao; Zhang Zhengwei; Wu Ping; Zhang Huiwei; Guan Yihui

2013-01-01

Objective: To find the optimal scanning time window and then set up the normal binding potentials (BPs) of 2β-carbomethoxy-3β-(4-fluorophenyl)-(N- 11 C-methyl) tropane ( 11 C-CFT) DAT PET/CT imaging. Methods: Thirty-one healthy volunteers (20 males, 11 females, average age: (55.7±2.3) years), who all gave written informed consent, were divided into three age and gender-matched groups according to block randomization. Each group underwent static PET/CT scan in different time windows from 40-60 min, 60-80 min to 80-100 min after 11 C-CFT injection. To determine the best scanning time window, the ratios of caudate and putamen of all volunteers were analyzed using automatic ROI method (caudate (putamen)/parieto-occipital cotex-1) and compared by one-way analysis of variance and the least significant difference (LSD) t test. The ratio of the same area between different age-groups and gender-groups was compared with independent two-sample t test. Results: Ratios of left caudate (2.08±0.06, 1.75±0.07 and 1.77±0.12 respectively), right anterior putamen (2.33±0.06, 1.95±0.09 and 2.08±0.12 respectively) and bilateral posterior putamen (left: 1.88±0.66, 1.55±0.88 and 1.72±0.09; right: 1.98±0.07, 1.61±0.09 and 1.69±0.12) were all different in three time windows (F=3.588, 3.345, 4.479, 3.557, all P<0.05). There were significant differences in ratios of left caudate, right anterior and bilateral posterior putamen between 40-60 min and the 60-80 min (all P<0.05), as well as the ratios of left caudate between 40-60 min and the 80-100 min group (P<0.05). While no valid differences in ratios of those areas were shown between the groups of 60-80 min and 80-100 min scanning time window (all P>0.05). DAT densities in right and left side of caudate, anterior and posterior putamen were significantly lower in the group over 60 years of age than those under 60 years (t=-3.260, -3.090, -3.270, -3.190, -2.270, -3.110, all P<0.05), but were not different between gender

Lipopolysaccharide determination by reversed-phase high-performance liquid chromatography after fluorescence labeling

DEFF Research Database (Denmark)

Parlesak, Alexandr; Bode, C.

1995-01-01

-anthroyl and 2 pg for the fluorenoyl and 4-(1-pyrenyl)butyroyl ester per sample (signal-to-noise ratio of 3). The detection limits of lipopolysaccharide from a smooth strain (Escherichia coli 0111:B4) was 20 pg, while that from two rough strains (E. coli Nissle 1917 and Salmonella typhimurium SL 1181...

Boundary conditions and dualities: vector fields in AdS/CFT

International Nuclear Information System (INIS)

Marolf, Donald; Ross, Simo F.

2006-01-01

In AdS, scalar fields with masses slightly above the Breitenlohner-Freedman bound admit a variety of possible boundary conditions which are reflected in the Lagrangian of the dual field theory. Generic small changes in the AdS boundary conditions correspond to deformations of the dual field theory by multi-trace operators. Here we extend this discussion to the case of vector gauge fields in the bulk spacetime using the results of Ishibashi and Wald [hep-th/0402184]. As in the context of scalar fields, general boundary conditions for vector fields involve multi-trace deformations which lead to renormalization-group flows. Such flows originate in ultra-violet CFTs which give new gauge/gravity dualities. At least for AdS 4 /CFT 3 , the dual of the bulk photon appears to be a propagating gauge field instead of the usual R-charge current. Applying similar reasoning to tensor fields suggests the existence of a duality between string theory on AdS 4 and a quantum gravity theory in three dimensions

Holographic two-point functions for Janus interfaces in the D1/D5 CFT

Energy Technology Data Exchange (ETDEWEB)

Chiodaroli, Marco [Department of Physics and Astronomy, Uppsala University, SE-75108 Uppsala (Sweden); Estes, John [Department of Physics, Long Island University,1 University Plaza, Brooklyn, NY 11201 (United States); Korovin, Yegor [Max-Planck-Institut für Gravitationsphysik, Albert-Einstein-Institut, Am Mühlenberg 1, 14476 Golm (Germany)

2017-04-26

This paper investigates scalar perturbations in the top-down supersymmetric Janus solutions dual to conformal interfaces in the D1/D5 CFT, finding analytic closed-form solutions. We obtain an explicit representation of the bulk-to-bulk propagator and extract the two-point correlation function of the dual operator with itself, whose form is not fixed by symmetry alone. We give an expression involving the sum of conformal blocks associated with the bulk-defect operator product expansion and briefly discuss finite-temperature extensions. To our knowledge, this is the first computation of a two-point function which is not completely determined by symmetry for a fully-backreacted, top-down holographic defect.

BPS/CFT Correspondence III: Gauge Origami Partition Function and qq-Characters

Science.gov (United States)

Nekrasov, Nikita

2018-03-01

We study generalized gauge theories engineered by taking the low energy limit of the Dp branes wrapping {X × {T}^{p-3}}, with X a possibly singular surface in a Calabi-Yau fourfold Z. For toric Z and X the partition function can be computed by localization, making it a statistical mechanical model, called the gauge origami. The random variables are the ensembles of Young diagrams. The building block of the gauge origami is associated with a tetrahedron, whose edges are colored by vector spaces. We show the properly normalized partition function is an entire function of the Coulomb moduli, for generic values of the {Ω} -background parameters. The orbifold version of the theory defines the qq-character operators, with and without the surface defects. The analytic properties are the consequence of a relative compactness of the moduli spaces M({ěc n}, k) of crossed and spiked instantons, demonstrated in "BPS/CFT correspondence II: instantons at crossroads, moduli and compactness theorem".

Closed String Tachyons, AdS/CFT, and QCD

Energy Technology Data Exchange (ETDEWEB)

Silverstein, Eva M

2001-07-25

We find that tachyonic orbifold examples of AdS/CFT have corresponding instabilities at small radius, and can decay to more generic gauge theories. We do this by computing a destabilizing Coleman-Weinberg effective potential for twisted operators of the corresponding quiver gauge theories, generalizing calculations of Tseytlin and Zarembo and interpreting them in terms of the large-N behavior of twisted-sector modes. The dynamically generated potential involves double-trace operators, which affect large-N correlators involving twisted fields but not those involving only untwisted fields, in line with large-N inheritance arguments. We point out a simple reason that no such small radius instability exists in gauge theories arising from freely acting orbifolds, which are tachyon-free at large radius. When an instability is present, twisted gauge theory operators with the quantum numbers of the large-radius tachyons acquire VEVs, leaving a gauge theory with fewer degrees of freedom in the infrared, analogous to but less extreme than ''decays to nothing'' studied in other systems with broken supersymmetry. In some cases one is left with pure glue QCD plus decoupled matter and U(1) factors in the IR, which we thus conjecture is described by the corresponding (possibly strongly coupled) endpoint of tachyon condensation in the M/String-theory dual.

F9 fimbriae of uropathogenic Escherichia coli are expressed at low temperature and recognise Galβ1-3GlcNAc-containing glycans.

Directory of Open Access Journals (Sweden)

Daniël J Wurpel

Full Text Available Uropathogenic Escherichia coli (UPEC is the leading causative agent of urinary tract infections (UTI in the developed world. Among the major virulence factors of UPEC, surface expressed adhesins mediate attachment and tissue tropism. UPEC strains typically possess a range of adhesins, with type 1 fimbriae and P fimbriae of the chaperone-usher class the best characterised. We previously identified and characterised F9 as a new chaperone-usher fimbrial type that mediates biofilm formation. However, the regulation and specific role of F9 fimbriae remained to be determined in the context of wild-type clinical UPEC strains. In this study we have assessed the distribution and genetic context of the f9 operon among diverse E. coli lineages and pathotypes and demonstrated that f9 genes are significantly more conserved in a UPEC strain collection in comparison to the well-defined E. coli reference (ECOR collection. In the prototypic UPEC strain CFT073, the global regulator protein H-NS was identified as a transcriptional repressor of f9 gene expression at 37°C through its ability to bind directly to the f9 promoter region. F9 fimbriae expression was demonstrated at 20°C, representing the first evidence of functional F9 fimbriae expression by wild-type E. coli. Finally, glycan array analysis demonstrated that F9 fimbriae recognise and bind to terminal Galβ1-3GlcNAc structures.

A multi-level capacitor-less memory cell fabricated on a nano-scale strained silicon-on-insulator

International Nuclear Information System (INIS)

Park, Jea-Gun; Kim, Seong-Je; Shin, Mi-Hee; Song, Seung-Hyun; Shim, Tae-Hun; Chung, Sung-Woong; Enomoto, Hirofumi

2011-01-01

A multi-level capacitor-less memory cell was fabricated with a fully depleted n-metal-oxide-semiconductor field-effect transistor on a nano-scale strained silicon channel on insulator (FD sSOI n-MOSFET). The 0.73% biaxial tensile strain in the silicon channel of the FD sSOI n-MOSFET enhanced the effective electron mobility to ∼ 1.7 times that with an unstrained silicon channel. This thereby enables both front- and back-gate cell operations, demonstrating eight-level volatile memory-cell operation with a 1 ms retention time and 12 μA memory margin. This is a step toward achieving a terabit volatile memory cell.

ORF Alignment: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available regulator of genes in aerobic pathways (sensors, ... ArcB and CpxA) [Shigella flexneri 2a str. 301] ... ... gb|AAN45846.2| negative response regulator of genes in ... aerobic pathways (sensors, ArcB...esponse ... regulator of genes in aerobic pathways (sensors, ArcB ... and CpxA) [Shigella flex...chia coli CFT073] gb|AAP19620.1| negative ... response regulator of genes in aerobic pathways... ... negative response regulator of genes in aerobic ... pathways, (senso

ORF Alignment: NC_003198 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available regulator of genes in aerobic pathways (sensors, ... ArcB and CpxA) [Shigella flexneri 2a str. 301] ... ... gb|AAN45846.2| negative response regulator of genes in ... aerobic pathways (sensors, ArcB...esponse ... regulator of genes in aerobic pathways (sensors, ArcB ... and CpxA) [Shigella flex...chia coli CFT073] gb|AAP19620.1| negative ... response regulator of genes in aerobic pathways... ... negative response regulator of genes in aerobic ... pathways, (senso

The Brain of the Archerfish Toxotes chatareus: A Nissl-Based Neuroanatomical Atlas and Catecholaminergic/Cholinergic Systems

Science.gov (United States)

Karoubi, Naomi; Segev, Ronen; Wullimann, Mario F.

2016-01-01

Over recent years, the seven-spot archerfish (Toxotes chatareus) has emerged as a new model for studies in visual and behavioral neuroscience thanks to its unique hunting strategy. Its natural ability to spit at insects outside of water can be used in the laboratory for well controlled behavioral experiments where the fish is trained to aim at targets on a screen. The need for a documentation of the neuroanatomy of this animal became critical as more research groups use it as a model. Here we present an atlas of adult T. chatareus specimens caught in the wild in South East Asia. The atlas shows representative sections of the brain and specific structures revealed by a classic Nissl staining as well as corresponding schematic drawings. Additional immunostainings for catecholaminergic and cholinergic systems were conducted to corroborate the identification of certain nuclei and the data of a whole brain scanner is available online. We describe the general features of the archerfish brain as well as its specificities, especially for the visual system and compare the neuroanatomy of the archerfish with other teleosts. This atlas of the archerfish brain shows all levels of the neuraxis and intends to provide a solid basis for further neuroscientific research on T. chatareus, in particular electrophysiological studies. PMID:27891081

Use of Attenuated but Metabolically Competent Salmonella as a Probiotic To Prevent or Treat Salmonella Infection

Science.gov (United States)

Sabag-Daigle, Anice; Blunk, Henry M.; Gonzalez, Juan F.; Steidley, Brandi L.; Boyaka, Prosper N.

2016-01-01

Salmonella enterica is among the most burdensome of foodborne disease agents. There are over 2,600 serovars that cause a range of disease manifestations ranging from enterocolitis to typhoid fever. While there are two vaccines in use in humans to protect against typhoid fever, there are none that prevent enterocolitis. If vaccines preventing enterocolitis were to be developed, they would likely protect against only one or a few serovars. In this report, we tested the hypothesis that probiotic organisms could compete for the preferred nutrient sources of Salmonella and thus prevent or treat infection. To this end, we added the fra locus, which encodes a utilization pathway for the Salmonella-specific nutrient source fructose-asparagine (F-Asn), to the probiotic bacterium Escherichia coli Nissle 1917 (Nissle) to increase its ability to compete with Salmonella in mouse models. We also tested a metabolically competent, but avirulent, Salmonella enterica serovar Typhimurium mutant for its ability to compete with wild-type Salmonella. The modified Nissle strain became more virulent and less able to protect against Salmonella in some instances. On the other hand, the modified Salmonella strain was safe and effective in preventing infection with wild-type Salmonella. While we tested for efficacy only against Salmonella Typhimurium, the modified Salmonella strain may be able to compete metabolically with most, if not all, Salmonella serovars, representing a novel approach to control of this pathogen. PMID:27185789

Origin of inflation in CFT driven cosmology. R2-gravity and non-minimally coupled inflaton models

International Nuclear Information System (INIS)

Barvinsky, A.O.; Kamenshchik, A.Yu.; Nesterov, D.V.

2015-01-01

We present a detailed derivation of the recently suggested new type of hill-top inflation [arXiv:1509.07270] originating from the microcanonical density matrix initial conditions in cosmology driven by conformal field theory (CFT). The cosmological instantons of topology S 1 x S 3 , which set up these initial conditions, have the shape of a garland with multiple periodic oscillations of the scale factor of the spatial S 3 -section. They describe underbarrier oscillations of the inflaton and scale factor in the vicinity of the inflaton potential maximum, which gives a sufficient amount of inflation required by the known CMB data. We build the approximation of two coupled harmonic oscillators for these garland instantons and show that they can generate inflation consistent with the parameters of the CMB primordial power spectrum in the non-minimal Higgs inflation model and in R 2 gravity. In particular, the instanton solutions provide smallness of inflationary slow-roll parameters ε and η < 0 and their relation ε ∝ η 2 characteristic of these two models. We present the mechanism of formation of hill-like inflaton potentials, which is based on logarithmic loop corrections to the asymptotically shift-invariant tree-level potentials of these models in the Einstein frame. We also discuss the role of R 2 -gravity as an indispensable finite renormalization tool in the CFT driven cosmology, which guarantees the nondynamical (ghost free) nature of its scale factor and special properties of its cosmological garland-type instantons. Finally, as a solution to the problem of hierarchy between the Planckian scale and the inflation scale we discuss the concept of a hidden sector of conformal higher spin fields. (orig.)

Defects in higher-dimensional quantum field theory. Relations to AdS/CFT-correspondence and Kondo lattices

Energy Technology Data Exchange (ETDEWEB)

Schmidt, R.

2007-03-15

The present work is addressed to defects and boundaries in quantum field theory considering the application to AdS/CFT correspondence. We examine interactions of fermions with spins localised on these boundaries. Therefore, an algebra method is emphasised adding reflection and transmission terms to the canonical quantisation prescription. This method has already been applied to bosons in two space-time dimensions before. We show the possibilities of such reflection-transmission algebras in two, three, and four dimensions. We compare with models of solid state physics as well as with the conformal field theory approach to the Kondo effect. Furthermore, we discuss ansatzes of extensions to lattice structures. (orig.)

Thermality and excited state Rényi entropy in two-dimensional CFT

Energy Technology Data Exchange (ETDEWEB)

Lin, Feng-Li [Department of Physics, National Taiwan Normal University,Taipei 11677, Taiwan (China); Wang, Huajia [Department of Physics, University of Illinois,Urbana-Champaign, IL 61801 (United States); Zhang, Jia-ju [Dipartimento di Fisica, Università degli Studi di Milano-Bicocca,Piazza della Scienza 3, I-20126 Milano (Italy); Theoretical Physics Division, Institute of High Energy Physics, Chinese Academy of Sciences,19B Yuquan Rd, Beijing 100049 (China); Theoretical Physics Center for Science Facilities, Chinese Academy of Sciences,19B Yuquan Rd, Beijing 100049 (China)

2016-11-21

We evaluate one-interval Rényi entropy and entanglement entropy for the excited states of two-dimensional conformal field theory (CFT) on a cylinder, and examine their differences from the ones for the thermal state. We assume the interval to be short so that we can use operator product expansion (OPE) of twist operators to calculate Rényi entropy in terms of sum of one-point functions of OPE blocks. We find that the entanglement entropy for highly excited state and thermal state behave the same way after appropriate identification of the conformal weight of the state with the temperature. However, there exists no such universal identification for the Rényi entropy in the short-interval expansion. Therefore, the highly excited state does not look thermal when comparing its Rényi entropy to the thermal state one. As the Rényi entropy captures the higher moments of the reduced density matrix but the entanglement entropy only the average, our results imply that the emergence of thermality depends on how refined we look into the entanglement structure of the underlying pure excited state.

State Operator Correspondence and Entanglement in AdS2/CFT1

Directory of Open Access Journals (Sweden)

Ashoke Sen

2011-07-01

Full Text Available Since Euclidean global AdS2 space represented as a strip has two boundaries, the state-operator correspondence in the dual CFT1 reduces to the standard map from the operators acting on a single copy of the Hilbert space to states in the tensor product of two copies of the Hilbert space. Using this picture we argue that the corresponding states in the dual string theory living on AdS2 × K are described by the twisted version of the Hartle–Hawking states, the twists being generated by a large unitary group of symmetries that this string theory must possess. This formalism makes natural the dual interpretation of the black hole entropy—as the logarithm of the degeneracy of ground states of the quantum mechanics describing the low energy dynamics of the black hole, and also as an entanglement entropy between the two copies of the same quantum theory living on the two boundaries of global AdS2 separated by the event horizon.

Pressure and Compressibility of Conformal Field Theories from the AdS/CFT Correspondence

Directory of Open Access Journals (Sweden)

Brian P. Dolan

2016-05-01

Full Text Available The equation of state associated with N = 4 supersymmetric Yang–Mills in four dimensions, for S U ( N in the large N limit, is investigated using the AdS/CFT correspondence. An asymptotically AdS black-hole on the gravity side provides a thermal background for the Yang–Mills theory on the boundary in which the cosmological constant is equivalent to a volume. The thermodynamic variable conjugate to the cosmological constant is a pressure, and the P - V diagram of the quark-gluon plasma is studied. It is known that there is a critical point where the heat capacity diverges, and this is reflected in the isothermal compressibility. Critical exponents are derived and found to be mean field in the large N limit. The same analysis applied to three- and six-dimensional conformal field theories again yields mean field exponents associated with the compressibility at the critical point.

Amelioration of cadmium- and mercury-induced liver and kidney damage in rats by genetically engineered probiotic Escherichia coli Nissle 1917 producing pyrroloquinoline quinone with oral supplementation of citric acid.

Science.gov (United States)

Raghuvanshi, Ruma; Chaudhari, Archana; Kumar, G Naresh

2016-01-01

Antioxidants, chelating agents, and probiotics are used to manage the toxic effects of cadmium (Cd) and mercury (Hg). The aim of this study was to investigate the combined effects of antioxidants, chelating agents, and probiotics against heavy metal toxicity. Genetically modified probiotic Escherichia coli Nissle 1917 (EcN-20) producing a potent water soluble antioxidant pyrroloquinoline quinone (PQQ) was supplemented with oral citric acid and compared with another genetically modified probiotic EcN-21 producing PQQ and citric acid against oxidative stress induced by Cd and Hg. Rats were independently given 100 ppm Cd and 80 ppm Hg in drinking water for 4 wk. EcN-20 was found to be more effective than EcN-2 (EcN strain with genomic integration of vgb and gfp genes) with orally given PQQ against oxidative stress induced by Cd and Hg. EcN-20 supplemented with oral citric acid was more effective against Cd and Hg toxicity compared with EcN-2+citric acid (oral), EcN-2+PQQ (oral), EcN-2+PQQ (oral)+citric acid (oral), EcN-20, and EcN-21. However, protection shown by EcN-21 was similar to EcN-20. The combination therapy involving probiotic EcN-20 producing PQQ with citric acid given orally was found to be a moderately effective strategy against toxicity induced by Cd and Hg, whereas the protective effect of EcN-21 was the same as EcN-20. Copyright © 2016 Elsevier Inc. All rights reserved.

Origin of inflation in CFT driven cosmology: R{sup 2}-gravity and non-minimally coupled inflaton models

Energy Technology Data Exchange (ETDEWEB)

Barvinsky, A. O., E-mail: barvin@td.lpi.ru [Theory Department, Lebedev Physics Institute, Leninsky Prospect 53, 119991, Moscow (Russian Federation); Department of Physics, Tomsk State University, Lenin Ave. 36, 634050, Tomsk (Russian Federation); Department of Physics and Astronomy, Pacific Institute for Theoretical Physics, UBC, 6224 Agricultural Road, V6T1Z1, Vancouver, BC (Canada); Kamenshchik, A. Yu., E-mail: kamenshchik@bo.infn.it [Dipartimento di Fisica e Astronomia, Università di Bologna and INFN, Via Irnerio 46, 40126, Bologna (Italy); L. D. Landau Institute for Theoretical Physics, 119334, Moscow (Russian Federation); Nesterov, D. V., E-mail: nesterov@td.lpi.it [Theory Department, Lebedev Physics Institute, Leninsky Prospect 53, 119991, Moscow (Russian Federation)

2015-12-11

We present a detailed derivation of the recently suggested new type of hill-top inflation originating from the microcanonical density matrix initial conditions in cosmology driven by conformal field theory (CFT). The cosmological instantons of topology S{sup 1}×S{sup 3}, which set up these initial conditions, have the shape of a garland with multiple periodic oscillations of the scale factor of the spatial S{sup 3}-section. They describe underbarrier oscillations of the inflaton and scale factor in the vicinity of the inflaton potential maximum, which gives a sufficient amount of inflation required by the known CMB data. We build the approximation of two coupled harmonic oscillators for these garland instantons and show that they can generate inflation consistent with the parameters of the CMB primordial power spectrum in the non-minimal Higgs inflation model and in R{sup 2} gravity. In particular, the instanton solutions provide smallness of inflationary slow-roll parameters ϵ and η<0 and their relation ϵ∼η{sup 2} characteristic of these two models. We present the mechanism of formation of hill-like inflaton potentials, which is based on logarithmic loop corrections to the asymptotically shift-invariant tree-level potentials of these models in the Einstein frame. We also discuss the role of R{sup 2}-gravity as an indispensable finite renormalization tool in the CFT driven cosmology, which guarantees the non-dynamical (ghost free) nature of its scale factor and special properties of its cosmological garland-type instantons. Finally, as a solution to the problem of hierarchy between the Planckian scale and the inflation scale we discuss the concept of a hidden sector of conformal higher spin fields.

ADHM and D-instantons in orbifold AdS/CFT duality

International Nuclear Information System (INIS)

Hollowood, Timothy J.; Khoze, Valentin V.

2000-01-01

We consider ADHM instantons in product group gauge theories that arise from D3-branes located at points in the orbifold R 6 /Z p . At finite N we argue that the ADHM construction and collective coordinate integration measure can be deduced from the dynamics of D-instantons in the D3-brane background. For the large-N conformal field theories of this type, we compute a saddle-point approximation of the ADHM integration measure and show that it is proportional to the partition function of D-instantons in the dual AdS 5 xS 5 /Z p background, in agreement with the orbifold AdS/CFT correspondence. Matching the expected behaviour of D-instantons, we find that when S 5 /Z p is smooth a saddle-point solution only exists in the sector where the instanton charges in each gauge group factor are the same. However, when S 5 /Z p is singular, the instanton charges at large N need not be the same and the space of saddle-point solutions has a number of distinct branches which represent the possible fractionations of D-instantons at the singularity. For the theories with a type 0B dual the saddle-point solutions manifest two types of D-instantons

Toluidine blue-O is a Nissl bright-field counterstain for lipophilic fluorescent tracers Di-ASP, DiI and DiO.

Science.gov (United States)

Chelvanayagam, D K; Beazley, L D

1997-03-01

The stain toluidine blue-O (tol blue), applied to sections of neural tissue, is shown to be compatible with the vivid fluorescent lipophilic neural tracers 4-(4-dihexadecylaminostyryl)-N-methylpyridinium iodide (Di-ASP), 3,3'-dioctadecyloxacarbocyanine perchlorate (DiO) and 1,1'-dioctadecyl-3,3,3',3'-tetramethylindocarbocyanine perchlorate (DiI). As with other Nissl stains, toluidine blue-O fluoresces in the red end of the spectrum but such fluorescence quenches upon binding with tissue. Moreover, progressive staining occurs at concentrations low enough to minimise any background fluorescence attributable to non-specific residence of the stain. The bright yellow Di-ASP and vivid green DiO signals are spectrally removed from the red fluorescence of toluidine blue-O. With toluidine blue-O counterstaining, Di-ASP generally offers contrast superior to that with DiI, however, the latter is improved by viewing in a polarised green bright field. Visible Di-ASP emission, although broad, peaks at a more film-sensitive region of the spectrum than that for DiI, thus reducing the photographic exposure required.

On information loss in AdS{sub 3}/CFT{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Fitzpatrick, A. Liam [Department of Physics, Boston University,Commonwealth Avenue, Boston, MA 02215 (United States); Kaplan, Jared; Li, Daliang; Wang, Junpu [Department of Physics and Astronomy, Johns Hopkins University, Charles Street, Baltimore, MD 21218 (United States)

2016-05-18

We discuss information loss from black hole physics in AdS{sub 3}, focusing on two sharp signatures infecting CFT{sub 2} correlators at large central charge c: ‘forbidden singularities’ arising from Euclidean-time periodicity due to the effective Hawking temperature, and late-time exponential decay in the Lorentzian region. We study an infinite class of examples where forbidden singularities can be resolved by non-perturbative effects at finite c, and we show that the resolution has certain universal features that also apply in the general case. Analytically continuing to the Lorentzian regime, we find that the non-perturbative effects that resolve forbidden singularities qualitatively change the behavior of correlators at times t∼S{sub BH}, the black hole entropy. This may resolve the exponential decay of correlators at late times in black hole backgrounds. By Borel resumming the 1/c expansion of exact examples, we explicitly identify ‘information-restoring’ effects from heavy states that should correspond to classical solutions in AdS{sub 3}. Our results suggest a line of inquiry towards a more precise formulation of the gravitational path integral in AdS{sub 3}.

Thermodynamic properties of Kehagias-Sfetsos black hole and KS/CFT correspondence

Science.gov (United States)

Pradhan, Parthapratim

2017-11-01

We speculate on various thermodynamic features of the inner horizon ({\\mathcal H}-) and outer horizons ({\\mathcal H}+) of Kehagias-Sfetsos (KS) black hole (BH) in the background of the Hořava-Lifshitz gravity. We compute particularly the area product, area sum, area minus and area division of the BH horizons. We find that they all are not showing universal behavior whereas the product is a universal quantity (PRADHAN P., Phys. Lett. B, 747 (2015) 64). Based on these relations, we derive the area bound of all horizons. From the area bound we derive the entropy bound and irreducible mass bound for all the horizons ({\\mathcal H}+/-) . We also observe that the first law of BH thermodynamics and Smarr-Gibbs-Duhem relations do not hold for this BH. The underlying reason behind this failure is due to the scale invariance of the coupling constant. Moreover, we compute the Cosmic-Censorship-Inequality for this BH which gives the lower bound for the total mass of the spacetime and it is supported by the cosmic cencorship conjecture. Finally, we discuss the KS/CFT correspondence via a thermodynamic procedure.

ORF Alignment: NC_004337 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004337 gi|24113675 >1nbuA 1 118 5 120 2e-19 ... ref|NP_708185.1| D-erythro-7,8-dihydrone...opterin triphosphate epimerase [Shigella ... flexneri 2a str. 301] gb|AAN43892.1| ... D-erythro-7,8-dihydrone....1| ... D-erythro-7,8-dihydroneopterin triphosphate epimerase ... [...Shigella flexneri 2a str. 2457T] ref|NP_754732.1| ... D-erythro-7,8-dihydroneopterin triphosphate epi...merase ... [Escherichia coli CFT073] gb|AAP17710.1| ... D-erythro-7,8-dihydroneopterin triphos

ORF Alignment: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15802850 >1nbuA 1 118 5 120 2e-19 ... ref|NP_708185.1| D-erythro-7,8-dihydrone...opterin triphosphate epimerase [Shigella ... flexneri 2a str. 301] gb|AAN43892.1| ... D-erythro-7,8-dihydrone....1| ... D-erythro-7,8-dihydroneopterin triphosphate epimerase ... [...Shigella flexneri 2a str. 2457T] ref|NP_754732.1| ... D-erythro-7,8-dihydroneopterin triphosphate epi...merase ... [Escherichia coli CFT073] gb|AAP17710.1| ... D-erythro-7,8-dihydroneopterin triphos

ORF Alignment: NC_004431 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004431 gi|26248692 >1nbuA 1 118 5 120 2e-19 ... ref|NP_708185.1| D-erythro-7,8-dihydrone...opterin triphosphate epimerase [Shigella ... flexneri 2a str. 301] gb|AAN43892.1| ... D-erythro-7,8-dihydrone....1| ... D-erythro-7,8-dihydroneopterin triphosphate epimerase ... [...Shigella flexneri 2a str. 2457T] ref|NP_754732.1| ... D-erythro-7,8-dihydroneopterin triphosphate epi...merase ... [Escherichia coli CFT073] gb|AAP17710.1| ... D-erythro-7,8-dihydroneopterin triphos

ORF Alignment: NC_004741 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004741 gi|30063729 >1nbuA 1 118 5 120 2e-19 ... ref|NP_708185.1| D-erythro-7,8-dihydrone...opterin triphosphate epimerase [Shigella ... flexneri 2a str. 301] gb|AAN43892.1| ... D-erythro-7,8-dihydrone....1| ... D-erythro-7,8-dihydroneopterin triphosphate epimerase ... [...Shigella flexneri 2a str. 2457T] ref|NP_754732.1| ... D-erythro-7,8-dihydroneopterin triphosphate epi...merase ... [Escherichia coli CFT073] gb|AAP17710.1| ... D-erythro-7,8-dihydroneopterin triphos

Evaluation of nigrostriatal damage and its change over weeks in a rat model of Parkinson's disease: small animal positron emission tomography studies with [11C]β-CFT

International Nuclear Information System (INIS)

Liu Limin; Wang Yong; Li Bo; Jia Jun; Sun Zuoli; Zhang Jinming; Tian Jiahe; Wang Xiaomin

2009-01-01

Introduction: The cardinal pathological feature of Parkinson's disease (PD) is progressive loss of dopaminergic neurons. Since dopamine transporter (DAT) is a protein located presynaptically on dopaminergic nerve terminals, radioligands that bind to these sites are promising radiopharmaceuticals for evaluation of the integrity of the dopamine system. This study using positron emission tomography (PET) tracers, [ 11 C]-2β-carbomethoxy-3β-(4-fluorophenyl)-tropane ([ 11 C]β-CFT, radioligand for DAT), was aimed at evaluating the degree of nigrostriatal damage and its change over weeks in a rat model of PD. Methods: The brains of these rats were unilaterally lesioned by mechanical transection of the nigrostriatal dopamine pathway at the medial forebrain bundle (MFB). Behavioral studies were carried out by apomorphine (APO) challenge prior to and 1, 2 and 4 weeks after MFB axotomy. Small animal PET scans were performed 2 days after the behavioral test. Immunohistochemistry was conducted 4 days after the last PET scan. Results: Compared with the contralateral intact side, a progressively decreased [ 11 C]β-CFT binding was observed on the lesioned side which correlated inversely with the APO-induced rotations. Postmortem immunohistochemical studies confirmed the loss of both striatal dopamine fibers and nigral neurons on the lesioned side. Conclusion: These findings not only demonstrate that the neuronal degeneration in this model is relatively slow, but also suggest [ 11 C]β-CFT is a sensitive marker to monitor the degree of nigrostriatal damage and its change over weeks. This marker can be used prospectively to study the progression of the disease, thereby making detection of early phases of PD possible.

Genetic control of oromotor phenotypes: A survey of licking and ingestive behaviors in highly diverse strains of mice.

Science.gov (United States)

St John, Steven J; Lu, Lu; Williams, Robert W; Saputra, Jennifer; Boughter, John D

2017-08-01

In order to examine genetic influences on fluid ingestion, 20-min intake of either water or 0.1M sucrose was measured in a lickometer in 18 isogenic strains of mice, including 15 inbred strains and 3 F 1 hybrid crosses. Intake and licking data were examined at a number of levels, including lick rate as defined by mean or median interlick interval, as well as several microstructural parameters (i.e. burst-pause structure). In general, strain variation for ingestive phenotypes were correlated across water and sucrose in all strains, indicating fundamental, rather than stimulus-specific, mechanisms of intake. Strain variation was substantial and robust, with heritabilities for phenotypes ranging from 0.22 to 0.73. For mean interlick interval (MPI; a measure of lick rate) strains varied continuously from 94.3 to 127.0ms, a range consistent with previous studies. Furthermore, variation among strains for microstructural traits such as burst size and number suggested that strains possess different overall ingestive strategies, with some favoring more short bursts, and others favoring fewer, long bursts. Strains also varied in cumulative intake functions, exhibiting both linear and decelerated rates of intake across the session. Copyright © 2017 Elsevier Inc. All rights reserved.

Prosomeric map of the lamprey forebrain based on calretinin immunocytochemistry, Nissl stain, and ancillary markers.

Science.gov (United States)

Pombal, M A; Puelles, L

1999-11-22

The structural organization of the lamprey extratelencephalic forebrain is re-examined from the perspective of the prosomeric segmental paradigm. The question asked was whether the prosomeric forebrain model used for gnathostomes is of material advantage for interpreting subdivisions in the lamprey forebrain. To this aim, the main longitudinal and transverse landmarks recognized by the prosomeric model in other vertebrates were identified in Nissl-stained lamprey material. Lines of cytoarchitectural discontinuity and contours of migrated neuronal groups were mapped in a two-dimensional sagittal representation and were also classified according to their radial position. Immunocytochemical mapping of calretinin expression in adjacent sections served to define particular structural units better, in particular, the dorsal thalamus. These data were complemented by numerous other chemoarchitectonic observations obtained with ancillary markers, which identified additional specific formations, subdivisions, or boundaries. Emphasis was placed on studying whether such chemically defined neuronal groups showed boundaries aligned with the postulated inter- or intraprosomeric boundaries. The course of diverse axonal tracts was studied also with regard to their prosomeric topography. This analysis showed that the full prosomeric model applies straightforwardly to the lamprey forebrain. This finding implies that a common segmental and longitudinal organization of the neural tube may be primitive for all vertebrates. Interesting novel aspects appear in the interpretation of the lamprey pretectum, the dorsal and ventral thalami, and the hypothalamus. The topologic continuity of the prosomeric forebrain regions with evaginated or non-evaginated portions of the telencephalon was also examined. Copyright 1999 Wiley-Liss, Inc.

Non-Abelian T-duality and the AdS/CFT correspondence: New N=1 backgrounds

Energy Technology Data Exchange (ETDEWEB)

Itsios, Georgios, E-mail: gitsios@upatras.gr [Department of Engineering Sciences, University of Patras, 26110 Patras (Greece); Department of Mathematics, University of Surrey, Guildford GU2 7XH (United Kingdom); Núñez, Carlos, E-mail: c.nunez@swansea.ac.uk [Swansea University, School of Physical Sciences, Singleton Park, Swansea SA2 8PP (United Kingdom); Sfetsos, Konstadinos, E-mail: k.sfetsos@surrey.ac.uk [Department of Mathematics, University of Surrey, Guildford GU2 7XH (United Kingdom); Department of Engineering Sciences, University of Patras, 26110 Patras (Greece); Thompson, Daniel C., E-mail: dthompson@tena4.vub.ac.be [Theoretische Natuurkunde, Vrije Universiteit Brussel (Belgium); International Solvay Institutes, Pleinlaan 2, B-1050 Brussels (Belgium)

2013-08-01

We consider non-Abelian T-duality on N=1 supergravity backgrounds possessing well understood field theory duals. For the case of D3-branes at the tip of the conifold, we dualise along an SU(2) isometry. The result is a type-IIA geometry whose lift to M-theory is of the type recently proposed by Bah et al. as the dual to certain N=1 SCFT quivers produced by M5-branes wrapping a Riemann surface. In the non-conformal cases we find smooth duals in massive IIA supergravity with a Romans mass naturally quantised. We initiate the interpretation of these geometries in the context of AdS/CFT correspondence. We show that the central charge and the entanglement entropy are left invariant by this dualisation. The backgrounds suggest a form of Seiberg duality in the dual field theories which also exhibit domain walls and confinement in the infrared.

Extensive numerical study of a D-brane, anti-D-brane system in AdS5/CFT4

International Nuclear Information System (INIS)

Hegedűs, Árpád

2015-01-01

In this paper the hybrid-NLIE approach of http://dx.doi.org/10.1007/JHEP08(2012)022 is extended to the ground state of a D-brane anti-D-brane system in AdS/CFT. The hybrid-NLIE equations presented in the paper are finite component alternatives of the previously proposed TBA equations and they admit an appropriate framework for the numerical investigation of the ground state of the problem. Straightforward numerical iterative methods fail to converge, thus new numerical methods are worked out to solve the equations. Our numerical data confirm the previous TBA data. In view of the numerical results the mysterious L=1 case is also commented in the paper.

Perturbative and non-perturbative approaches to string sigma-models in AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Vescovi, Edoardo

2016-10-05

This thesis discusses quantum aspects of type II superstring theories in AdS{sub 5} x S{sup 5} and AdS{sub 4} x CP{sup 3} backgrounds relevant for the AdS/CFT correspondence, using perturbative methods at large string tension and lattice field theory techniques inspired by a work of Roiban and McKeown. We review the construction of the supercoset sigma-model for strings in the AdS{sub 5} x S{sup 5} background, whereas the general quantum dynamics of the superstring in AdS{sub 4} x CP{sup 3} is described by a double dimensional reduction of the supermembrane action in AdS{sub 4} x S{sup 7}. We present a manifestly covariant formalism for semiclassical quantization of strings around arbitrary minimal-area surfaces in AdS{sub 5} x S{sup 5}, expressing the fluctuation operators in terms of intrinsic and extrinsic invariants of the background geometry. We exactly solve the spectral problem for a fourth-order generalization of the Lame differential equation with doubly periodic coefficients in a complex variable. This calculates the one-loop energy of the (J{sub 1},J{sub 2})-string in the SU(2) sector in the limit described by a quantum Landau-Lifshitz model and the bosonic contribution to the energy of the (S,J)-string rotating in AdS{sub 5} and S{sup 5}. Similar techniques calculate the 1/4-BPS latitude Wilson loops in N=4 SYM theory at one loop, normalized to the 1/2-BPS circular loop. Our regularization scheme reproduces the next-to-leading order predicted by supersymmetric localization, up to a remainder function that we discuss upon. We also study the AdS{sub 4} x CP{sup 3} string action expanded around the null cusp background and compute the cusp anomaly up to two loops. This agrees with an all-loop conjectured expression of the ABJM interpolating function. We finally discretize the AdS{sub 5} x S{sup 5} superstring theory in the AdS light-cone gauge and perform lattice simulations at finite coupling with a Monte Carlo algorithm. We measure the string action

Scalar field theory in the AdS/CFT correspondence revisited

International Nuclear Information System (INIS)

Minces, Pablo; Rivelles, Victor O.

2000-01-01

We consider the role of boundary conditions in the AdS d+1 /CFT d correspondence for the scalar field theory. Also a careful analysis of some limiting cases is presented. We study three possible types of boundary conditions, Dirichlet, Neumann and mixed. We compute the two-point functions of the conformal operators on the boundary for each type of boundary condition. We show how particular choices of the mass require different treatments. In the Dirichlet case we find that there is no double zero in the two-point function of the operator with conformal dimension d/2. The Neumann case leads to new normalizations for the boundary two-point functions. In the massless case we show that the conformal dimension of the boundary conformal operator is precisely the unitarity bound for scalar operators. We find a one-parameter family of boundary conditions in the mixed case. There are again new normalizations for the boundary two-point functions. For a particular choice of the mixed boundary condition and with the mass squared in the range -d 2 /4 2 2 /4+1 the boundary operator has conformal dimension comprised in the interval [(d-2)/2, d/2]. For mass squared m 2 >-d 2 /4+1 the same choice of mixed boundary condition leads to a boundary operator whose conformal dimension is the unitarity bound

Antibacterial activity of peritoneal exudate in patients treated with 2 g cefotiam for surgical anti-microbial prophylaxis.

Science.gov (United States)

Miglioli, P A; Schoeffel, U; Gabroska, E; Allerberger, F

1998-01-01

The objective of this study was to investigate the presence of antibacterial activity in peritoneal exudate (PE) of patients treated with cefotiam (CFT). CFT (2 g) was administered as a 'single-shot' antimicrobial prophylaxis to 6 patients at the beginning of colorectal resection. Samples of PE were collected from each patient on days 1, 2 and 3 after surgery. CFT was detectable in the samples of day 1 for 5 of the 6 patients. The influence of PE on antibacterial activity of the antimicrobial drug was evaluated carrying out the MICs of CFT against Escherichia coli K-12, E. coli (ATCC 10798), Klebsiella pneumoniae (ATCC 1003), Proteus rettgeri (Sanelli) and Staphylococcus aureus (ATCC 29213) with and without the addition of PE. The presence of PE enhanced the antimicrobial activity of CFT against gram-negative strains, but not against S. aureus (ATCC 29213). These results suggest the presence of substances in PE that possess endogenous antibacterial activity. Thus, antimicrobial activity in PE cannot be predicted by evaluating pathogen sensitivity in vitro only.

Dissecting CFT Correlators and String Amplitudes. Conformal Blocks and On-Shell Recursion for General Tensor Fields

International Nuclear Information System (INIS)

Hansen, Tobias

2015-07-01

This thesis covers two main topics: the tensorial structure of quantum field theory correlators in general spacetime dimensions and a method for computing string theory scattering amplitudes directly in target space. In the first part tensor structures in generic bosonic CFT correlators and scattering amplitudes are studied. To this end arbitrary irreducible tensor representations of SO(d) (traceless mixed-symmetry tensors) are encoded in group invariant polynomials, by contracting with sets of commuting and anticommuting polarization vectors which implement the index symmetries of the tensors. The tensor structures appearing in CFT d correlators can then be inferred by studying these polynomials in a d + 2 dimensional embedding space. It is shown with an example how these correlators can be used to compute general conformal blocks describing the exchange of mixed-symmetry tensors in four-point functions, which are crucial for advancing the conformal bootstrap program to correlators of operators with spin. Bosonic string theory lends itself as an ideal example for applying the same methods to scattering amplitudes, due to its particle spectrum of arbitrary mixed-symmetry tensors. This allows in principle the definition of on-shell recursion relations for string theory amplitudes. A further chapter introduces a different target space definition of string scattering amplitudes. As in the case of on-shell recursion relations, the amplitudes are expressed in terms of their residues via BCFW shifts. The new idea here is that the residues are determined by use of the monodromy relations for open string theory, avoiding the infinite sums over the spectrum arising in on-shell recursion relations. Several checks of the method are presented, including a derivation of the Koba-Nielsen amplitude in the bosonic string. It is argued that this method provides a target space definition of the complete S-matrix of string theory at tree-level in a at background in terms of a small

dS/CFT correspondence from a holographic description of massless scalar fields in Minkowski space-time

International Nuclear Information System (INIS)

Loran, Farhang

2004-01-01

We solve Klein-Gordon equation for massless scalars on (d+1)-dimensional Minkowski (Euclidean) space in terms of the Cauchy data on the hypersurface t=0. By inserting the solution into the action of massless scalars in Minkowski (Euclidean) space we obtain the action of dual theory on the boundary t=0 which is exactly the holographic dual of conformally coupled scalars on (d+1)-dimensional (Euclidean anti) de Sitter space obtained in (A)dS/CFT correspondence. The observed equivalence of dual theories is explained using the one-to-one map between conformally coupled scalar fields on Minkowski (Euclidean) space and (Euclidean anti) de Sitter space which is an isomorphism between the hypersurface t=0 of Minkowski (Euclidean) space and the boundary of (A)dS space

Supergravity one-loop corrections on AdS7 and AdS3, higher spins and AdS/CFT

Directory of Open Access Journals (Sweden)

Matteo Beccaria

2015-03-01

Full Text Available As was shown earlier, the one-loop correction in 10d supergravity on AdS5×S5 corresponds to the contributions to the vacuum energy and 4d boundary conformal anomaly which are minus the values for one N=4 Maxwell supermultiplet, thus reproducing the subleading term in the N2−1 coefficient in the dual SU(N SYM theory. We perform similar one-loop computations in 11d supergravity on AdS7×S4 and 10d supergravity on AdS3×S3×T4. In the AdS7 case we find that the corrections to the 6d conformal anomaly a-coefficient and the vacuum energy are again minus the ones for one (2,0 tensor multiplet, suggesting that the total a-anomaly coefficient for the dual (2,0 theory is 4N3−9/4N−7/4 and thus vanishes for N=1. In the AdS3 case the one-loop correction to the vacuum energy or 2d central charge turns out to be equal to that of one free (4,4 scalar multiplet, i.e. is c=+6. This reproduces the subleading term in the central charge c=6(Q1Q5+1 of the dual 2d CFT describing decoupling limit of D5–D1 system. We also present the expressions for the 6d a-anomaly coefficient and vacuum energy contributions of general-symmetry higher spin field in AdS7 and consider their application to tests of vectorial AdS/CFT with the boundary conformal 6d theory represented by free scalars, spinors or rank-2 antisymmetric tensors.

Wilson loops in heavy ion collisions and their calculation in AdS/CFT

CERN Document Server

Liu, H; Wiedemann, Urs Achim; Liu, Hong; Rajagopal, Krishna; Wiedemann, Urs Achim

2007-01-01

Expectation values of Wilson loops define the nonperturbative properties of the hot medium produced in heavy ion collisions that arise in the analysis of both radiative parton energy loss and quarkonium suppression. We use the AdS/CFT correspondence to calculate the expectation values of such Wilson loops in the strongly coupled plasma of N=4 super Yang-Mills (SYM) theory, allowing for the possibility that the plasma may be moving with some collective flow velocity as is the case in heavy ion collisions. We obtain the N=4 SYM values of the jet quenching parameter $\\hat q$, which describes the energy loss of a hard parton in QCD, and of the velocity-dependence of the quark-antiquark screening length for a moving dipole as a function of the angle between its velocity and its orientation. We show that if the quark-gluon plasma is flowing with velocity v_f at an angle theta with respect to the trajectory of a hard parton, the jet quenching parameter $\\hat q$ is modified by a factor gamma_f(1-v_f cos theta), and s...

Extensive numerical study of a D-brane, anti-D-brane system in AdS{sub 5}/CFT{sub 4}

Energy Technology Data Exchange (ETDEWEB)

Hegedűs, Árpád [MTA Lendület Holographic QFT Group, Wigner Research Centre,H-1525 Budapest 114, P.O.B. 49 (Hungary)

2015-04-20

In this paper the hybrid-NLIE approach of http://dx.doi.org/10.1007/JHEP08(2012)022 is extended to the ground state of a D-brane anti-D-brane system in AdS/CFT. The hybrid-NLIE equations presented in the paper are finite component alternatives of the previously proposed TBA equations and they admit an appropriate framework for the numerical investigation of the ground state of the problem. Straightforward numerical iterative methods fail to converge, thus new numerical methods are worked out to solve the equations. Our numerical data confirm the previous TBA data. In view of the numerical results the mysterious L=1 case is also commented in the paper.

Aspects of the zero Λ limit in the AdS/CFT correspondence

Science.gov (United States)

Caldeira Costa, R. N.

2014-11-01

We examine the correspondence between QFT observables and bulk solutions in the context of AdS/CFT in the limit as the cosmological constant Λ →0 . We focus specifically on the spacetime metric and a nonbackreacting scalar in the bulk, compute the one-point functions of the dual operators, and determine the necessary conditions for the correspondence to admit a well-behaved zero-Λ limit. We discuss holographic renormalization in this limit and find that it requires schemes that partially break diffeomorphism invariance of the bulk theory. In the specific case of three bulk dimensions, we compute the zero-Λ limit of the holographic Weyl anomaly and reproduce the central charge that arises in the central extension of bms3 . We compute holographically the energy and momentum of those QFT states dual to flat cosmological solutions and to the Kerr solution and find an agreement with the bulk theory. We also compute holographically the renormalized two-point function of a scalar operator in the zero-Λ limit and find it to be consistent with that of a conformal operator in two dimensions fewer. Finally, our results can be used in a new definition of asymptotic Ricci flatness at null infinity based on the zero-Λ limit of asymptotically Einstein manifolds.

One-point functions in AdS/dCFT from matrix product states

International Nuclear Information System (INIS)

Buhl-Mortensen, Isak; Leeuw, Marius de; Kristjansen, Charlotte; Zarembo, Konstantin

2016-01-01

One-point functions of certain non-protected scalar operators in the defect CFT dual to the D3-D5 probe brane system with k units of world volume flux can be expressed as overlaps between Bethe eigenstates of the Heisenberg spin chain and a matrix product state. We present a closed expression of determinant form for these one-point functions, valid for any value of k. The determinant formula factorizes into the k=2 result times a k-dependent pre-factor. Making use of the transfer matrix of the Heisenberg spin chain we recursively relate the matrix product state for higher even and odd k to the matrix product state for k=2 and k=3 respectively. We furthermore find evidence that the matrix product states for k=2 and k=3 are related via a ratio of Baxter’s Q-operators. The general k formula has an interesting thermodynamical limit involving a non-trivial scaling of k, which indicates that the match between string and field theory one-point functions found for chiral primaries might be tested for non-protected operators as well. We revisit the string computation for chiral primaries and discuss how it can be extended to non-protected operators.

Mixed-symmetry fields in AdS(5), conformal fields, and AdS/CFT

Energy Technology Data Exchange (ETDEWEB)

Metsaev, R.R. [Department of Theoretical Physics, P.N. Lebedev Physical Institute,Leninsky prospect 53, Moscow 119991 (Russian Federation)

2015-01-15

Mixed-symmetry arbitrary spin massive, massless, and self-dual massive fields in AdS(5) are studied. Light-cone gauge actions for such fields leading to decoupled equations of motion are constructed. Light-cone gauge formulation of mixed-symmetry anomalous conformal currents and shadows in 4d flat space is also developed. AdS/CFT correspondence for normalizable and non-normalizable modes of mixed-symmetry AdS fields and the respective boundary mixed-symmetry anomalous conformal currents and shadows is studied. We demonstrate that the light-cone gauge action for massive mixed-symmetry AdS field evaluated on solution of the Dirichlet problem amounts to the light-cone gauge 2-point vertex of mixed-symmetry anomalous shadow. Also we show that UV divergence of the action for mixed-symmetry massive AdS field with some particular value of mass parameter evaluated on the Dirichlet problem amounts to the action of long mixed-symmetry conformal field, while UV divergence of the action for mixed-symmetry massless AdS field evaluated on the Dirichlet problem amounts to the action of short mixed-symmetry conformal field. We speculate on string theory interpretation of a model which involves short low-spin conformal fields and long higher-spin conformal fields.

Genetically Engineered Escherichia coli Nissle 1917 Synbiotics Reduce Metabolic Effects Induced by Chronic Consumption of Dietary Fructose.

Directory of Open Access Journals (Sweden)

Chaudhari Archana Somabhai

Full Text Available To assess protective efficacy of genetically modified Escherichia coli Nissle 1917 (EcN on metabolic effects induced by chronic consumption of dietary fructose.EcN was genetically modified with fructose dehydrogenase (fdh gene for conversion of fructose to 5-keto-D-fructose and mannitol-2-dehydrogenase (mtlK gene for conversion to mannitol, a prebiotic. Charles foster rats weighing 150-200 g were fed with 20% fructose in drinking water for two months. Probiotic treatment of EcN (pqq, EcN (pqq-glf-mtlK, EcN (pqq-fdh was given once per week 109 cells for two months. Furthermore, blood and liver parameters for oxidative stress, dyslipidemia and hyperglycemia were estimated. Fecal samples were collected to determine the production of short chain fatty acids and pyrroloquinoline quinone (PQQ production.EcN (pqq-glf-mtlK, EcN (pqq-fdh transformants were confirmed by restriction digestion and functionality was checked by PQQ estimation and HPLC analysis. There was significant increase in body weight, serum glucose, liver injury markers, lipid profile in serum and liver, and decrease in antioxidant enzyme activity in high-fructose-fed rats. However the rats treated with EcN (pqq-glf-mtlK and EcN (pqq-fdh showed significant reduction in lipid peroxidation along with increase in serum and hepatic antioxidant enzyme activities. Restoration of liver injury marker enzymes was also seen. Increase in short chain fatty acids (SCFA demonstrated the prebiotic effects of mannitol and gluconic acid.Our study demonstrated the effectiveness of probiotic EcN producing PQQ and fructose metabolizing enzymes against the fructose induced hepatic steatosis suggesting that its potential for use in treating fructose induced metabolic syndrome.

Detection of highly and minimally leukotoxic Actinobacillus actinomycetemcomitans strains in patients with periodontal disease

Directory of Open Access Journals (Sweden)

Cortelli Sheila Cavalca

2003-01-01

Full Text Available This study examined the prevalence of highly and minimally leukotoxic Actinobacillus actinomycetemcomitans in patients with periodontal disease. Pooled subgingival plaque samples from 136 patients with some form of periodontal disease were examined. Subjects were between 14 and 76 years of age. Clinical examinations included periodontal pocket depth (PD, plaque index (PI and bleeding index (BI. The obtained plaque samples were examined for the presence of highly or minimally leukotoxic A. actinomycetemcomitans strains by the polymerase chain reaction (PCR. Chi-square and logistic regression were performed to evaluate the results. Forty-seven subjects were diagnosed with gingivitis, 70 with chronic periodontitis and 19 with aggressive periodontitis. According to chi-square there was no significant correlation detected between PD (chi2 = 0.73, PI (chi2 = 0.35, BI (chi2 = 0.09 and the presence of the highly leukotoxic A. actinomycetemcomitans. The highly leukotoxic A. actinomycetemcomitans strains were correlated with subjects that were 28 years of age and younger (chi2 = 7.41. There was a significant correlation between highly leukotoxic A. actinomycetemcomitans and aggressive periodontitis (chi2 = 22.06. This study of a Brazilian cohort confirms the strong association between highly leukotoxic A. actinomycetemcomitans strains and the presence of aggressive periodontitis.

Aquaporin-4 facilitator TGN-073 promotes interstitial fluid circulation within the blood-brain barrier: [17O]H2O JJVCPE MRI study.

Science.gov (United States)

Huber, Vincent J; Igarashi, Hironaka; Ueki, Satoshi; Kwee, Ingrid L; Nakada, Tsutomu

2018-06-13

The blood-brain barrier (BBB), which imposes significant water permeability restriction, effectively isolates the brain from the systemic circulation. Seemingly paradoxical, the abundance of aquaporin-4 (AQP-4) on the inside of the BBB strongly indicates the presence of unique water dynamics essential for brain function. On the basis of the highly specific localization of AQP-4, namely, astrocyte end feet at the glia limitans externa and pericapillary Virchow-Robin space, we hypothesized that the AQP-4 system serves as an interstitial fluid circulator, moving interstitial fluid from the glia limitans externa to pericapillary Virchow-Robin space to ensure proper glymphatic flow draining into the cerebrospinal fluid. The hypothesis was tested directly using the AQP-4 facilitator TGN-073 developed in our laboratory, and [O]H2O JJ vicinal coupling proton exchange MRI, a method capable of tracing water molecules delivered into the blood circulation. The results unambiguously showed that facilitation of AQP-4 by TGN-073 increased turnover of interstitial fluid through the system, resulting in a significant reduction in [O]H2O contents of cortex with normal flux into the cerebrospinal fluid. The study further suggested that in addition to providing the necessary water for proper glymphatic flow, the AQP-4 system produces a water gradient within the interstitial space promoting circulation of interstitial fluid within the BBB.

Enhancement of crystallinity of cellulose produced by Escherichia coli through heterologous expression of bcsD gene from Gluconacetobacter xylinus.

Science.gov (United States)

Sajadi, Elaheh; Babaipour, Valiollah; Deldar, Ali Asghar; Yakhchali, Bagher; Fatemi, Seyed Safa-Ali

2017-09-01

To evaluate the crystallinity index of the cellulose produced by Escherichia coli Nissle 1917 after heterologous expression of the cellulose synthase subunit D (bcsD) gene of Gluconacetobacter xylinus BPR2001. The bcsD gene of G. xylinus BPR2001 was expressed in E. coli and its protein product was visualized using SDS-PAGE. FTIR analysis showed that the crystallinity index of the cellulose produced by the recombinants was 0.84, which is 17% more than that of the wild type strain. The increased crystallinity index was also confirmed by X-ray diffraction analysis. The cellulose content was not changed significantly after over-expressing the bcsD. The bcsD gene can improve the crystalline structure of the bacterial cellulose but there is not any significant difference between the amounts of cellulose produced by the recombinant and wild type E. coli Nissle 1917.

A functional gene array for detection of bacterial virulence elements

Energy Technology Data Exchange (ETDEWEB)

Jaing, C

2007-11-01

We report our development of the first of a series of microarrays designed to detect pathogens with known mechanisms of virulence and antibiotic resistance. By targeting virulence gene families as well as genes unique to specific biothreat agents, these arrays will provide important data about the pathogenic potential and drug resistance profiles of unknown organisms in environmental samples. To validate our approach, we developed a first generation array targeting genes from Escherichia coli strains K12 and CFT073, Enterococcus faecalis and Staphylococcus aureus. We determined optimal probe design parameters for microorganism detection and discrimination, measured the required target concentration, and assessed tolerance for mismatches between probe and target sequences. Mismatch tolerance is a priority for this application, due to DNA sequence variability among members of gene families. Arrays were created using the NimbleGen Maskless Array Synthesizer at Lawrence Livermore National Laboratory. Purified genomic DNA from combinations of one or more of the four target organisms, pure cultures of four related organisms, and environmental aerosol samples with spiked-in genomic DNA were hybridized to the arrays. Based on the success of this prototype, we plan to design further arrays in this series, with the goal of detecting all known virulence and antibiotic resistance gene families in a greatly expanded set of organisms.

Zooming in on AdS3/CFT2 near a BPS bound

Science.gov (United States)

Hartong, Jelle; Lei, Yang; Obers, Niels; Oling, Gerben

2018-05-01

Any ( d + 1)-dimensional CFT with a U(1) flavor symmetry, a BPS bound and an exactly marginal coupling admits a decoupling limit in which one zooms in on the spectrum close to the bound. This limit is an Inönü-Wigner contraction of so(2 , d+1)⊕ u(1) that leads to a relativistic algebra with a scaling generator but no conformal generators. In 2D CFTs, Lorentz boosts are abelian and by adding a second u(1) we find a contraction of two copies of sl(2, ℝ) ⊕ u(1) to two copies of P 2 c , the 2-dimensional centrally extended Poincaré algebra. We show that the bulk is described by a novel non-Lorentzian geometry that we refer to as pseudo-Newton-Cartan geometry. Both the Chern-Simons action on sl(2, ℝ) ⊕ u(1) and the entire phase space of asymptotically AdS3 spacetimes are well-behaved in the corresponding limit if we fix the radial component for the u(1) connection. With this choice, the resulting Newton-Cartan foliation structure is now associated not with time, but with the emerging holographic direction. Since the leaves of this foliation do not mix, the emergence of the holographic direction is much simpler than in AdS3 holography. Furthermore, we show that the asymptotic symmetry algebra of the limit theory consists of a left- and a right-moving warped Virasoro algebra.

Proteogenomic mapping of Mycoplasma hyopneumoniae virulent strain 232.

Science.gov (United States)

Pendarvis, Ken; Padula, Matthew P; Tacchi, Jessica L; Petersen, Andrew C; Djordjevic, Steven P; Burgess, Shane C; Minion, F Chris

2014-07-08

Mycoplasma hyopneumoniae causes respiratory disease in swine and contributes to the porcine respiratory disease complex, a major disease problem in the swine industry. The M. hyopneumoniae strain 232 genome is one of the smallest and best annotated microbial genomes, containing only 728 annotated genes and 691 known proteins. Standard protein databases for mass spectrometry only allow for the identification of known and predicted proteins, which if incorrect can limit our understanding of the biological processes at work. Proteogenomic mapping is a methodology which allows the entire 6-frame genome translation of an organism to be used as a mass spectrometry database to help identify unknown proteins as well as correct and confirm existing annotations. This methodology will be employed to perform an in-depth analysis of the M. hyopneumoniae proteome. Proteomic analysis indicates 483 of 691 (70%) known M. hyopneumoniae strain 232 proteins are expressed under the culture conditions given in this study. Furthermore, 171 of 328 (52%) hypothetical proteins have been confirmed. Proteogenomic mapping resulted in the identification of previously unannotated genes gatC and rpmF and 5-prime extensions to genes mhp063, mhp073, and mhp451, all conserved and annotated in other M. hyopneumoniae strains and Mycoplasma species. Gene prediction with Prodigal, a prokaryotic gene predicting program, completely supports the new genomic coordinates calculated using proteogenomic mapping. Proteogenomic mapping showed that the protein coding genes of the M. hyopneumoniae strain 232 identified in this study are well annotated. Only 1.8% of mapped peptides did not correspond to genes defined by the current genome annotation. This study also illustrates how proteogenomic mapping can be an important tool to help confirm, correct and append known gene models when using a genome sequence as search space for peptide mass spectra. Using a gene prediction program which scans for a wide variety of

Topological Symmetry, Spin Liquids and CFT Duals of Polyakov Model with Massless Fermions

Energy Technology Data Exchange (ETDEWEB)

Unsal, Mithat

2008-04-30

We prove the absence of a mass gap and confinement in the Polyakov model with massless complex fermions in any representation of the gauge group. A U(1){sub *} topological shift symmetry protects the masslessness of one dual photon. This symmetry emerges in the IR as a consequence of the Callias index theorem and abelian duality. For matter in the fundamental representation, the infrared limits of this class of theories interpolate between weakly and strongly coupled conformal field theory (CFT) depending on the number of flavors, and provide an infinite class of CFTs in d = 3 dimensions. The long distance physics of the model is same as certain stable spin liquids. Altering the topology of the adjoint Higgs field by turning it into a compact scalar does not change the long distance dynamics in perturbation theory, however, non-perturbative effects lead to a mass gap for the gauge fluctuations. This provides conceptual clarity to many subtle issues about compact QED{sub 3} discussed in the context of quantum magnets, spin liquids and phase fluctuation models in cuprate superconductors. These constructions also provide new insights into zero temperature gauge theory dynamics on R{sup 2,1} and R{sup 2,1} x S{sup 1}. The confined versus deconfined long distance dynamics is characterized by a discrete versus continuous topological symmetry.

Using ALMA to Resolve the Nature of the Early Star-Forming Large-Scale Structure G073

Science.gov (United States)

Hill, R.; Kneissl, R.; Polletta, M.; Clarenc, B.; Dole, H. A.; Nesvadba, N. P. H.; Scott, D.; Béthermin, M.; Lagache, G.; Montier, L.

2017-07-01

Galaxy clusters at large redshift are key targets for understanding the nature of the early Universe, yet locating them has proven to be very challenging. Recently, a large sample of over 2000 high-z candidate structures have been found using Planck's all-sky submillimetre maps, and a subset of 234 have been followed up with Herschel-SPIRE, which showed that the emission can be attributed to large far-infrared overdensities. However, the individual galaxies giving rise to the emission seen by Planck and Herschel have not yet been resolved nor characterized, so we do not yet know whether these sources are the progenitors of present-day, massive galaxy clusters. In an attempt to address this, we targeted the eight brightest Herschel-SPIRE peaks in the centre of the Planck peak G073.4-57.5 using ALMA at 1.3 mm, and complemented these observations with multi-wavelength data from Spitzer-IRAC at 3.6 and 4.5 μm and from CFHT-WIRCam at 1.2 and 2.2 μm. We also utilize data on G073.4-57.5 at 850 μm from JCMT's SCUBA-2 instrument. We detect a total of 18 millimetre galaxies brighter than 0.3mJy in 2.4arcmin2. In every case we are able to match these to their NIR counterparts, and while the most significant SCUBA-2 sources are not included in the ALMA pointings, we find an 8σ detection when stacking the ALMA source positions in the 850 μm data. We derive photometric redshifts, IR luminosities, star-formation rates, stellar masses, dust temperatures, and dust masses; the photometric redshifts are concentrated around z ≃ 1 and z ≃ 2 and the NIR colours show a "red" sequence, while the star-formation rates indicate that three of the galaxies are "starbursts". Serendipitous CO line detections of two of the galaxies appear to match their photometric redshifts with z = 2.05. We find that the ALMA source density is 8-30 times higher than average background estimates, and thus also larger than seen in typical "proto-cluster" fields. The evidence seems to be indicating the

Results of the radiological survey at 174 Essex Street, Lodi, New Jersey (LJ073)

International Nuclear Information System (INIS)

Foley, R.D.; Floyd, L.M.; Carrier, R.F.; Crutcher, J.W.

1989-06-01

Maywood Chemical Works (MCW) of Maywood, New Jersey, generated process wastes and residues associated with the production and refining of thorium and thorium compounds from monazite ores from 1916 to 1956. MCW supplied rare earth metals and thorium compounds to the Atomic Energy Commission and various other government agencies from the late 1940s to the mid-1950s. Area residents used the sandlike waste from this thorium extraction process mixed with tea and cocoa leaves as mulch in their yards. Some of these contaminated wastes were also eroded from the site into Lodi Brook. At the request of the US Department of Energy (DOE), a group from Oak Ridge National Laboratory conducts investigative radiological surveys of properties in the vicinity of MCW to determine whether a property is contaminated with radioactive residues, principally 232 Th, derived from the MCW site. The survey typically includes direct measurement of gamma radiation levels and soil sampling for radionuclide analyses. The survey of this site, 174 Essex Street, Lodi, New Jersey (LJ073), was conducted during 1987. Results of the survey demonstrated radionuclide concentrations in excess of the DOE Formerly Utilized Sites Remedial Action Program criteria. The radionuclide distributions are typical of the type of material originating from the MCW site

Neuronal density, size and shape in the human anterior cingulate cortex: a comparison of Nissl and NeuN staining.

Science.gov (United States)

Gittins, Rebecca; Harrison, Paul J

2004-03-15

There are an increasing number of quantitative morphometric studies of the human cerebral cortex, especially as part of comparative investigations of major psychiatric disorders. In this context, the present study had two aims. First, to provide quantitative data regarding key neuronal morphometric parameters in the anterior cingulate cortex. Second, to compare the results of conventional Nissl staining with those observed after immunostaining with NeuN, an antibody becoming widely used as a selective neuronal marker. We stained adjacent sections of area 24b from 16 adult brains with cresyl violet or NeuN. We measured the density of pyramidal and non-pyramidal neurons, and the size and shape of pyramidal neurons, in laminae II, III, Va, Vb and VI, using two-dimensional counting methods. Strong correlations between the two modes of staining were seen for all variables. However, NeuN gave slightly higher estimates of neuronal density and size, and a more circular perikaryal shape. Brain pH was correlated with neuronal size, measured with both methods, and with neuronal shape. Age and post-mortem interval showed no correlations with any parameter. These data confirm the value of NeuN as a tool for quantitative neuronal morphometric studies in routinely processed human brain tissue. Absolute values are highly correlated between NeuN and cresyl violet stains, but cannot be interchanged. NeuN may be particularly useful when it is important to distinguish small neurons from glia, such as in cytoarchitectural studies of the cerebral cortex in depression and schizophrenia.

Genetic diversity and symbiotic effectiveness of Bradyrhizobium strains nodulating selected annual grain legumes growing in Ethiopia.

Science.gov (United States)

Degefu, Tulu; Wolde-Meskel, Endalkachew; Rasche, Frank

2018-01-01

Vigna unguiculata, Vigna radiata and Arachis hypogaea growing in Ethiopia are nodulated by a genetically diverse group of Bradyrhizobium strains. To determine the genetic identity and symbiotic effectiveness of these bacteria, a collection of 36 test strains originating from the root nodules of the three hosts was investigated using multilocus sequence analyses (MLSA) of core genes including 16S rRNA, recA, glnII, gyrB, atpD and dnaK. Sequence analysis of nodA and nifH genes along with tests for symbiotic effectiveness using δ 15 N analysis were also carried out. The phylogenetic trees derived from the MLSA grouped most test strains into four well-supported distinct positions designated as genospecies I-IV. The maximum likelihood (ML) tree that was constructed based on the nodA gene sequences separated the entire test strains into two lineages, where the majority of the test strains were clustered on one of a well-supported large branch that comprise Bradyrhizobium species from the tropics. This clearly suggested the monophyletic origin of the nodA genes within the bradyrhizobia of tropical origin. The δ 15 N-based symbiotic effectiveness test of seven selected strains revealed that strains GN100 (δ 15 N=0.73) and GN102 (δ 15 N=0.79) were highly effective nitrogen fixers when inoculated to cowpea, thus can be considered as inoculants in cowpea production. It was concluded that Ethiopian soils are a hotspot for rhizobial diversity. This calls for further research to unravel as yet unknown bradyrhizobia nodulating legume host species growing in the country. In this respect, prospective research should also address the mechanisms of symbiotic specificity that could lead to high nitrogen fixation in target legumes.

Cinacalcet: AMG 073, Calcimimetics--Amgen/NPS Pharmaceuticals, KRN 1493, NPS 1493.

Science.gov (United States)

2003-01-01

Cinacalcet [AMG 073, KRN 1493, NPS 1493] is an orally active, second-generation calcimimetic compound licensed by NPS Pharmaceuticals to Amgen in the US for potential treatment of hyperparathyroidism (HPT). Cinacalcet modulates (increases the sensitivity of) calcium receptors on the surface of parathyroid cells thereby inhibiting the oversecretion of parathyroid hormone, which characterises HPT. It also represents a potentially significant advance for chronic kidney disease patients diagnosed with secondary HPT, a common yet serious metabolic disorder where parathyroid hormone levels are elevated. Patients with this disease can suffer from bone disease, bone pain and fractures, soft tissue calcification, vascular calcification and cardiovascular complications. Amgen has rights to develop and sell cinacalcet throughout the world except in Japan, Taiwan and China, where the compound was licensed to Kirin Brewery. Kirin is developing it as KRN 1493 in phase II clinical studies in Japan. In December 2001, commencement of a phase III clinical trial with cinacalcet for the treatment of secondary HPT, triggered a 3 million US dollars milestone payment to NPS Pharmaceuticals. In September 2003, submission of an NDA to the US FDA for cinacalcet for secondary HPT will be followed by a milestone payment of 6 million US dollars to NPS. NPS, Kirin and Amgen were also developing another compound, tecalcet, for HPT, but that project has been discontinued in favour of cinacalcet. In September 2003, Amgen submitted an NDA to the US FDA for secondary HPT in patients with chronic kidney disease. In April 2003, Amgen announced positive results from a phase III clinical trial with cinacalcet in patients with secondary HPT. In a clinical study in patients on dialysis suffering from the effects of chronically elevated levels parathyroid hormone, cinacalcet appeared to be safe and well tolerated and was significantly more effective than placebo. Two more additional efficacy studies with

Homologous Recombination between Genetically Divergent Campylobacter fetus Lineages Supports Host-Associated Speciation

Science.gov (United States)

Duim, Birgitta; van der Graaf-van Bloois, Linda; Wagenaar, Jaap A; Zomer, Aldert L

2018-01-01

Abstract Homologous recombination is a major driver of bacterial speciation. Genetic divergence and host association are important factors influencing homologous recombination. Here, we study these factors for Campylobacter fetus, which shows a distinct intraspecific host dichotomy. Campylobacter fetus subspecies fetus (Cff) and venerealis are associated with mammals, whereas C. fetus subsp. testudinum (Cft) is associated with reptiles. Recombination between these genetically divergent C. fetus lineages is extremely rare. Previously it was impossible to show whether this barrier to recombination was determined by the differential host preferences, by the genetic divergence between both lineages or by other factors influencing recombination, such as restriction-modification, CRISPR/Cas, and transformation systems. Fortuitously, a distinct C. fetus lineage (ST69) was found, which was highly related to mammal-associated C. fetus, yet isolated from a chelonian. The whole genome sequences of two C. fetus ST69 isolates were compared with those of mammal- and reptile-associated C. fetus strains for phylogenetic and recombination analysis. In total, 5.1–5.5% of the core genome of both ST69 isolates showed signs of recombination. Of the predicted recombination regions, 80.4% were most closely related to Cft, 14.3% to Cff, and 5.6% to C. iguaniorum. Recombination from C. fetus ST69 to Cft was also detected, but to a lesser extent and only in chelonian-associated Cft strains. This study shows that despite substantial genetic divergence no absolute barrier to homologous recombination exists between two distinct C. fetus lineages when occurring in the same host type, which provides valuable insights in bacterial speciation and evolution. PMID:29608720

Toward the AdS/CFT gravity dual for high energy collisions. III. Gravitationally collapsing shell and quasiequilibrium

International Nuclear Information System (INIS)

Lin, Shu; Shuryak, Edward

2008-01-01

The equilibration of matter and onset of hydrodynamics can be understood in the AdS/CFT context as a gravitational collapse process, in which 'collision debris' create a horizon. In this paper we consider the simplest geometry possible, a flat shell (or membrane) falling in the holographic direction toward the horizon. The metric is a combination of two well-known solutions: thermal AdS above the shell and pure AdS below, while motion of the shell is given by the Israel junction condition. Furthermore, when the shell motion can be considered slow, we were able to solve for two-point functions of all boundary stress tensors and found that an observer on the boundary sees a very peculiar quasiequilibrium: while the average stress tensor μν> contains the equilibrium plasma energy and pressure at all times, the spectral densities of the correlators (related with occupation probabilities of the modes) reveal additional oscillating terms absent in equilibrium. This is explained by the echo phenomenon, a partial return of the field coherence at certain echo times.

Non-supersymmetric Wilson loop in N = 4 SYM and defect 1d CFT

Science.gov (United States)

Beccaria, Matteo; Giombi, Simone; Tseytlin, Arkady A.

2018-03-01

Following Polchinski and Sully (arXiv:1104.5077), we consider a generalized Wilson loop operator containing a constant parameter ζ in front of the scalar coupling term, so that ζ = 0 corresponds to the standard Wilson loop, while ζ = 1 to the locally supersymmetric one. We compute the expectation value of this operator for circular loop as a function of ζ to second order in the planar weak coupling expansion in N = 4 SYM theory. We then explain the relation of the expansion near the two conformal points ζ = 0 and ζ = 1 to the correlators of scalar operators inserted on the loop. We also discuss the AdS5 × S 5 string 1-loop correction to the strong-coupling expansion of the standard circular Wilson loop, as well as its generalization to the case of mixed boundary conditions on the five-sphere coordinates, corresponding to general ζ. From the point of view of the defect CFT1 defined on the Wilson line, the ζ-dependent term can be seen as a perturbation driving a RG flow from the standard Wilson loop in the UV to the supersymmetric Wilson loop in the IR. Both at weak and strong coupling we find that the logarithm of the expectation value of the standard Wilson loop for the circular contour is larger than that of the supersymmetric one, which appears to be in agreement with the 1d analog of the F-theorem.

Toric Geometry, Sasaki-Einstein Manifolds and a New Infinite Class of AdS/CFT Duals

CERN Document Server

Martelli, D; Martelli, Dario; Sparks, James

2006-01-01

Recently an infinite family of explicit Sasaki-Einstein metrics Y^{p,q} on S^2 x S^3 has been discovered, where p and q are two coprime positive integers, with qCFT dual to an infinite class of N=1 superconformal field theories arising as infra-red (IR) fixed points of toric quiver gauge theories with gauge group SU(N)^{2p}. As a non-trivial example, we show that Y^{2,1} is an explicit irregular Sasaki-Einstein metric on the horizon of the complex cone over the first del Pezz...

Environmental Enrichment Protects against Functional Deficits caused by Traumatic Brain Injury

Science.gov (United States)

2012-11-01

5 3.8 Nissl Stain ...distribution unlimited. 88 ABW/PA Cleared 4/09/2013; 88ABW-2013-1135; AFMC-2013-0051. 3.8 Nissl Stain A Nissl stain was performed to identify cell bodies and...TBI, b p < 0.05 Sham vs EC-TBI, c p < 0.05 ST-TBI vs EC-TBI using two-tailed 2-sample t-test. 4.4 Lesion size Nissl - stained coronal sections of the

Pathophysiological Alterations In The Basolateral Amygdala And Neurodegeneration Of Limbic Structures During Epileptogenesis Induced By Status Epilepticus

Science.gov (United States)

2009-02-05

22 CHAPTER 2 TABLE 1 Stereological estimation of total Nissl - stained and GAD67-positive neurons in the BLA of sham control rats and KA-SE rats... Nissl - stained sections……………….... FIGURE 2 Counting site for stereological quantification of Nissl - stained neurons...FIGURE 3 Counting grid superimposed over tracing of BLA………………... 142 143 144 xii FIGURE 4 Disector height and guard zones in Nissl - stained

Use of a Western blot technique for the serodiagnosis of glanders

Directory of Open Access Journals (Sweden)

de Souza Marcilia MA

2011-01-01

Full Text Available Abstract Background The in vivo diagnosis of glanders relies on the highly sensitive complement fixation test (CFT. Frequently observed false positive results are troublesome for veterinary authorities and cause financial losses to animal owners. Consequently, there is an urgent need to develop a test with high specificity. Hence, a Western blot assay making use of a partly purified lipopolysaccaride (LPS containing antigen of three Burkholderia mallei strains was developed. The test was validated investigating a comprehensive set of positive and negative sera obtained from horses and mules from endemic and non endemic areas. Results The developed Western blot assay showed a markedly higher diagnostic specificity when compared to the prescribed CFT and therefore can be used as a confirmatory test. However, the CFT remains the test of choice for routine testing of glanders due to its high sensitivity, its feasibility using standard laboratory equipment and its worldwide distribution in diagnostic laboratories. Conclusions The CFT should be amended by the newly validated Western blot to increase the positive likelihood ratio of glanders serodiagnosis in non endemic areas or areas with low glanders prevalence. Its use for international trade of horses and mules should be implemented by the OIE.

Private selective sweeps identified from next-generation pool-sequencing reveal convergent pathways under selection in two inbred Schistosoma mansoni strains.

Directory of Open Access Journals (Sweden)

Julie A J Clément

Full Text Available BACKGROUND: The trematode flatworms of the genus Schistosoma, the causative agents of schistosomiasis, are among the most prevalent parasites in humans, affecting more than 200 million people worldwide. In this study, we focused on two well-characterized strains of S. mansoni, to explore signatures of selection. Both strains are highly inbred and exhibit differences in life history traits, in particular in their compatibility with the intermediate host Biomphalaria glabrata. METHODOLOGY/PRINCIPAL FINDINGS: We performed high throughput sequencing of DNA from pools of individuals of each strain using Illumina technology and identified single nucleotide polymorphisms (SNP and copy number variations (CNV. In total, 708,898 SNPs were identified and roughly 2,000 CNVs. The SNPs revealed low nucleotide diversity (π = 2 × 10(-4 within each strain and a high differentiation level (Fst = 0.73 between them. Based on a recently developed in-silico approach, we further detected 12 and 19 private (i.e. specific non-overlapping selective sweeps among the 121 and 151 sweeps found in total for each strain. CONCLUSIONS/SIGNIFICANCE: Functional annotation of transcripts lying in the private selective sweeps revealed specific selection for functions related to parasitic interaction (e.g. cell-cell adhesion or redox reactions. Despite high differentiation between strains, we identified evolutionary convergence of genes related to proteolysis, known as a key virulence factor and a potential target of drug and vaccine development. Our data show that pool-sequencing can be used for the detection of selective sweeps in parasite populations and enables one to identify biological functions under selection.

Neuroprotection and Anti-Epileptogenesis with Mitochondria-Targeted Antioxidant

Science.gov (United States)

2016-06-01

Nissl , Fluoro-jade C (FJ), NeuN and heat shock protein 70-72 (HSP). Nissl , FJ and NeuN stains were used to assess neuroprotection. HSP was used to...days after SE. The brains were removed and sectioned on a vibratome (50µm) throughout the dorsal hippocampus. Sections were stained for Nissl ...2.5mg/kg (n=2). Nissl - stained sections from the left hemisphere of each brain were evaluated for damage and scored using the following scale: 1

The effect of exercise and metformin treatment on circulating free DNA in pregnancy.

Science.gov (United States)

Christiansen, S C; Vanky, E; Klungland, H; Stafne, S N; Mørkved, S; Salvesen, K Å; Sæther, M; Carlsen, S M

2014-12-01

Some pregnancy complications are characterized by increased levels of cell-free fetal (cffDNA) and maternal DNA (cfmDNA), the latter may also be elevated during physical strain. This study aims at assessing the impact of exercise and metformin intervention in pregnancy, and to compare the levels of cell free DNA in pregnant women with or without PCOS diagnosis. Consecutive women from two previous randomized controlled trials in pregnancy were included. Women came from a trial with organized exercise vs. standard antenatal care in pregnancy and a trial of metformin vs. placebo in PCOS women. Levels of cffDNA, cfmDNA and cell-free total DNA (cftDNA) were measured by qPCR. Training in pregnancy did not affect the levels of cffDNA, cfmDNA or cftDNA. PCOS-women treated with metformin had lower levels of cfmDNA and cftDNA at week 32 (mean ± SD: 301 ± 162 versus 570 ± 337, p = 0.012, 345 ± 173 versus 635 ± 370, p = 0.019); otherwise the levels were comparable to PCOS-controls. Metformin-treated PCOS-women had higher cffDNA at inclusion, in the 1st trimester; later on in pregnancy the levels in the metformin and placebo groups were equal. A comparison of pregnant women in the exercise study (TRIP) to placebo-treated pregnant PCOS-women, showed the levels of cffDNA, cfmDNA or cftDNA during mid-pregnancy (weeks 18-36) to be equal. Training during pregnancy was not associated with altered levels of cffDNA cfmDNA or cftDNA, but metformin treatment may reduce cfmDNA and cftDNA in pregnant PCOS women. Copyright © 2014 Elsevier Ltd. All rights reserved.

The full spectrum of AdS5/CFT4 I: representation theory and one-loop Q-system

Science.gov (United States)

Marboe, Christian; Volin, Dmytro

2018-04-01

With the formulation of the quantum spectral curve for the AdS5/CFT4 integrable system, it became potentially possible to compute its full spectrum with high efficiency. This is the first paper in a series devoted to the explicit design of such computations, with no restrictions to particular subsectors being imposed. We revisit the representation theoretical classification of possible states in the spectrum and map the symmetry multiplets to solutions of the quantum spectral curve at zero coupling. To this end it is practical to introduce a generalisation of Young diagrams to the case of non-compact representations and define algebraic Q-systems directly on these diagrams. Furthermore, we propose an algorithm to explicitly solve such Q-systems that circumvents the traditional usage of Bethe equations and simplifies the computation effort. For example, our algorithm quickly obtains explicit analytic results for all 495 multiplets that accommodate single-trace operators in N=4 SYM with classical conformal dimension up to \\frac{13}{2} . We plan to use these results as the seed for solving the quantum spectral curve perturbatively to high loop orders in the next paper of the series.

Quantum field theories coupled to supergravity. AdS/CFT and local couplings

International Nuclear Information System (INIS)

Grosse, J.

2006-01-01

This dissertation is devoted to the investigation of the interplay of supersymmetric Yang-Mills theories (SYM) and supergravity (SUGRA). The topic is studied from two points of view: Firstly from the point of view of AdS/CFT correspondence, which realises the coupling of four dimensional superconformal N=4 SYM theory and ten dimensional type IIB SUGRA in a holographic way. In order to arrive at theories that resemble quantum chromodynamics (QCD) more closely, fundamental fields are introduced using probe D7-branes and nontrivial background configuration are considered. In particular supergravity solutions that are only asymptotically anti-de Sitter and break supersymmetry are used. This allows the description of spontaneous chiral symmetry breaking. The meson spectrum is calculated and the existence of an associated Goldstone mode is demonstrated. Moreover it is shown that highly radially excited mesons are not degenerate. Additionally instanton configurations on the D7-branes are investigated, which lead to a holographic description of the dual field theory's Higgs branch. Finally a holographic description of heavy-light mesons is developed, which are mesons consisting of quarks with a large mass difference, such that a treatment of B mesons can be achieved. The second approach to the topic of this thesis is the technique of socalled space-time dependent couplings (also known as ''local couplings''), where coupling constants are promoted to external sources. This allows to explore the conformal anomaly of quantum field theories coupled to a classical gravity background. The technique is extended to the superfield description of N=1 supergravity, a complete basis for the anomaly is given and the consistency conditions that arise from a cohomological treatment are calculated. Possible implications for an extension of Zamolodchikov's c-theorem to four dimensional supersymmetric quantum field theories are discussed. (orig.)

Quantum field theories coupled to supergravity. AdS/CFT and local couplings

Energy Technology Data Exchange (ETDEWEB)

Grosse, J.

2006-08-03

This dissertation is devoted to the investigation of the interplay of supersymmetric Yang-Mills theories (SYM) and supergravity (SUGRA). The topic is studied from two points of view: Firstly from the point of view of AdS/CFT correspondence, which realises the coupling of four dimensional superconformal N=4 SYM theory and ten dimensional type IIB SUGRA in a holographic way. In order to arrive at theories that resemble quantum chromodynamics (QCD) more closely, fundamental fields are introduced using probe D7-branes and nontrivial background configuration are considered. In particular supergravity solutions that are only asymptotically anti-de Sitter and break supersymmetry are used. This allows the description of spontaneous chiral symmetry breaking. The meson spectrum is calculated and the existence of an associated Goldstone mode is demonstrated. Moreover it is shown that highly radially excited mesons are not degenerate. Additionally instanton configurations on the D7-branes are investigated, which lead to a holographic description of the dual field theory's Higgs branch. Finally a holographic description of heavy-light mesons is developed, which are mesons consisting of quarks with a large mass difference, such that a treatment of B mesons can be achieved. The second approach to the topic of this thesis is the technique of socalled space-time dependent couplings (also known as ''local couplings''), where coupling constants are promoted to external sources. This allows to explore the conformal anomaly of quantum field theories coupled to a classical gravity background. The technique is extended to the superfield description of N=1 supergravity, a complete basis for the anomaly is given and the consistency conditions that arise from a cohomological treatment are calculated. Possible implications for an extension of Zamolodchikov's c-theorem to four dimensional supersymmetric quantum field theories are discussed. (orig.)

Confinement near Argyres-Douglas point in N=2 QCD and low energy version of AdS/CFT correspondence

International Nuclear Information System (INIS)

Yung, Alexei

2002-01-01

We study Abrikosov-Nielsen-Olesen (ANO) flux tubes on the Higgs branch of N=2 QCD with SU(2) gauge group and N f =2 flavors of fundamental matter. In particular, we consider this theory near Argyres-Douglas (AD) point where the mass of monopoles connected by these ANO strings become small. In this regime the effective QED which describes the theory on the Higgs branch becomes strongly coupled. We argue that the appropriate description of the theory is in terms of long and thin flux tubes (strings) with small tension. We interpret this as another example of duality between field theory in strong coupling and string theory in weak coupling. Then we consider the non-critical string theory for these flux tubes which includes fifth (Liouville) dimension. We identify CFT at the AD point as UV fix point corresponding to AdS metric on the 5d 'gravity' side. The perturbation associated with the monopole mass term creates a kink separating UV and IR behavior. We estimate the renormalized string tension and show that it is determined by the small monopole mass. In particular, it goes to zero at the AD point

Modeling the Constitutive Relationship of Al–0.62Mg–0.73Si Alloy Based on Artificial Neural Network

Directory of Open Access Journals (Sweden)

Ying Han

2017-03-01

Full Text Available In this work, the hot deformation behavior of 6A02 aluminum alloy was investigated by isothermal compression tests conducted in the temperature range of 683–783 K and strain-rate range of 0.001–1 s−1. According to the obtained true stress–true strain curves, the constitutive relationship of the alloy was revealed by establishing the Arrhenius-type constitutive model and back-propagation (BP neural network model. It is found that the flow characteristic of 6A02 aluminum alloy is closely related to deformation temperature and strain rate, and the true stress decreases with increasing temperatures and decreasing strain rates. The hot deformation activation energy is calculated to be 168.916 kJ mol−1. The BP neural network model with one hidden layer and 20 neurons in the hidden layer is developed. The accuracy in prediction of the Arrhenius-type constitutive model and BP neural network model is eveluated by using statistics analysis method. It is demonstrated that the BP neural network model has better performance in predicting the flow stress.

Al2O3 Coated Concentration-Gradient Li[Ni0.73Co0.12Mn0.15]O2 Cathode Material by Freeze Drying for Long-Life Lithium Ion Batteries

International Nuclear Information System (INIS)

Wang, Jingpeng; Du, Chunyu; Yan, Chunqiu; He, Xiaoshu; Song, Bai; Yin, Geping; Zuo, Pengjian; Cheng, Xinqun

2015-01-01

Highlights: • Al 2 O 3 -coated concentration-gradient oxide is synthesized by a freeze drying method. • The effect of Al 2 O 3 -coating on concentration-gradient cathode is firstly studied. • Al 2 O 3 -coated sample exhibits high capacity and significantly enhanced cyclability. • Improved cyclability is ascribed to the effective protection of uniform Al 2 O 3 layer. - Abstract: In order to enhance the electrochemical performance of the high capacity layered oxide cathode with a Ni-rich core and a concentration-gradient shell (NRC-CGS), we use a freeze drying method to coat Al 2 O 3 layer onto the surface of NRC-CGS Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material. The samples are characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, charge-discharge measurements and electrochemical impedance spectroscopy. It is revealed that an amorphous Al 2 O 3 layer of about 5 nm in thickness is uniformly formed on the surface of NRC-CGS Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material by the freeze drying procedure. The freeze drying Al 2 O 3 -coated (FD-Al 2 O 3 -coated) sample demonstrates similar discharge capacity and significantly enhanced cycling performances, in comparison to the pristine and conventional heating drying Al 2 O 3 -coated (HD-Al 2 O 3 -coated) samples. The capacity decay rate of FD-Al 2 O 3 -coated Li[Ni 0.73 Co 0.12 Mn 0.15 ]O 2 material is 1.7% after 150 cycles at 55 °C, which is 9 and 12 times lower than that of the pristine and HD-Al 2 O 3 -coated samples. The superior electrochemical stability of the FD-Al 2 O 3 -coated sample is attributed to the synergistic protection of CGS and high-quality Al 2 O 3 coating that effectively protect the active material from electrolyte attack. The freeze drying process provides an effective method to prepare the high performance surface-coated electrode materials

Use of enzyme linked immunosorbent assay (ELISA) for the diagnosis of brucellosis in cattle in Yucatan, Mexico

International Nuclear Information System (INIS)

Dajer, A.; Gutierrez, E.; Zapata, D.

1998-01-01

Sera (247) from non-vaccinated brucellosis negative herds, 328 negative sera from Brucella abortus strain 19 vaccinated herds (brucellosis free), and 95 sera positive to the Rose Bengal test (RBT) and Complement Fixation test (CFT) from Brucella abortus-infected herds, were used to determine the relative sensitivity and specificity of a FAO/IAEA I-ELISA kit and the Rivanol Agglutination Test (RAT), using the CFT as a 'gold standard'. A threshold value for the I-ELISA was determined to be 37 PP using the mean plus 3 standard deviations of the negative sera from vaccinated animals. The I-ELISA showed a high relative sensitivity (100%) and a good relative specificity (92.5%), using the threshold determined for local conditions. The RAT gave a lower sensitivity value than the CFT (97.8%) and good specificity (99.3%). The I-ELISA could be used as a screening test under Yucatan conditions or as a confirmatory test in places where vaccination is not carried out. The RAT lacks sensitivity and is therefore not recommended for use in final stages of eradication programs but could be used in control programmes or early stages of eradication campaigns as a confirmatory test. (author)

Magnetic domain structure, crystal orientation, and magnetostriction of Tb{sub 0.27}Dy{sub 0.73}Fe{sub 1.95} solidified in various high magnetic fields

Energy Technology Data Exchange (ETDEWEB)

Gao, Pengfei [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Liu, Tie, E-mail: liutie@epm.neu.edu.cn [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Dong, Meng [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China); Yuan, Yi [School of Materials and Metallurgy, Northeastern University, Shenyang 110819 (China); Wang, Qiang [Key Laboratory of Electromagnetic Processing of Materials (Ministry of Education), Northeastern University, Shenyang 110819 (China)

2016-03-01

In this paper, we studied how applying a high magnetic field during solidification of Tb{sub 0.27}Dy{sub 0.73}Fe{sub 1.95} alloys affected their magnetic domain structure, crystal orientation, and magnetostriction. We observed the morphology of the magnetic domain during solidification, finding it change with the applied field: from fiber like (0 T) to dot like and closure mixed (4.4 T) to fiber like (8.8 T) to fishbone like (11.5 T). The alloy solidified at 4.4 T showed the best contrast of light and dark in its domain image, widest magnetic domain, fastest magnetization, and highest magnetostriction; this alloy is followed in descending order by the alloys solidified at 11.5 T, 8.8 T, and 0 T. The orientation of the (Tb, Dy)Fe{sub 2} phase changed with magnetic field from random (0 T) to 〈111〉 (4.4 T) to 〈113〉 (8.8 T) to 〈110〉 (11.5 T). The improvement in magnetostriction was likely caused by modification of both the magnetization process and the alloy microstructure. - Highlights: • We present how magnetic field affects magnetic domain structure of Tb{sub 0.27}Dy{sub 0.73}Fe{sub 1.95}. • Morphology and width of magnetic domain change with increasing magnetic field. • Magnetization and magnetostriction of alloy change with increasing magnetic field. • A transformation of random–〈111〉–〈113〉–〈110〉 for (Tb, Dy)Fe{sub 2} orientation forms.

Peptidoglycan Association of Murein Lipoprotein Is Required for KpsD-Dependent Group 2 Capsular Polysaccharide Expression and Serum Resistance in a Uropathogenic Escherichia coli Isolate.

Science.gov (United States)

Diao, Jingyu; Bouwman, Catrien; Yan, Donghong; Kang, Jing; Katakam, Anand K; Liu, Peter; Pantua, Homer; Abbas, Alexander R; Nickerson, Nicholas N; Austin, Cary; Reichelt, Mike; Sandoval, Wendy; Xu, Min; Whitfield, Chris; Kapadia, Sharookh B

2017-05-23

Murein lipoprotein (Lpp) and peptidoglycan-associated lipoprotein (Pal) are major outer membrane lipoproteins in Escherichia coli Their roles in cell-envelope integrity have been documented in E. coli laboratory strains, and while Lpp has been linked to serum resistance in vitro , the underlying mechanism has not been established. Here, lpp and pal mutants of uropathogenic E. coli strain CFT073 showed reduced survival in a mouse bacteremia model, but only the lpp mutant was sensitive to serum killing in vitro The peptidoglycan-bound Lpp form was specifically required for preventing complement-mediated bacterial lysis in vitro and complement-mediated clearance in vivo Compared to the wild-type strain, the lpp mutant had impaired K2 capsular polysaccharide production and was unable to respond to exposure to serum by elevating capsular polysaccharide amounts. These properties correlated with altered cellular distribution of KpsD, the predicted outer membrane translocon for "group 2" capsular polysaccharides. We identified a novel Lpp-dependent association between functional KpsD and peptidoglycan, highlighting important interplay between cell envelope components required for resistance to complement-mediated lysis in uropathogenic E. coli isolates. IMPORTANCE Uropathogenic E. coli (UPEC) isolates represent a significant cause of nosocomial urinary tract and bloodstream infections. Many UPEC isolates are resistant to serum killing. Here, we show that a major cell-envelope lipoprotein (murein lipoprotein) is required for serum resistance in vitro and for complement-mediated bacterial clearance in vivo This is mediated, in part, through a novel mechanism by which murein lipoprotein affects the proper assembly of a key component of the machinery involved in production of "group 2" capsules. The absence of murein lipoprotein results in impaired production of the capsule layer, a known participant in complement resistance. These results demonstrate an important role for

Mechanism and Therapy for the Shared Susceptibility to Migraine and Epilepsy after Traumatic Brain Injury (TBI)

Science.gov (United States)

2013-10-01

and 7 days post injury time point. Figure 20 shows the typical lesion pattern following our protocol. Figure 21 shows Nissl stain at different...diameter. Figure 21. Light microscopy images of Nissl stain displaying lesion area 1 week following impact in WT (Stat3-LoxP) and KO (Stat3-LoxP-Cre...cryoprotectant solution pending further processing. Every third section was collected to quantify infarct volumes using cresyl violet ( Nissl ) stain (Ohab et

Therapist competencies necessary for the delivery of compassion-focused therapy: A Delphi study.

Science.gov (United States)

Liddell, Alice E; Allan, Steven; Goss, Ken

2017-06-01

Compassion-focused therapy (CFT) has shown promising results for a range of clinical presentations. This study explored the therapeutic competencies required to deliver CFT and organized these into a coherent framework. The Delphi method was used to explore and refine competencies for delivering CFT in three rounds of data collection. The first round involved interviews with 12 experts in CFT. Data were analysed using template analysis to generate a draft competency framework. The main competencies were used to create a survey for rounds two and three involving CFT experts and practitioners. Data collected from the surveys were used to refine the competencies. The CFT competency framework (CFT-CF) that was produced comprised 25 main competencies within six key areas of competence. The areas were as follows: competencies in creating safeness, meta-skills, non-phase-specific skills, phase-specific skills, knowledge and understanding and use of supervision. The main competencies included several subcompetencies specifying knowledge, skills and attributes needed to demonstrate the main competence. Overall, there was consensus on 14 competencies and 20 competencies exceeded an 80% agreement level. Some of the CFT competencies overlapped with existing therapies, whilst others were specific to CFT. The CFT-CF provides useful guidance for clinicians, supervisors and training programmes. Further research could develop the CFT-CF into a therapist rating scale in order to measure the outcome of training and to assess treatment fidelity in clinical trials. The compassion-focused therapy competency framework (CFT-CF) identifies therapeutic competencies that overlap with existing treatments as well as those specific to compassion-focused therapy (CFT). The CFT-CF builds guidance for the competencies required to deliver CFT in a range of clinical settings. The CFT-CF provides guidance for those training CFT therapists. The CFT-CF could be used as a basis to develop a therapist

Synchrotron X-radiation topography studies of the magnetization process in Tbsub(0.27) Dysub(0.73) Fe2

International Nuclear Information System (INIS)

Clark, G.F.; Tanner, B.K.

1982-01-01

The domain structure changes occurring during magnetization of a (110) oriented disc of Tbsub(0.27) Dysub(0.73) Fe 2 have been studied by synchrotron X-radiation topography. Despite there being two easy directions in the specimen surface the commonest demagnetized configuration consisted of 71 0 walls on (001) between domains magnetized parallel to [111] and [1 bar 1 1], or [1 bar 1 1] and [1 bar 1 bar 1 1], etc. In each case one direction is inclined to the specimen surface and the configuration would appear to be somewhat unfavourable magnetostatically. Domain-wall energy calculations are presented for many possible wall geometries in the easy system, including magneto-elastic terms in the wall energy. These show that the 71 0 (001) walls have a very low wall energy. During magnetization in a field applied along principal crystallographic directions in the surface, a structure of skew 109 0 walls formed in low fields. This structure, between domains both magnetized in directions inclined to the surface, and having equal components of magnetization in the specimen plane, is immobile and does not move in the highest fields available. This explains the slow approach to saturation, following an initial rapid rise, observed in bulk magnetization experiments. (author)

Optogenetic Activation of the Sublaterodorsal (SLD) Nucleus Induces Rapid Muscle Inhibition

Science.gov (United States)

2015-09-01

followed by 10% formalin with 15% sucrose, for cryoprotection. Brains were sectioned at 40 µm and tissue stained for Nissl and green fluorescent...injection location Figure 6A: A coronal brain section from rat CG4: The blue Nissl stain highlights neuronal cell bodies, while the darker black is an...coronal brain section from rat CG3: The blue Nissl stain highlights neuronal cell bodies, while the darker black is an anti-GFP stain to determine

Impact of the Gate Width of Al0.27Ga0.73N/AlN/Al0.04Ga0.96N/GaN HEMT on Its Characteristics

Directory of Open Access Journals (Sweden)

Liwei Jin

2013-01-01

Full Text Available This paper presents impact of layout sizes of Al0.27Ga0.73N/AlN/Al0.04Ga0.96N/GaN HEMT heterostructure high-mobility transistors (HEMTs on SiC substrate on its characteristics that include the threshold voltage, the maximum transconductance, characteristic frequency, and the maximum oscillation frequency. The changing parameters include the gate finger number, the gate width per finger. The measurement results based on common-source devices demonstrate that the above parameters have different effects on the threshold voltage, maximum transconductance, and frequency characteristics.

Flight Determination of the Longitudinal Stability Characteristics of a 0.133-Scale Rocket-Powered Model of the Consolidated Vultee XFY-1 Airplane without Propellers at Mach Numbers from 0.73 to 1.19, TED No. NACA DE 369

Science.gov (United States)

Hastings, Earl E., Jr.; Mitcham, Grady L.

1954-01-01

A flight test has been conducted to determine the longitudinal stability and control,characteristics of a 0.133-scale model of the Consolidated Vultee XFY-1 airplane without propellers for the Mach number range between 0.73 and 1.19.

Synthesis, crystal structure determination, thermal and magnetic properties of the new Cu{sub 0.73}Ni{sub 0.27}(HSeO{sub 3}){sub 2} compound

Energy Technology Data Exchange (ETDEWEB)

Hentech, I., E-mail: hentechimen@yahoo.fr [Laboratoire des Sciences des Matériaux et de l' Environnement, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); CMTR, ICMPE, UMR7182, CNRS – Université Paris Est Créteil, 2-8 rue Henri Dunant, F-94320 Thiais (France); Zehani, K. [CMTR, ICMPE, UMR7182, CNRS – Université Paris Est Créteil, 2-8 rue Henri Dunant, F-94320 Thiais (France); Kabadou, A.; Ben Salah, A.; Loukil, M. [Laboratoire des Sciences des Matériaux et de l' Environnement, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Bessais, L. [CMTR, ICMPE, UMR7182, CNRS – Université Paris Est Créteil, 2-8 rue Henri Dunant, F-94320 Thiais (France)

2017-01-15

A novel three-dimensional Cu{sub 0.73}Ni{sub 0.27}(HSeO{sub 3}){sub 2} compound was prepared from an aqueous solution. This compound crystallizes in the monoclinic system with P2{sub 1}/n space group and with the following cell parameters: a=6.4379(3) Å; b=7.3555(3) Å; c=5.7522(3) Å; β=93.4341(1)°; V=271.90(2) Å{sup 3} and Z=2. The reported material has been structurally characterized by X-ray powder diffraction and confirmed by scanning electron microscope and energy dispersive spectroscopy (MEB/EDS) analysis. The copper/nickel atom is surrounded by an octahedron coordination of oxygen atoms from sex hydrogenoselenites anions. The presence of (HSeO{sub 3}){sup −} has been further confirmed by IR spectroscopy and this compound exhibits a phase transition at 356 K, this transition has been detected by differential scanning calorimetry and TG-DTA measurement. The magnetic property of this material was determined. The ferromagnetic ordering is further confirmed by the magnetic field dependence of the magnetization (Hysteresis loop) at 10 K. The substitution of Cu by Ni induces a ferro-paramagnetic transition at T=31 K. Field cooled (FC) and Zero field cooled (ZFC) magnetization measurements under an applied field of 100 Oe in the temperature range of 10–300 K were performed. These measurements have been resulted the blocking temperature (T{sub B}) at around 25 K. - Highlights: • A novel three-dimensional Cu{sub 0.73}Ni{sub 0.27}(HSeO{sub 3}){sub 2} compound was prepared from an aqueous solution. • Magnetic measurements reveal the occurrence of weak ferromagnetism at low temperature for this compound. • The substitution of Cu by Ni induces a ferro-paramagnetic transition at T=31 K.

Accumulation of metabolites during bacterial degradation of PAH-mixtures

Energy Technology Data Exchange (ETDEWEB)

Vila, J.; Lopez, Z.; Bauza, J.I. [Universitat de Barcelona (Spain). Department de Microbiologia; Minguillon, C. [Parc Cientific de Barcelona (ES). Institut de Recerca de Barcelona (IRB-PCB); Grifoll, M.

2003-07-01

In a previous work we identified a number of metabolites accumulated during growth in pyrene by Mycobacterium sp. AP1, and proposed a metabolic pathway for pyrene utilization. In order to confirm and complete this pathway we have isolated and identified the pyrene-degrading strains Mycobacterium sp. PGP2, CP1 and CP2. During growth on pyrene, strains AP1, PGP2, CP1 and CP2 accumulated 4,5-cis-pyrene-dihydrodiol, 4,5-phenanthrene dicarboxylic acid, 4-phenanthrene carboxylic acid, 3,4-dihydroxy-3-hydrophenanthrene-4-carboxylic acid, phthalic acid, and 6,6'-dihydroxy-2,2'-biphenyl dicarboxylic acid. Strains AP1, PGP2, CP1 and CP2 also grew on fluoranthene accumulating acenaphthenone, naphthalene-1,8-dicarboxylic acid, 9-fluorenone-1-carboxylic acid, Z-9-carboxymethylenefluorene-1-carboxylic acid and benzene-1,2,3-tricarboxylic acid. Similar metabolites were produced during growth onf fluoranthene by the Gram-positive strains CFt2 and CFt6, isolated by their capability of using this PAH as a sole source of carbon and energy. These fluoranthene-degrading strains also accumulated cis-1,9a-dihydroxy-1-hydrofluorene-9-one-8-carboxylic acid. In addition to pyrene and fluoranthene, all pyrene-degrading utilized phenanthrene as a sole source of carbon and energy, while the fluoranthene-degrading strains were unable to utilize pyrene or phenanthrene. Mycobacterium sp. AP1 acted on a wide range of PAHs, accumulating aromatic dicarboxylic acids, hydroxyacids, and ketones resulting from dioxygenation and ortho-cleavage, dioxygenation and meta-cleavage, and monooxygenation reactions. In cultures of strains AP1 and CP1 with a defined PAH-mixture only 20% removal of the parent compounds was observed. Analysis of acidic extracts showed the accumulation of the anticipated aromatic acids, suggesting that accumulation of acidic compounds could prevent further degradation of the mixture. Those results led us to isolation of strains DF11 and OH3, able to grow on the selected

Enhanced anti-proliferative efficacy of epothilone B loaded with Escherichia coli Nissle 1917 bacterial ghosts on the HeLa cells by mitochondrial pathway of apoptosis.

Science.gov (United States)

Zhu, Wenxing; Hao, Lujiang; Liu, Xinli; Orlando, Borrás-Hidalgo; Zhang, Yuyu

2018-03-20

Epothilones constitute a new class of microtubule-stabilizing anti-cancer agents with promising preclinical and clinical activity. However, its systemic application still causes some toxic side effects. To reduce these undesired effects, advanced drug delivery systems based on cell targeting carriers are needed currently. In this study, the high quality bacterial ghosts of the probiotic Escherichia coli Nissle 1917 (EcN) were prepared in a large scale and retained fully intact surface structures for specific attachment to mammalian cells. The EcN ghosts could be efficiently loaded with the low hydrophilic drug Epothilone B (Epo B) and the maximal load efficiency was approximately 2.5% (w/w). Cytotoxicity assays revealed that Epo B-ghosts exhibited enhanced anti-proliferative properties on the HeLa cells. The Epo B associated with EcN ghosts was more cytotoxic at least 10 times than the free Epo B at the same concentrations. Apoptosis assays showed that both Epo B-ghosts and free Epo B induced time course-dependent apoptosis and necrosis in HeLa cells, respectively. While the former induced more apoptosis and necrosis than the latter. Furthermore, the cytochrome C release and the activation of caspase-3 were more remarkable after treatment with the Epo B-ghosts compared to the free Epo B, which implied that Epo B-ghosts might more effectively induce the apoptosis mediated by mitochondrial pathway in HeLa cells. Therefore, the higher anti-proliferative effects of the Epo B-ghosts on the HeLa cells were mediated by mitochondrial pathway of apoptosis. The EcN ghosts may provide a useful drug delivery carrier for drug candidates in cancer therapy.

Ex vivo intestinal adhesion of Escherichia coli LF82 in Crohn's disease

DEFF Research Database (Denmark)

Jensen, Stina Rikke; Fink, Lisbeth Nielsen; Nielsen, Ole Haagen

2011-01-01

Adherent-invasive Escherichia coli (AIEC) are reported to inhabit the gut mucosa in Crohn's disease (CD), however, little is known about the importance of host factors for the interplay between AIEC and the human gut. To examine if differences in bacterial adhesion patterns are disease associated......, the AIEC-prototype strain LF82 was evaluated for its ability to adhere to ileal and colonic biopsies from CD and healthy controls (HC). Moreover, the efficacy of the non-pathogenic E. coli Nissle 1917 (ECN) in averting LF82 adhesion to ileal mucosa was assessed. Similar numbers of LF82 adhered to biopsies...

Fluoro jade-C staining in the assessment of brain injury after deep hypothermia circulatory arrest.

Science.gov (United States)

Wang, Ren; Ma, Wei-Guo; Gao, Guo-Dong; Mao, Qun-Xia; Zheng, Jun; Sun, Li-Zhong; Liu, Ying-Long

2011-02-04

To evaluate the efficacy of Fluoro Jade-C staining (FJC) in the assessment of brain injury after deep hypothermia circulatory arrest (DHCA). Six healthy adult miniature male pigs underwent DHCA, the rectal temperature was down to 18°C, circulation was stopped , circulatory arrest was maintained for 60 minutes. On postoperative day 1, perfusion-fixation was performed on brain tissue. Cerebral cortex, hippocampus, cerebellum were taken for sampling. FJC, hematoxylin-eosin staining (HE), nissl staining (NISSL), terminal deoxynucleotidyl transferase biotin-dUTP nick end labeling (TUNEL) were performed to detect the histological and pathological changes. Histological scores of all slices were ranked. Comparison between the FJC and other techniques was done by analysis of variance (ANOVA) according to histological scores. All animals survived the operation. On the cerebral cortex, in comparison of FJC between HE, NISSL and TUNEL, the p value was 0.90, 0.40, 0.16 respectively (p>0.05). On the hippocampus, the comparison of FJC with HE, NISSL and TUNEL had a p value of 0.12, 0.23, 0.62 respectively (p>0.05). On the cerebellum, in comparing FJC with HE, NISSL and TUNEL, the p value was 0.96, 0.77, 0.96 respectively (p>0.05). On representative regions, the results of FJC were in accordance with that of TUNEL, NISSL and HE. Furthermore, ascertainment of brain injury is easier with FJC. FJC is a reliable and convenient method to assess brain injury after DHCA. Copyright © 2010 Elsevier B.V. All rights reserved.

Colonization by non-pathogenic bacteria alters mRNA expression of cytochromes P450 in originally germ-free mice.

Science.gov (United States)

Jourová, L; Anzenbacher, P; Lišková, B; Matušková, Z; Hermanová, P; Hudcovic, T; Kozáková, H; Hrnčířová, L; Anzenbacherová, E

2017-11-01

Gut microbiota provides a wide range of beneficial function for the host and has an immense effect on the host's health state. It has also been shown that gut microbiome is often involved in the biotransformation of xenobiotics; however, the molecular mechanisms of the interaction between the gut bacteria and the metabolism of drugs by the host are still unclear. To investigate the effect of microbial colonization on messenger RNA (mRNA) expression of liver cytochromes P450 (CYPs), the main drug-metabolizing enzymes, we used germ-free (GF) mice, lacking the intestinal flora and mice monocolonized by non-pathogenic bacteria Lactobacillus plantarum NIZO2877 or probiotic bacteria Escherichia coli Nissle 1917 compared to specific pathogen-free (SPF) mice. Our results show that the mRNA expression of Cyp1a2 and Cyp2e1 was significantly increased, while the expression of Cyp3a11 mRNA was decreased under GF conditions compared to the SPF mice. The both bacteria L. plantarum NIZO2877 and E. coli Nissle 1917 given to the GF mice decreased the level of Cyp1a2 mRNA and normalized it to the control level. On the other hand, the colonization by these bacteria had no effect on the expression of Cyp3a11 mRNA in the liver of the GF mice (which remained decreased). Surprisingly, monocolonization with chosen bacterial strains has shown a different effect on the expression of Cyp2e1 mRNA in GF mice. Increased level of Cyp2e1 expression observed in the GF mice was found also in mice colonized by L. plantarum NIZO2877 ; however, the colonization with probiotic E. coli Nissle 1917 caused a decrease in Cyp2e1 expression and partially restored the SPF mice conditions.

Decreasing ammonia inhibition in thermophilic methanogenic bioreactors using carbon fiber textiles.

Science.gov (United States)

Sasaki, Kengo; Morita, Masahiko; Hirano, Shin-ichi; Ohmura, Naoya; Igarashi, Yasuo

2011-05-01

Ammonia accumulation is one of the main causes of the loss of methane production observed during fermentation. We investigated the effect of addition of carbon fiber textiles (CFT) to thermophilic methanogenic bioreactors with respect to ammonia tolerance during the process of degradation of artificial garbage slurry, by comparing the performance of the reactors containing CFT with the performance of reactors without CFT. Under total ammonia-N concentrations of 3,000 mg L(-1), the reactors containing CFT were found to mediate stable removal of organic compounds and methane production. Under these conditions, high levels of methanogenic archaea were retained at the CFT, as determined by 16S rRNA gene analysis for methanogenic archaea. In addition, Methanobacterium sp. was found to be dominant in the suspended fraction, and Methanosarcina sp. was dominant in the retained fraction of the reactors with CFT. However, the reactors without CFT had lower rates of removal of organic compounds and production of methane under total ammonia-N concentrations of 1,500 mg L(-1). Under this ammonia concentration, a significant accumulation of acetate was observed in the reactors without CFT (130.0 mM), relative to the reactors with CFT (4.2 mM). Only Methanobacterium sp. was identified in the reactors without CFT. These results suggest that CFT enables stable proliferation of aceticlastic methanogens by preventing ammonia inhibition. This improves the process of stable garbage degradation and production of methane in thermophilic bioreactors that include high levels of ammonia.

Waxholm space: an image-based reference for coordinating mouse brain research.

Science.gov (United States)

Johnson, G Allan; Badea, Alexandra; Brandenburg, Jeffrey; Cofer, Gary; Fubara, Boma; Liu, Song; Nissanov, Jonathan

2010-11-01

We describe an atlas of the C57BL/6 mouse brain based on MRI and conventional Nissl histology. Magnetic resonance microscopy was performed on a total of 14 specimens that were actively stained to enhance tissue contrast. Images were acquired with three different MR protocols yielding contrast dependent on spin lattice relaxation (T1), spin spin relaxation (T2), and magnetic susceptibility (T2*). Spatial resolution was 21.5 mum (isotropic). Conventional histology (Nissl) was performed on a limited set of these same specimens and the Nissl images were registered (3D-to-3D) to the MR data. Probabilistic atlases for 37 structures are provided, along with average atlases. The availability of three different MR protocols, the Nissl data, and the labels provides a rich set of options for registration of other atlases to the same coordinate system, thus facilitating data-sharing. All the data is available for download via the web. Copyright 2010 Elsevier Inc. All rights reserved.

A strain gauge

DEFF Research Database (Denmark)

2016-01-01

The invention relates to a strain gauge of a carrier layer and a meandering measurement grid positioned on the carrier layer, wherein the strain gauge comprises two reinforcement members positioned on the carrier layer at opposite ends of the measurement grid in the axial direction....... The reinforcement members are each placed within a certain axial distance to the measurement grid with the axial distance being equal to or smaller than a factor times the grid spacing. The invention further relates to a multi-axial strain gauge such as a bi-axial strain gauge or a strain gauge rosette where each...... of the strain gauges comprises reinforcement members. The invention further relates to a method for manufacturing a strain gauge as mentioned above....

Development of intra-strain self-cloning procedure for breeding baker's yeast strains.

Science.gov (United States)

Nakagawa, Youji; Ogihara, Hiroyuki; Mochizuki, Chisato; Yamamura, Hideki; Iimura, Yuzuru; Hayakawa, Masayuki

2017-03-01

Previously reported self-cloning procedures for breeding of industrial yeast strains require DNA from other strains, plasmid DNA, or mutagenesis. Therefore, we aimed to construct a self-cloning baker's yeast strain that exhibits freeze tolerance via an improved self-cloning procedure. We first disrupted the URA3 gene of a prototrophic baker's yeast strain without the use of any marker gene, resulting in a Δura3 homozygous disruptant. Then, the URA3 gene of the parental baker's yeast strain was used as a selection marker to introduce the constitutive TDH3 promoter upstream of the PDE2 gene encoding high-affinity cyclic AMP phosphodiesterase. This self-cloning procedure was performed without using DNA from other Saccharomyces cerevisiae strains, plasmid DNA, or mutagenesis and was therefore designated an intra-strain self-cloning procedure. Using this self-cloning procedure, we succeeded in producing self-cloning baker's yeast strains that harbor the TDH3p-PDE2 gene heterozygously and homozygously, designated TDH3p-PDE2 hetero and TDH3p-PDE2 homo strains, respectively. These self-cloning strains expressed much higher levels of PDE2 mRNA than the parental strain and exhibited higher viability after freeze stress, as well as higher fermentation ability in frozen dough, when compared with the parental strain. The TDH3p-PDE2 homo strain was genetically more stable than the TDH3p-PDE2 hetero strain. These results indicate that both heterozygous and homozygous strains of self-cloning PDE2-overexpressing freeze-tolerant strains of industrial baker's yeast can be prepared using the intra-strain self-cloning procedure, and, from a practical viewpoint, the TDH3p-PDE2 homo strain constructed in this study is preferable to the TDH3p-PDE2 hetero strain for frozen dough baking. Copyright © 2016 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

Lactobacillus acidophilus induces virus immune defence genes in murine dendritic cells by a Toll-like receptor-2-dependent mechanism

DEFF Research Database (Denmark)

Weiss, Gudrun Margarethe; Rasmussen, Simon; Hjerrild Zeuthen, L.

2010-01-01

Lactobacilli are probiotics that, among other health-promoting effects, have been ascribed immunostimulating and virus-preventive properties. Certain Lactobacillus spp. have been shown to possess strong interleukin-12 (IL-12) -inducing properties. As IL-12 production depends on the up......-regulation of type I interferons (IFNs), we hypothesized that the strong IL-12-inducing capacity of Lactobacillus acidophilus NCFM in murine bone-marrow-derived dendritic cells (DCs) is caused by an up-regulation of IFN-beta, which subsequently induces IL-12 and the double-stranded RNA binding Toll-like receptor-3...... detected in another L. acidophilus strain (X37), but was not a property of other probiotic strains tested, i.e. Bifidobacterium bifidum Z9 and Escherichia coli Nissle 1917. The IFN-beta expression was markedly reduced in TLR-2(-/-) DCs, dependent on endocytosis, and the major cause of the induction of Il...

Repeated administration of phytocannabinoid Δ(9)-THC or synthetic cannabinoids JWH-018 and JWH-073 induces tolerance to hypothermia but not locomotor suppression in mice, and reduces CB1 receptor expression and function in a brain region-specific manner.

Science.gov (United States)

Tai, S; Hyatt, W S; Gu, C; Franks, L N; Vasiljevik, T; Brents, L K; Prather, P L; Fantegrossi, W E

2015-12-01

These studies probed the relationship between intrinsic efficacy and tolerance/cross-tolerance between ∆(9)-THC and synthetic cannabinoid drugs of abuse (SCBs) by examining in vivo effects and cellular changes concomitant with their repeated administration in mice. Dose-effect relationships for hypothermic effects were determined in order to confirm that SCBs JWH-018 and JWH-073 are higher efficacy agonists than ∆(9)-THC in mice. Separate groups of mice were treated with saline, sub-maximal hypothermic doses of JWH-018 or JWH-073 (3.0mg/kg or 10.0mg/kg, respectively) or a maximally hypothermic dose of 30.0mg/kg ∆(9)-THC once per day for 5 consecutive days while core temperature and locomotor activity were monitored via biotelemetry. Repeated administration of all drugs resulted in tolerance to hypothermic effects, but not locomotor effects, and this tolerance was still evident 14 days after the last drug administration. Further studies treated mice with 30.0mg/kg ∆(9)-THC once per day for 4 days, then tested with SCBs on day 5. Mice with a ∆(9)-THC history were cross-tolerant to both SCBs, and this cross-tolerance also persisted 14 days after testing. Select brain regions from chronically treated mice were examined for changes in CB1 receptor expression and function. Expression and function of hypothalamic CB1Rs were reduced in mice receiving chronic drugs, but cortical CB1R expression and function were not altered. Collectively, these data demonstrate that repeated ∆(9)-THC, JWH-018 and JWH-073 can induce long-lasting tolerance to some in vivo effects, which is likely mediated by region-specific downregulation and desensitization of CB1Rs. Copyright © 2015 Elsevier Ltd. All rights reserved.

Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels

Energy Technology Data Exchange (ETDEWEB)

Bintu, Alexandra [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Vincze, Gabriela, E-mail: gvincze@ua.pt [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Picu, Catalin R. [Department of Mechanical, Aerospace and Nuclear Engineering, Rensselaer Polytechnic Institute, Troy, NY 12180 (United States); Lopes, Augusto B. [CICECO, Department of Materials and Ceramic Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Grácio, Jose J. [TEMA, Department of Mechanical Engineering, University of Aveiro, Campus Universitário de Santiago, 3810-193 (Portugal); Barlat, Frederic [Materials Mechanics Laboratory, Graduate Institute of Ferrous Technology, Pohang University of Science and Technology, Pohang 790-784 (Korea, Republic of)

2015-04-01

TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS.

Strain hardening rate sensitivity and strain rate sensitivity in TWIP steels

International Nuclear Information System (INIS)

Bintu, Alexandra; Vincze, Gabriela; Picu, Catalin R.; Lopes, Augusto B.; Grácio, Jose J.; Barlat, Frederic

2015-01-01

TWIP steels are materials with very high strength and exceptional strain hardening capability, parameters leading to large energy absorption before failure. However, TWIP steels also exhibit reduced (often negative) strain rate sensitivity (SRS) which limits the post-necking deformation. In this study we demonstrate for an austenitic TWIP steel with 18% Mn a strong dependence of the twinning rate on the strain rate, which results in negative strain hardening rate sensitivity (SHRS). The instantaneous component of SHRS is large and negative, while its transient is close to zero. The SRS is observed to decrease with strain, becoming negative for larger strains. Direct observations of the strain rate dependence of the twinning rate are made using electron microscopy and electron backscatter diffraction, which substantiate the proposed mechanism for the observed negative SHRS

Variation in the strain anisotropy of Zircaloy with temperature and strain

International Nuclear Information System (INIS)

Hindle, E.D.; Worswick, D.

1984-04-01

Strain anisotropy was investigated at temperatures in the range 293 to 1117K in circular tensile specimens prepared from rolled Zircaloy-2 plate so that their tensile axes were parallel to and transverse to the rolling direction. The strain anisotropy factor for both types of specimen increased markedly in the high alpha phase region above 923K reaching a maximum at circa 1070K. Above this temperature in the alpha-plus-beta phase region the strain anisotropy decreased rapidly as the proportion of beta phase increased and was almost non-existent at 1173K. The strain anisotropy was markedly strain dependent, particularly in the high alpha phase region. The study was extended to Zircaloy-4 pressurized water reactor (PWR) 17 x 17 type fuel rod tubing specimens which were strained under biaxial conditions using cooling conditions which promoted uniform diametral strain over most of their lengths (circa 250 mm). In these circumstances the strain anisotropy is manifest by a reduction in length. Measurement of this change along with that in diameter and wall thickness produced data from which the strain anisotropy factor was calculated. The results, although influenced by additional factors discussed in the paper, were similar to those observed in the uniaxial Zircaloy-2 tensile tests. (author)

Haemophilus ducreyi Cutaneous Ulcer Strains Are Nearly Identical to Class I Genital Ulcer Strains.

Directory of Open Access Journals (Sweden)

Dharanesh Gangaiah

Full Text Available Although cutaneous ulcers (CU in the tropics is frequently attributed to Treponema pallidum subspecies pertenue, the causative agent of yaws, Haemophilus ducreyi has emerged as a major cause of CU in yaws-endemic regions of the South Pacific islands and Africa. H. ducreyi is generally susceptible to macrolides, but CU strains persist after mass drug administration of azithromycin for yaws or trachoma. H. ducreyi also causes genital ulcers (GU and was thought to be exclusively transmitted by microabrasions that occur during sex. In human volunteers, the GU strain 35000HP does not infect intact skin; wounds are required to initiate infection. These data led to several questions: Are CU strains a new variant of H. ducreyi or did they evolve from GU strains? Do CU strains contain additional genes that could allow them to infect intact skin? Are CU strains susceptible to azithromycin?To address these questions, we performed whole-genome sequencing and antibiotic susceptibility testing of 5 CU strains obtained from Samoa and Vanuatu and 9 archived class I and class II GU strains. Except for single nucleotide polymorphisms, the CU strains were genetically almost identical to the class I strain 35000HP and had no additional genetic content. Phylogenetic analysis showed that class I and class II strains formed two separate clusters and CU strains evolved from class I strains. Class I strains diverged from class II strains ~1.95 million years ago (mya and CU strains diverged from the class I strain 35000HP ~0.18 mya. CU and GU strains evolved under similar selection pressures. Like 35000HP, the CU strains were highly susceptible to antibiotics, including azithromycin.These data suggest that CU strains are derivatives of class I strains that were not recognized until recently. These findings require confirmation by analysis of CU strains from other regions.

Factors affecting finite strain estimation in low-grade, low-strain clastic rocks

Science.gov (United States)

Pastor-Galán, Daniel; Gutiérrez-Alonso, Gabriel; Meere, Patrick A.; Mulchrone, Kieran F.

2009-12-01

The computer strain analysis methods SAPE, MRL and DTNNM have permitted the characterization of finite strain in two different regions with contrasting geodynamic scenarios; (1) the Talas Ala Tau (Tien Shan, Kyrgyzs Republic) and (2) the Somiedo Nappe and Narcea Antiform (Cantabrian to West Asturian-Leonese Zone boundary, Variscan Belt, NW of Iberia). The performed analyses have revealed low-strain values and the regional strain trend in both studied areas. This study also investigates the relationship between lithology (grain size and percentage of matrix) and strain estimates the two methodologies used. The results show that these methods are comparable and the absence of significant finite strain lithological control in rocks deformed under low metamorphic and low-strain conditions.

Black Holes Versus Firewalls and Thermo-Field Dynamics

Science.gov (United States)

Chowdhury, Borun D.

2013-09-01

In this paper, we examine the implications of the ongoing black holes versus firewalls debate for the thermo-field dynamics of black holes by analyzing a conformal field theory (CFT) in a thermal state in the context of anti-de Sitter/CFT. We argue that the thermo-field doubled copy of the thermal CFT should be thought of not as a fictitious system, but as the image of the CFT in the heat bath. In case of strong coupling between the CFT and the heat bath, this image allows for free infall through the horizon and the system is described by a black hole. Conversely, firewalls are the appropriate dual description in case of weak interaction of the CFT with its heat bath.

Strong coupling results in the AdS{sub 5}/CFT{sub 4} correspondence from the numerical solution of the quantum spectral curve

Energy Technology Data Exchange (ETDEWEB)

Hegedűs, Árpád; Konczer, József [MTA Lendület Holographic QFT Group, Wigner Research Centre,H-1525 Budapest 114, P.O.B. 49 (Hungary)

2016-08-09

In this paper, we solved numerically the Quantum Spectral Curve (QSC) equations corresponding to some twist-2 single trace operators with even spin from the sl(2) sector of AdS{sub 5}/CFT{sub 4} correspondence. We describe all technical details of the numerical method which are necessary to implement it in C++ language. In the S=2,4,6,8 cases, our numerical results confirm the analytical results, known in the literature for the first 4 coefficients of the strong coupling expansion for the anomalous dimensions of twist-2 operators. In the case of the Konishi operator, due to the high precision of the numerical data we could give numerical predictions to the values of two further coefficients, as well. The strong coupling behaviour of the coefficients c{sub a,n} in the power series representation of the P {sub a}-functions is also investigated. Based on our numerical data, in the regime, where the index of the coefficients is much smaller than λ{sup 1/4}, we conjecture that the coefficients have polynomial index dependence at strong coupling. This allows one to propose a strong coupling series representation for the P-functions being valid far enough from the real short cut. In the paper the qualitative strong coupling behaviour of the P-functions at the branch points is also discussed.

Stress-strain properties of railway steel at strain rates of upto 105 per second

International Nuclear Information System (INIS)

Hashmi, M.S.J.; Islam, M.N.

1985-01-01

This paper presents the stress-strain characteristics of railway steel at strain rates of up to 10 5 /s at room temperature determined by a new technique. In determining the results, account has been taken of the strain-rate variation, the total strain and the strain rate history. The effect of friction, material inertia and temperature rise is also assessed and an empirical constitutive equation describing the strain-rate and strain sensitive flow stress for this type of steel is proposed. (orig.)

Comparison of Thermal Creep Strain Calculation Results Using Time Hardening and Strain Hardening Rules

International Nuclear Information System (INIS)

Kim, Junehyung; Cheon, Jinsik; Lee, Byoungoon; Lee, Chanbock

2014-01-01

One of the design criteria for the fuel rod in PGSFR is the thermal creep strain of the cladding, because the cladding is exposed to a high temperature for a long time during reactor operation period. In general, there are two kind of calculation scheme for thermal creep strain: time hardening and strain hardening rules. In this work, thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules are compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule are compared with those by using MACSIS. Thermal creep strain calculation results for HT9 cladding by using time hardening and strain hardening rules were compared by employing KAERI's current metallic fuel performance analysis code, MACSIS. Also, thermal creep strain calculation results by using ANL's metallic fuel performance analysis code, LIFE-METAL which adopts strain hardening rule were compared with those by using MACSIS. Tertiary creep started earlier in time hardening rule than in strain hardening rule. Also, calculation results by MACSIS with strain hardening and those obtained by using LIFE-METAL were almost identical to each other

Limitations of Hollomon and Ludwigson stress-strain relations in assessing the strain hardening parameters

International Nuclear Information System (INIS)

Samuel, K G

2006-01-01

It is shown that the deviation from the ideal Hollomon relation in describing the stress-strain behaviour is characteristic of all materials at low strains. The Ludwigson relation describing the deviation from the Hollomon relation at low strains is critically analysed and it is shown that the deviation at low strains is a consequence of some unknown 'plastic strain equivalent' present in the material. Stress strain curves obeying an ideal Hollomon relation as well as that of a structurally modified (prior cold worked) material were simulated and compared. The results show that the yield strength and the flow strength of a material at constant strain rate and temperature are dictated by the magnitude of the 'plastic strain equivalent' term. It is shown that this component need not necessarily mean a prior plastic strain present in the material due to prior cold work alone and that prior cold work strain will add to this. If this component is identified, the stress-strain behaviour can be adequately described by the Swift relation. It is shown that in both formalisms, the strain hardening index is a function of the yield strength of the material

Strained Silicon Photonics

Directory of Open Access Journals (Sweden)

Ralf B. Wehrspohn

2012-05-01

Full Text Available A review of recent progress in the field of strained silicon photonics is presented. The application of strain to waveguide and photonic crystal structures can be used to alter the linear and nonlinear optical properties of these devices. Here, methods for the fabrication of strained devices are summarized and recent examples of linear and nonlinear optical devices are discussed. Furthermore, the relation between strain and the enhancement of the second order nonlinear susceptibility is investigated, which may enable the construction of optically active photonic devices made of silicon.

Optimal staining methods for delineation of cortical areas and neuron counts in human brains.

Science.gov (United States)

Uylings, H B; Zilles, K; Rajkowska, G

1999-04-01

For cytoarchitectonic delineation of cortical areas in human brain, the Gallyas staining for somata with its sharp contrast between cell bodies and neuropil is preferable to the classical Nissl staining, the more so when an image analysis system is used. This Gallyas staining, however, does not appear to be appropriate for counting neuron numbers in pertinent brain areas, due to the lack of distinct cytological features between small neurons and glial cells. For cell counting Nissl is preferable. In an optimal design for cell counting at least both the Gallyas and the Nissl staining must be applied, the former staining for cytoarchitectural delineaton of cortical areas and the latter for counting the number of neurons in the pertinent cortical areas. Copyright 1999 Academic Press.

Amerindian Helicobacter pylori strains go extinct, as european strains expand their host range.

Directory of Open Access Journals (Sweden)

Maria G Domínguez-Bello

Full Text Available We studied the diversity of bacteria and host in the H. pylori-human model. The human indigenous bacterium H. pylori diverged along with humans, into African, European, Asian and Amerindian groups. Of these, Amerindians have the least genetic diversity. Since niche diversity widens the sets of resources for colonizing species, we predicted that the Amerindian H. pylori strains would be the least diverse. We analyzed the multilocus sequence (7 housekeeping genes of 131 strains: 19 cultured from Africans, 36 from Spanish, 11 from Koreans, 43 from Amerindians and 22 from South American Mestizos. We found that all strains that had been cultured from Africans were African strains (hpAfrica1, all from Spanish were European (hpEurope and all from Koreans were hspEAsia but that Amerindians and Mestizos carried mixed strains: hspAmerind and hpEurope strains had been cultured from Amerindians and hpEurope and hpAfrica1 were cultured from Mestizos. The least genetically diverse H. pylori strains were hspAmerind. Strains hpEurope were the most diverse and showed remarkable multilocus sequence mosaicism (indicating recombination. The lower genetic structure in hpEurope strains is consistent with colonization of a diversity of hosts. If diversity is important for the success of H. pylori, then the low diversity of Amerindian strains might be linked to their apparent tendency to disappear. This suggests that Amerindian strains may lack the needed diversity to survive the diversity brought by non-Amerindian hosts.

Activation of multiple chemotherapeutic prodrugs by the natural enzymolome of tumour-localised probiotic bacteria.

Science.gov (United States)

Lehouritis, Panos; Stanton, Michael; McCarthy, Florence O; Jeavons, Matthieu; Tangney, Mark

2016-01-28

Some chemotherapeutic drugs (prodrugs) require activation by an enzyme for efficacy. We and others have demonstrated the ability of probiotic bacteria to grow specifically within solid tumours following systemic administration, and we hypothesised that the natural enzymatic activity of these tumour-localised bacteria may be suitable for activation of certain such chemotherapeutic drugs. Several wild-type probiotic bacteria; Escherichia coli Nissle, Bifidobacterium breve, Lactococcus lactis and Lactobacillus species, were screened against a panel of popular prodrugs. All strains were capable of activating at least one prodrug. E. coli Nissle 1917 was selected for further studies because of its ability to activate numerous prodrugs and its resistance to prodrug toxicity. HPLC data confirmed biochemical transformation of prodrugs to their toxic counterparts. Further analysis demonstrated that different enzymes can complement prodrug activation, while simultaneous activation of multiple prodrugs (CB1954, 5-FC, AQ4N and Fludarabine phosphate) by E. coli was confirmed, resulting in significant efficacy improvement. Experiments in mice harbouring murine tumours validated in vitro findings, with significant reduction in tumour growth and increase in survival of mice treated with probiotic bacteria and a combination of prodrugs. These findings demonstrate the ability of probiotic bacteria, without the requirement for genetic modification, to enable high-level activation of multiple prodrugs specifically at the site of action. Copyright © 2015 Elsevier B.V. All rights reserved.

Guernsey; Report on Observance of Standards and Codes-FATF Recommendations for Anti-Money Laundering and Combating the Financing of Terrorism

OpenAIRE

International Monetary Fund

2011-01-01

Bailiwick of Guernsey has a Anti-Money Laundering and Combating the Financing of Terrorism (AML/CFT) legal framework that provides the basis for an AML/CFT regime. It has a program to review and enhance AML/CFT legislation and monitor effectiveness of compliance with the AML/CFT regime. Assessors found that confiscation and provisional measures within Bailiwick are robust. They also found that previous designation mechanisms had a negative impact on the effectiveness of the mutual legal assis...

Analysis of a bio-electrochemical reactor containing carbon fiber textiles for the anaerobic digestion of tomato plant residues.

Science.gov (United States)

Hirano, Shin-Ichi; Matsumoto, Norio

2018-02-01

A bio-electrochemical system packed with supporting material can promote anaerobic digestion for several types of organic waste. To expand the target organic matters of a BES, tomato plant residues (TPRs), generated year-round as agricultural and cellulosic waste, were treated using three methanogenic reactors: a continuous stirred tank reactor (CSTR), a carbon fiber textile (CFT) reactor, and a bio-electrochemical reactor (BER) including CFT with electrochemical regulation (BER + CFT). CFT had positive effects on methane fermentation and methanogen abundance. The microbial population stimulated by electrochemical regulation, including hydrogenotrophic methanogens, cellulose-degrading bacteria, and acetate-degrading bacteria, suppressed acetate accumulation, as evidenced by the low acetate concentration in the suspended fraction in the BER + CFT. These results indicated that the microbial community in the BER + CFT facilitated the efficient decomposition of TPR and its intermediates such as acetate to methane. Copyright © 2017 Elsevier Ltd. All rights reserved.

Manganese Research Health Project (MHRP)

Science.gov (United States)

2009-02-01

green nucleic acid staining further confirmed the neurotoxic effect of cadmium in this cell model (Fig 10C). Next, we examined the enzymatic activity...Quantification of Nissl bodies revealed a widespread reduction in SNpc cell numbers. Other areas of the basal ganglia were also altered by manganese as...the substantia nigra pars compacta (SNpc) following manganese treatment. Quantification of Nissl bodies revealed a widespread reduction in SNpc

Neural Plasticity and Neurorehabilitation Following Traumatic Brain Injury

Science.gov (United States)

2011-04-01

of Theresa Jones for sectioning and staining . To date, the brains have been sectioned and one set stained for Nissl . Using the Nissl stained ...three rehabilitations decreases contusion size compared to CCI-Yoked (#p=0.051). The remaining sets of brain sections have been stained with...optical densitometry, as appropriate, given staining patterns. Sample locations will be the remaining sensorimotor cortex around the injury, in the

Opioid Abuse after TBI

Science.gov (United States)

2015-09-01

analysis. Cresyl violet histochemistry Cresyl violet histological processing of tissue stains Nissl substance, which is composed mostly of rough...dried overnight before staining . Sections were dehydrated through graded alcohol to xylene for two changes of 5 min each, and then rehydrated through...four minutes, followed by differentiation in 95% ethanol with 0.2% HCl for 14    five minutes. Differentiation was timed such that both Nissl

Measurement of Strain and Strain Rate during the Impact of Tennis Ball Cores

Directory of Open Access Journals (Sweden)

Ben Lane

2018-03-01

Full Text Available The aim of this investigation was to establish the strains and strain rates experienced by tennis ball cores during impact to inform material characterisation testing and finite element modelling. Three-dimensional surface strains and strain rates were measured using two high-speed video cameras and corresponding digital image correlation software (GOM Correlate Professional. The results suggest that material characterisation testing to a maximum strain of 0.4 and a maximum rate of 500 s−1 in tension and to a maximum strain of −0.4 and a maximum rate of −800 s−1 in compression would encapsulate the demands placed on the material during impact and, in turn, define the range of properties required to encapsulate the behavior of the material during impact, enabling testing to be application-specific and strain-rate-dependent properties to be established and incorporated in finite element models.

Strain measurement based battery testing

Science.gov (United States)

Xu, Jeff Qiang; Steiber, Joe; Wall, Craig M.; Smith, Robert; Ng, Cheuk

2017-05-23

A method and system for strain-based estimation of the state of health of a battery, from an initial state to an aged state, is provided. A strain gauge is applied to the battery. A first strain measurement is performed on the battery, using the strain gauge, at a selected charge capacity of the battery and at the initial state of the battery. A second strain measurement is performed on the battery, using the strain gauge, at the selected charge capacity of the battery and at the aged state of the battery. The capacity degradation of the battery is estimated as the difference between the first and second strain measurements divided by the first strain measurement.

Strain measurement technique

International Nuclear Information System (INIS)

1987-01-01

The 10 contributions are concerned with selected areas of application, such as strain measurements in wood, rubber/metal compounds, sets of strain measurements on buildings, reinforced concrete structures without gaps, pipes buried in the ground and measurements of pressure fluctuations. To increase the availability and safety of plant, stress analyses were made on gas turbine rotors with HT-DMS or capacitive HT-DMS (high temperature strain measurements). (DG) [de

Strain expansion-reduction approach

Science.gov (United States)

Baqersad, Javad; Bharadwaj, Kedar

2018-02-01

Validating numerical models are one of the main aspects of engineering design. However, correlating million degrees of freedom of numerical models to the few degrees of freedom of test models is challenging. Reduction/expansion approaches have been traditionally used to match these degrees of freedom. However, the conventional reduction/expansion approaches are only limited to displacement, velocity or acceleration data. While in many cases only strain data are accessible (e.g. when a structure is monitored using strain-gages), the conventional approaches are not capable of expanding strain data. To bridge this gap, the current paper outlines a reduction/expansion technique to reduce/expand strain data. In the proposed approach, strain mode shapes of a structure are extracted using the finite element method or the digital image correlation technique. The strain mode shapes are used to generate a transformation matrix that can expand the limited set of measurement data. The proposed approach can be used to correlate experimental and analytical strain data. Furthermore, the proposed technique can be used to expand real-time operating data for structural health monitoring (SHM). In order to verify the accuracy of the approach, the proposed technique was used to expand the limited set of real-time operating data in a numerical model of a cantilever beam subjected to various types of excitations. The proposed technique was also applied to expand real-time operating data measured using a few strain gages mounted to an aluminum beam. It was shown that the proposed approach can effectively expand the strain data at limited locations to accurately predict the strain at locations where no sensors were placed.

Rat Strain Ontology: structured controlled vocabulary designed to facilitate access to strain data at RGD.

Science.gov (United States)

Nigam, Rajni; Munzenmaier, Diane H; Worthey, Elizabeth A; Dwinell, Melinda R; Shimoyama, Mary; Jacob, Howard J

2013-11-22

The Rat Genome Database (RGD) ( http://rgd.mcw.edu/) is the premier site for comprehensive data on the different strains of the laboratory rat (Rattus norvegicus). The strain data are collected from various publications, direct submissions from individual researchers, and rat providers worldwide. Rat strain, substrain designation and nomenclature follow the Guidelines for Nomenclature of Mouse and Rat Strains, instituted by the International Committee on Standardized Genetic Nomenclature for Mice. While symbols and names aid in identifying strains correctly, the flat nature of this information prohibits easy search and retrieval, as well as other data mining functions. In order to improve these functionalities, particularly in ontology-based tools, the Rat Strain Ontology (RS) was developed. The Rat Strain Ontology (RS) reflects the breeding history, parental background, and genetic manipulation of rat strains. This controlled vocabulary organizes strains by type: inbred, outbred, chromosome altered, congenic, mutant and so on. In addition, under the chromosome altered category, strains are organized by chromosome, and further by type of manipulations, such as mutant or congenic. This allows users to easily retrieve strains of interest with modifications in specific genomic regions. The ontology was developed using the Open Biological and Biomedical Ontology (OBO) file format, and is organized on the Directed Acyclic Graph (DAG) structure. Rat Strain Ontology IDs are included as part of the strain report (RS: ######). As rat researchers are often unaware of the number of substrains or altered strains within a breeding line, this vocabulary now provides an easy way to retrieve all substrains and accompanying information. Its usefulness is particularly evident in tools such as the PhenoMiner at RGD, where users can now easily retrieve phenotype measurement data for related strains, strains with similar backgrounds or those with similar introgressed regions. This

The process and risk of the CPR1000 cold function test in the cold area

International Nuclear Information System (INIS)

Liu Tinghao; Zhang Jian; Ji Dapeng; Shi Quanjian; Tian Kuo

2014-01-01

Hong yanhe nuclear power station is the first CPR1000 reactor which is under construction in the cold area of north China. It is also the first time to carry out the cold functional test (CFT) in the winter of north China. The preparation and process of CFT are described in the paper. According to the experience feedback of CFT of Unit 1, the risk and solution which are significance for the CFT of the other NPS in the cold area are analysed. (authors)

Variation in the strain anisotropy of Zircaloy with temperature and strain

International Nuclear Information System (INIS)

Hindle, E.D.; Worswick, D.

1984-01-01

The strong crystallographic texture which is developed during the fabrication of zirconium-based alloys causes pronounced anisotropy in their mechanical properties, particularly deformation. The tendency for circular-section tension specimens with a high concentration of basal poles in one direction to become elliptical when deformed in tension has been used in this study to provide quantitative data on the effects of both strain and temperature on strain anisotropy. Tension tests were carried out over a temperature range of 293 to 1193 K on specimens machined from Zircaloy-2 plate. The strain anisotropy was found to increase markedly at temperatures over 923 K, reaching a maximum in the region of 1070 K. The strain anisotropy increased with increasing strain in this temperature region. The study was extended to Zircaloy-4 pressurized-water reactor fuel cladding by carrying out tube swelling tests and evaluating the axial deformation produced. Although scatter in the test results was higher than that exhibited in the tension tests, the general trend in the data was similar. The effects of the strain anisotropy observed are discussed in relation to the effects of temperature on the ductility of Zircaloy fuel cladding tubes during postulated largebreak loss-of-coolant accidents

Three dimensional strained semiconductors

Science.gov (United States)

Voss, Lars; Conway, Adam; Nikolic, Rebecca J.; Leao, Cedric Rocha; Shao, Qinghui

2016-11-08

In one embodiment, an apparatus includes a three dimensional structure comprising a semiconductor material, and at least one thin film in contact with at least one exterior surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the three dimensional structure. In another embodiment, a method includes forming a three dimensional structure comprising a semiconductor material, and depositing at least one thin film on at least one surface of the three dimensional structure for inducing a strain in the structure, the thin film being characterized as providing at least one of: an induced strain of at least 0.05%, and an induced strain in at least 5% of a volume of the structure.

Vision Integrating Strategies in Ophthalmology and Neurochemistry (VISION)

Science.gov (United States)

2012-02-01

stained optic nerve cross sections. Retinal ganglion cell and superior colliculus damage was assessed by Nissl stain cell counts. Intravitreal...and potential neuroprotective effects were analyzed from 0-42 days post ONC. Cells in the retinal ganglion cell layer of Nissl stained retinal flat...brain region innervated by RGC axons. There was a progressive loss of neuronal volume assessed by black-gold staining of coronal sections through the

Stimulation of Central A1 Adenosine Receptors Suppresses Seizure and Neuropathology in a Soman Nerve Agent Seizure Rat Model

Science.gov (United States)

2014-05-22

implantation site, Nissl stained , and then analyzed by a trained pathologist to verify the accuracy of cannulae placement and evaluate toxicity. The second...transcardial perfusion and fixation, the brains were sectioned and stained with Nissl . A trained pathologist then analyzed the sections and verified that CPA...proto- col was used for assessing neuropathology in the subsequent soman seizure experiments. Those brains were serial sec- tioned at 5 mm, stained

Hamstring strain - aftercare

Science.gov (United States)

Pulled hamstring muscle; Sprain - hamstring ... There are 3 levels of hamstring strains: Grade 1 -- mild muscle strain or pull Grade 2 -- partial muscle tear Grade 3 -- complete muscle tear Recovery time depends ...

Strain-Modulated Epitaxy

National Research Council Canada - National Science Library

Brown, April

1999-01-01

Strain-Modulated Epitaxy (SME) is a novel approach, invented at Georgia Tech, to utilize subsurface stressors to control strain and therefore material properties and growth kinetics in the material above the stressors...

In vivo labeling of cocaine receptors with 3H-(-) cocaine, 3H-WIN 35,065-2 and 3H-WIN 35,428

International Nuclear Information System (INIS)

Scheffel, U.; Boja, J.W.; Stathis, M.; Kuhar, M.J.

1990-01-01

11 C-(-)cocaine (-COC) has recently been employed to image -COC binding sites in vivo using PET. Two analogs of -COC, WIN 35,065-2 (WIN-2) and WIN 35,428 (CFT), have been shown in vitro to exhibit higher affinity for the -COC receptor than -COC. The present study evaluates 3 H-WIN-2 and 3 H-CFT as in vivo receptor labels in mice with a view towards the use of these compounds as PET ligands for -COC receptors in the living human brain. 3 H-labeled -COC, WIN-2 and CFT were injected i.v. into mice and their specific binding in the CNS determined. Peak striatal/cerebellar (S/C) ratios were reached at 5 minutes post injection with -COC (1.56), at 45 minutes with 3 H-WIN-2 (3.30) and 60 minutes with 3 H-CFT (4.0). The specificity of in vivo binding of 3 H-WIN-2 and 3 H-CFT was tested by pre-injection of various drugs. Binding of 3 H-WIN-2 and 3 H-CFT was dose-dependently blocked by cold WIN-2 and CFT, and by dopamine uptake site inhibitors (mazindol, GBR 12,909, nomifensine), but not by (+)COC, paroxetine and desipramine. The data indicate that 3 H-WIN-2 and 3 H-CFT exhibit improved in vivo binding (higher S/C ratios, longer retention time at the -COC receptor/dopamine transporter) compared to -COC and support their testing in PET studies

Methodology to measure strains at high temperatures using electrical strain gages with free filaments

International Nuclear Information System (INIS)

Atanazio Filho, Nelson N.; Gomes, Paulo T. Vida; Scaldaferri, Denis H.B.; Silva, Luiz L. da; Rabello, Emerson G.; Mansur, Tanius R.

2013-01-01

An experimental methodology used for strains measuring at high temperatures is show in this work. In order to do the measurements, it was used electric strain gages with loose filaments attached to a stainless steel 304 beam with specific cements. The beam has triangular shape and a constant thickness, so the strain is the same along its length. Unless the beam surface be carefully prepared, the strain gage attachment is not efficient. The showed results are for temperatures ranging from 20 deg C to 300 deg C, but the experimental methodology could be used to measure strains at a temperature up to 900 deg C. Analytical calculations based on solid mechanics were used to verify the strain gage electrical installation and the measured strains. At a first moment, beam deformations as a temperature function were plotted. After that, beam deformations with different weighs were plotted as a temperature function. The results shown allowed concluding that the experimental methodology is trustable to measure strains at temperatures up to 300 deg C. (author)

State-dependent bulk-boundary maps and black hole complementarity

NARCIS (Netherlands)

Papadodimas, Kyriakos; Raju, Suvrat

2014-01-01

We provide a simple and explicit construction of local bulk operators that describe the interior of a black hole in the AdS/CFT correspondence. The existence of these operators is predicated on the assumption that the mapping of CFT operators to local bulk operators depends on the state of the CFT.

Strain mapping near a triple junction in strained Ni-based alloy using EBSD and biaxial nanogauges

Energy Technology Data Exchange (ETDEWEB)

Clair, A. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Foucault, M.; Calonne, O. [Areva ANP, Centre Technique Departement Corrosion-Chimie, 30 Bd de l' industrie, BP 181, 71205 Le Creusot (France); Lacroute, Y.; Markey, L.; Salazar, M.; Vignal, V. [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France); Finot, E., E-mail: Eric.Finot@u-bourgogne.fr [Laboratoire Interdisciplinaire Carnot de Bourgogne, UMR 5209 CNRS, Universite de Bourgogne, 9 Avenue Alain Savary, BP 47870, 21078 Dijon Cedex (France)

2011-05-15

Research highlights: > Surface strains measured using nanogauge were compared to the texture obtained by EBSD. > Statistics of the principal strain discern the grains according to the Schmid factor. > Strain hotspots were localized near a triple junction of alloy 600 under tensile loading. > Asymetrical profile of the GB strains is a criterion for surface cracking initiation. - Abstract: A key element for analyzing the crack initiation in strained polycrystalline alloys is the local quantification of the surface strain distribution according to the grain texture. Using electron backscattered diffraction, the local microstructure was determined to both localize a triple junction and deduce the local Schmid factors. Kernel average misorientation (KAM) was also used to map the areas of defect concentration. The maximum principal strain and the in-plane shear strain were quantified using the biaxial nanogauge. Distortions of the array of nanodots used as spot markers were analyzed near the triple junction. The crystallographic orientation and the surface strain were then investigated both statistically for each grain and locally at the grain boundaries. The superimposition of microstructure and strain maps allows the high strain gradient (reaching 3-fold the applied strain) to be localized at preferential grain boundaries near the triple junction. The Schmid factors and the KAM were compared to the maximum principal strain and the in-plane shear strain respectively. The polycrystalline deformation was attributable first to the rotation of some grains, followed by the elongation of all grains along their preferential activated slip systems.

Involvement of oxidative stress in SAMP10 mice with age-related neurodegeneration.

Science.gov (United States)

Wang, Jun; Lei, Hongtao; Hou, Jincai; Liu, Jianxun

2015-05-01

Age-related changes in the brain tissue are reflected in many aspects. We sought to determine the morphology, Nissl bodies, behavioral appearance and oxidative stress in the brain using SAMP10 mice, a substrain of the senescence-accelerated mouse. SAMP10 mice groups divided by different ages (3, 5, 8 and 14 months) were compared with those of control groups with the above corresponding ages. Cortical thickness, Nissl bodies, behavioral appearance and oxidative stress were evaluated through image software, thionine staining, step-down test and colorimetry, respectively. The weight and cortical thickness of the brain in SAMP10 mice significantly reduced from 8 months of age. The results showed that the number of Nissl bodies decreased or Nissl bodies shrank with dark staining in histology. The same result appeared in a step-down test. As the SAMP10 mice grew older, the oxidative stress-related markers superoxide dismutase decreased and malondialdehyde increased after 8 months. Glutathione peroxidase activities showed no age-related changes. The changes of brain morphology and productions of oxidative stress in the brain tissue might contribute to the behavioral abnormality. Deceleration of age-related production of oxidative stress might be expected to be a potent strategy for anti-aging interventions.

Solitary waves in morphogenesis: Determination fronts as strain-cued strain transformations among automatous cells

Science.gov (United States)

Cox, Brian N.; Landis, Chad M.

2018-02-01

We present a simple theory of a strain pulse propagating as a solitary wave through a continuous two-dimensional population of cells. A critical strain is assumed to trigger a strain transformation, while, simultaneously, cells move as automata to tend to restore a preferred cell density. We consider systems in which the strain transformation is a shape change, a burst of proliferation, or the commencement of growth (which changes the shape of the population sheet), and demonstrate isomorphism among these cases. Numerical and analytical solutions describe a strain pulse whose height does not depend on how the strain disturbance was first launched, or the rate at which the strain transformation is achieved, or the rate constant in the rule for the restorative cell motion. The strain pulse is therefore very stable, surviving the imposition of strong perturbations: it would serve well as a timing signal in development. The automatous wave formulation is simple, with few model parameters. A strong case exists for the presence of a strain pulse during amelogenesis. Quantitative analysis reveals a simple relationship between the velocity of the leading edge of the pulse in amelogenesis and the known speed of migration of ameloblast cells. This result and energy arguments support the depiction of wave motion as an automatous cell response to strain, rather than as a response to an elastic energy gradient. The theory may also contribute to understanding the determination front in somitogenesis, moving fronts of convergent-extension transformation, and mitotic wavefronts in the syncytial drosophila embryo.

Mycobacterium tuberculosis strains exhibit differential and strain-specific molecular signatures in pulmonary epithelial cells.

Science.gov (United States)

Mvubu, Nontobeko Eunice; Pillay, Balakrishna; Gamieldien, Junaid; Bishai, William; Pillay, Manormoney

2016-12-01

Although pulmonary epithelial cells are integral to innate and adaptive immune responses during Mycobacterium tuberculosis infection, global transcriptomic changes in these cells remain largely unknown. Changes in gene expression induced in pulmonary epithelial cells infected with M. tuberculosis F15/LAM4/KZN, F11, F28, Beijing and Unique genotypes were investigated by RNA sequencing (RNA-Seq). The Illumina HiSeq 2000 platform generated 50 bp reads that were mapped to the human genome (Hg19) using Tophat (2.0.10). Differential gene expression induced by the different strains in infected relative to the uninfected cells was quantified and compared using Cufflinks (2.1.0) and MeV (4.0.9), respectively. Gene expression varied among the strains with the total number of genes as follows: F15/LAM4/KZN (1187), Beijing (1252), F11 (1639), F28 (870), Unique (886) and H37Rv (1179). A subset of 292 genes was commonly induced by all strains, where 52 genes were down-regulated while 240 genes were up-regulated. Differentially expressed genes were compared among the strains and the number of induced strain-specific gene signatures were as follows: F15/LAM4/KZN (138), Beijing (52), F11 (255), F28 (55), Unique (186) and H37Rv (125). Strain-specific molecular gene signatures associated with functional pathways were observed only for the Unique and H37Rv strains while certain biological functions may be associated with other strain signatures. This study demonstrated that strains of M. tuberculosis induce differential gene expression and strain-specific molecular signatures in pulmonary epithelial cells. Specific signatures induced by clinical strains of M. tuberculosis can be further explored for novel host-associated biomarkers and adjunctive immunotherapies. Copyright © 2016 Elsevier Ltd. All rights reserved.

Field assessment of the enzyme linked immunosorbent assay for foot-and-mouth disease virus diagnosis and typing

International Nuclear Information System (INIS)

Smitsaart, E.; Fondevila, N.; Compaired, D.; Maradei, E.; Fernandez, E.

1998-01-01

The objective of the present study was to evaluate the enzyme linked immunosorbent assay (ELISA) in comparison with the complement fixation test (CFT) for the diagnosis and typing of foot-and-mouth disease (FMD) virus (FMDV). Diagnostic material was epithelium from either suspected cases of FMD or from animals experimentally infected with FMDV. Epithelial suspensions and supernatant fluids from cell culture passage were assayed by CFT and ELISA. The superiority of the ELISA over the CFT was demonstrated: 1) the detection rate was 23% higher than that of CFT on original (epithelial) suspensions (OS) submissions of all sample (positive and negative) and 30% higher on supernatant fluids from cell culture passage, 2) the detection rate of ELISA on OS of confirmed positive samples was 28% higher than that of CFT, 3) no significant differences were observed in the detection and typing rates between the PANAFTOSA and FAO/IAEA ELISA kits (P<0.05) and 4) the sensitivity of the ELISA was 16 to 85 times higher than that of CFT when serial dilutions of sample homogenates were examined. (author)

Development of Posiphen, an Inhibitor of Phosphorylated Tau Expression, as a Treatment of TBI

Science.gov (United States)

2015-09-01

only expect a decrease in cell numbers (Fig. 25). This effect was not seen on the number of Nissl - stained neurons, indicating that it is due to a...decrease in TH staining not cell death. Table 2. LFP injury did not significantly affect the number of TH+ or Nissl + neurons in the ipsilateral...of toxicity consisting of red staining around the nostrils. The veterinarian consulted indicated that rats did not need to be euthanized prematurely

The Root Cause of Post-Traumatic and Developmental Stress Disorder

Science.gov (United States)

2014-10-01

PTSD BA11 PTSD BA11 (Pɘ.023) and correlated to HLA-DRB3 mushroom spine density Nissl staining on whole hemisphere sections from the frontal...techniques. Initial golgi analysis of prefrontal anatomy and stereological studies of the frontal cortex in Nissl sections are in progress. Major...cortex/hippocampus of PTSD, MDD and controls, with 5HTTLPR and other genetic variants as cofactors. Fig A. Golgi staining (left) in the mOFCTX has been

Accurate counting of neurons in frozen sections: some necessary precautions.

OpenAIRE

Cooper, J D; Payne, J N; Horobin, R W

1988-01-01

In 30 microns frozen sections of rat midbrain the retrograde axonal transport of diamidino yellow, a fluorescent tracer, was used to demonstrate a population of neurons in the substantia nigra. However, when visualisation was carried out using the routine Nissl method a significant proportion of neurons failed to stain. As the presence of the retrograde tracer did not affect Nissl staining of such cells, such incomplete staining, with consequent underestimation of neuronal populations, is pro...

Flexible piezotronic strain sensor.

Science.gov (United States)

Zhou, Jun; Gu, Yudong; Fei, Peng; Mai, Wenjie; Gao, Yifan; Yang, Rusen; Bao, Gang; Wang, Zhong Lin

2008-09-01

Strain sensors based on individual ZnO piezoelectric fine-wires (PFWs; nanowires, microwires) have been fabricated by a simple, reliable, and cost-effective technique. The electromechanical sensor device consists of a single electrically connected PFW that is placed on the outer surface of a flexible polystyrene (PS) substrate and bonded at its two ends. The entire device is fully packaged by a polydimethylsiloxane (PDMS) thin layer. The PFW has Schottky contacts at its two ends but with distinctly different barrier heights. The I- V characteristic is highly sensitive to strain mainly due to the change in Schottky barrier height (SBH), which scales linear with strain. The change in SBH is suggested owing to the strain induced band structure change and piezoelectric effect. The experimental data can be well-described by the thermionic emission-diffusion model. A gauge factor of as high as 1250 has been demonstrated, which is 25% higher than the best gauge factor demonstrated for carbon nanotubes. The strain sensor developed here has applications in strain and stress measurements in cell biology, biomedical sciences, MEMS devices, structure monitoring, and more.

Molecular typing of Brucella melitensis endemic strains and differentiation from the vaccine strain Rev-1.

Science.gov (United States)

Noutsios, Georgios T; Papi, Rigini M; Ekateriniadou, Loukia V; Minas, Anastasios; Kyriakidis, Dimitrios A

2012-03-01

In the present study forty-four Greek endemic strains of Br. melitensis and three reference strains were genotyped by Multi locus Variable Number Tandem Repeat (ML-VNTR) analysis based on an eight-base pair tandem repeat sequence that was revealed in eight loci of Br. melitensis genome. The forty-four strains were discriminated from the vaccine strain Rev-1 by Restriction Fragment Length Polymorphism (RFLP) and Denaturant Gradient Gel Electrophoresis (DGGE). The ML-VNTR analysis revealed that endemic, reference and vaccine strains are genetically closely related, while most of the loci tested (1, 2, 4, 5 and 7) are highly polymorphic with Hunter-Gaston Genetic Diversity Index (HGDI) values in the range of 0.939 to 0.775. Analysis of ML-VNTRs loci stability through in vitro passages proved that loci 1 and 5 are non stable. Therefore, vaccine strain can be discriminated from endemic strains by allele's clusters of loci 2, 4, 6 and 7. RFLP and DGGE were also employed to analyse omp2 gene and reveled different patterns among Rev-1 and endemic strains. In RFLP, Rev-1 revealed three fragments (282, 238 and 44 bp), while endemic strains two fragments (238 and 44 bp). As for DGGE, the electrophoretic mobility of Rev-1 is different from the endemic strains due to heterologous binding of DNA chains of omp2a and omp2b gene. Overall, our data show clearly that it is feasible to genotype endemic strains of Br. melitensis and differentiate them from vaccine strain Rev-1 with ML-VNTR, RFLP and DGGE techniques. These tools can be used for conventional investigations in brucellosis outbreaks.

Effects of the Strain Rate Sensitivity and Strain Hardening on the Saturated Impulse of Plates

Directory of Open Access Journals (Sweden)

Ling Zhu

Full Text Available Abstract This paper studies the stiffening effects of the material strain rate sensitivity and strain hardening on the saturated impulse of elastic, perfectly plastic plates. Finite element (FE code ABAQUS is employed to simulate the elastoplastic response of square plates under rectangular pressure pulse. Rigid-plastic analyses for saturated impulse, which consider strain rate sensitivity and strain hardening, are conducted. Satisfactory agreement between the finite element models (FEM and predictions of the rigid-plastic analysis is obtained, which verifies that the proposed rigid-plastic methods are effective to solve the problem including strain rate sensitivity and strain hardening. The quantitative results for the scale effect of the strain rate sensitivity are given. The results for the stiffening effects suggest that two general stiffening factors n 1 and n 2, which characterizes the strain rate sensitivity and strain hardening effect, respectively can be defined. The saturated displacement is inversely proportional to the stiffening factors (i.e. n 1 and n 2 and saturated impulse is inversely proportional to the square roots of the stiffening factors (i.e. n 1 and n 2. Formulae for displacement and saturated impulse are proposed based on the empirical analysis.

Effect of strain rate and temperature at high strains on fatigue behavior of SAP alloys

DEFF Research Database (Denmark)

Blucher, J.T.; Knudsen, Per; Grant, N.J.

1968-01-01

Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased with decre......Fatigue behavior of three SAP alloys of two nominal compositions (7 and 13% Al2O3) was studied in terms of strain rate and temperature at high strains; strain rate had no effect on life at 80 F, but had increasingly greater effect with increasing temperature above 500 F; life decreased...

What if? Neural activity underlying semantic and episodic counterfactual thinking.

Science.gov (United States)

Parikh, Natasha; Ruzic, Luka; Stewart, Gregory W; Spreng, R Nathan; De Brigard, Felipe

2018-05-25

Counterfactual thinking (CFT) is the process of mentally simulating alternative versions of known facts. In the past decade, cognitive neuroscientists have begun to uncover the neural underpinnings of CFT, particularly episodic CFT (eCFT), which activates regions in the default network (DN) also activated by episodic memory (eM) recall. However, the engagement of DN regions is different for distinct kinds of eCFT. More plausible counterfactuals and counterfactuals about oneself show stronger activity in DN regions compared to implausible and other- or object-focused counterfactuals. The current study sought to identify a source for this difference in DN activity. Specifically, self-focused counterfactuals may also be more plausible, suggesting that DN core regions are sensitive to the plausibility of a simulation. On the other hand, plausible and self-focused counterfactuals may involve more episodic information than implausible and other-focused counterfactuals, which would imply DN sensitivity to episodic information. In the current study, we compared episodic and semantic counterfactuals generated to be plausible or implausible against episodic and semantic memory reactivation using fMRI. Taking multivariate and univariate approaches, we found that the DN is engaged more during episodic simulations, including eM and all eCFT, than during semantic simulations. Semantic simulations engaged more inferior temporal and lateral occipital regions. The only region that showed strong plausibility effects was the hippocampus, which was significantly engaged for implausible CFT but not for plausible CFT, suggestive of binding more disparate information. Consequences of these findings for the cognitive neuroscience of mental simulation are discussed. Published by Elsevier Inc.

Genome-Wide Transcription Study of Cryptococcus neoformans H99 Clinical Strain versus Environmental Strains.

Directory of Open Access Journals (Sweden)

Elaheh Movahed

Full Text Available The infection of Cryptococcus neoformans is acquired through the inhalation of desiccated yeast cells and basidiospores originated from the environment, particularly from bird's droppings and decaying wood. Three environmental strains of C. neoformans originated from bird droppings (H4, S48B and S68B and C. neoformans reference clinical strain (H99 were used for intranasal infection in C57BL/6 mice. We showed that the H99 strain demonstrated higher virulence compared to H4, S48B and S68B strains. To examine if gene expression contributed to the different degree of virulence among these strains, a genome-wide microarray study was performed to inspect the transcriptomic profiles of all four strains. Our results revealed that out of 7,419 genes (22,257 probes examined, 65 genes were significantly up-or down-regulated in H99 versus H4, S48B and S68B strains. The up-regulated genes in H99 strain include Hydroxymethylglutaryl-CoA synthase (MVA1, Mitochondrial matrix factor 1 (MMF1, Bud-site-selection protein 8 (BUD8, High affinity glucose transporter 3 (SNF3 and Rho GTPase-activating protein 2 (RGA2. Pathway annotation using DAVID bioinformatics resource showed that metal ion binding and sugar transmembrane transporter activity pathways were highly expressed in the H99 strain. We suggest that the genes and pathways identified may possibly play crucial roles in the fungal pathogenesis.

Life Stress, Strain, and Deviance Across Schools: Testing the Contextual Version of General Strain Theory in China.

Science.gov (United States)

Zhang, Jinwu; Liu, Jianhong; Wang, Xin; Zou, Anquan

2017-08-01

General Strain Theory delineates different types of strain and intervening processes from strain to deviance and crime. In addition to explaining individual strain-crime relationship, a contextualized version of general strain theory, which is called the Macro General Strain Theory, has been used to analyze how aggregate variables influence aggregate and individual deviance and crime. Using a sample of 1,852 students (Level 1) nested in 52 schools (Level 2), the current study tests the Macro General Strain Theory using Chinese data. The results revealed that aggregate life stress and strain have influences on aggregate and individual deviance, and reinforce the individual stress-deviance association. The current study contributes by providing the first Macro General Strain Theory test based on Chinese data and offering empirical evidence for the multilevel intervening processes from strain to deviance. Limitations and future research directions are discussed.

Toxin-antitoxin systems are important for niche-specific colonization and stress resistance of uropathogenic Escherichia coli.

Directory of Open Access Journals (Sweden)

J Paul Norton

Full Text Available Toxin-antitoxin (TA systems are prevalent in many bacterial genomes and have been implicated in biofilm and persister cell formation, but the contribution of individual chromosomally encoded TA systems during bacterial pathogenesis is not well understood. Of the known TA systems encoded by Escherichia coli, only a subset is associated with strains of extraintestinal pathogenic E. coli (ExPEC. These pathogens colonize diverse niches and are a major cause of sepsis, meningitis, and urinary tract infections. Using a murine infection model, we show that two TA systems (YefM-YoeB and YbaJ-Hha independently promote colonization of the bladder by the reference uropathogenic ExPEC isolate CFT073, while a third TA system comprised of the toxin PasT and the antitoxin PasI is critical to ExPEC survival within the kidneys. The PasTI TA system also enhances ExPEC persister cell formation in the presence of antibiotics and markedly increases pathogen resistance to nutrient limitation as well as oxidative and nitrosative stresses. On its own, low-level expression of PasT protects ExPEC from these stresses, whereas overexpression of PasT is toxic and causes bacterial stasis. PasT-induced stasis can be rescued by overexpression of PasI, indicating that PasTI is a bona fide TA system. By mutagenesis, we find that the stress resistance and toxic effects of PasT can be uncoupled and mapped to distinct domains. Toxicity was specifically linked to sequences within the N-terminus of PasT, a region that also promotes the development of persister cells. These results indicate discrete, multipurpose functions for a TA-associated toxin and demonstrate that individual TA systems can provide bacteria with pronounced fitness advantages dependent on toxin expression levels and the specific environmental niche occupied.

Strain Pattern in Supercooled Liquids

Science.gov (United States)

Illing, Bernd; Fritschi, Sebastian; Hajnal, David; Klix, Christian; Keim, Peter; Fuchs, Matthias

2016-11-01

Investigations of strain correlations at the glass transition reveal unexpected phenomena. The shear strain fluctuations show an Eshelby-strain pattern [˜cos (4 θ ) /r2 ], characteristic of elastic response, even in liquids, at long times. We address this using a mode-coupling theory for the strain fluctuations in supercooled liquids and data from both video microscopy of a two-dimensional colloidal glass former and simulations of Brownian hard disks. We show that the long-ranged and long-lived strain signatures follow a scaling law valid close to the glass transition. For large enough viscosities, the Eshelby-strain pattern is visible even on time scales longer than the structural relaxation time τ and after the shear modulus has relaxed to zero.

Biological assay of attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus.

Science.gov (United States)

Mengeling, W L; Pejsak, Z; Paul, P S

1984-11-01

Attenuated strain NADL-2 and virulent strain NADL-8 of porcine parvovirus (PPV) were titrated in vivo and in vitro under similar conditions to provide a better understanding of some of the factors involved in virulence of PPV in causing maternal reproductive failure of swine. Both strains cause fetal death when they are injected directly into fetal fluids, but only strain NADL-8 does so when administered to pregnant swine. The strains were tested for their hemagglutinating activity (HA), median cell culture infective dose (CCID50), median fetal infective dose (FID50), and median fetal lethal dose (FLD50). The FID50 and FLD50 were determined by injecting virus directly into the amniotic fluid of fetuses in utero at 44 +/- 2 days of gestation and collecting the fetuses 15 +/- 1 days later. Both strains had an HA titer of 64, suggesting that there is a similar number of virions in stock preparations. However, other measurements differed markedly. The CCID50, FID50, and FLD50 were 10(5.5), 10(3.5), and 10(0.5), respectively, for strain NADL-2, and 10(4.5), 10(7.7), and 10(6.3), respectively, for strain NADL-8. Collectively, the values indicate that more than 10,000 times as much strain NADL-2 would need to reach the conceptus transplacentally to establish infection. These observations may help to explain the different consequences of oronasal exposure of pregnant swine to these strains of PPV.

Haldane model under nonuniform strain

Science.gov (United States)

Ho, Yen-Hung; Castro, Eduardo V.; Cazalilla, Miguel A.

2017-10-01

We study the Haldane model under strain using a tight-binding approach, and compare the obtained results with the continuum-limit approximation. As in graphene, nonuniform strain leads to a time-reversal preserving pseudomagnetic field that induces (pseudo-)Landau levels. Unlike a real magnetic field, strain lifts the degeneracy of the zeroth pseudo-Landau levels at different valleys. Moreover, for the zigzag edge under uniaxial strain, strain removes the degeneracy within the pseudo-Landau levels by inducing a tilt in their energy dispersion. The latter arises from next-to-leading order corrections to the continuum-limit Hamiltonian, which are absent for a real magnetic field. We show that, for the lowest pseudo-Landau levels in the Haldane model, the dominant contribution to the tilt is different from graphene. In addition, although strain does not strongly modify the dispersion of the edge states, their interplay with the pseudo-Landau levels is different for the armchair and zigzag ribbons. Finally, we study the effect of strain in the band structure of the Haldane model at the critical point of the topological transition, thus shedding light on the interplay between nontrivial topology and strain in quantum anomalous Hall systems.

Strain preservation of experimental animals: vitrification of two-cell stage embryos for multiple mouse strains.

Science.gov (United States)

Eto, Tomoo; Takahashi, Riichi; Kamisako, Tsutomu

2015-04-01

Strain preservation of experimental animals is crucial for experimental reproducibility. Maintaining complete animal strains, however, is costly and there is a risk for genetic mutations as well as complete loss due to disasters or illness. Therefore, the development of effective vitrification techniques for cryopreservation of multiple experimental animal strains is important. We examined whether a vitrification method using cryoprotectant solutions, P10 and PEPeS, is suitable for preservation of multiple inbred and outbred mouse strains. First, we investigated whether our vitrification method using cryoprotectant solutions was suitable for two-cell stage mouse embryos. In vitro development of embryos exposed to the cryoprotectant solutions was similar to that of fresh controls. Further, the survival rate of the vitrified embryos was extremely high (98.1%). Next, we collected and vitrified two-cell stage embryos of 14 mouse strains. The average number of embryos obtained from one female was 7.3-33.3. The survival rate of vitrified embryos ranged from 92.8% to 99.1%, with no significant differences among mouse strains. In vivo development did not differ significantly between fresh controls and vitrified embryos of each strain. For strain preservation using cryopreserved embryos, two offspring for inbred lines and one offspring for outbred lines must be produced from two-cell stage embryos collected from one female. The expected number of surviving fetuses obtained from embryos collected from one female of either the inbred or outbred strains ranged from 2.9 to 19.5. The findings of the present study indicated that this vitrification method is suitable for strain preservation of multiple mouse strains. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Colony Dimorphism in Bradyrhizobium Strains

Science.gov (United States)

Sylvester-Bradley, Rosemary; Thornton, Philip; Jones, Peter

1988-01-01

Ten isolates of Bradyrhizobium spp. which form two colony types were studied; the isolates originated from a range of legume species. The two colony types differed in the amount of gum formed or size or both, depending on the strain. Whole 7-day-old colonies of each type were subcultured to determine the proportion of cells which had changed to the other type. An iterative computerized procedure was used to determine the rate of switching per generation between the two types and to predict proportions reached at equilibrium for each strain. The predicted proportions of the wetter (more gummy) or larger colony type at equilibrium differed significantly between strains, ranging from 0.9999 (strain CIAT 2383) to 0.0216 (strain CIAT 2469), because some strains switched faster from dry to wet (or small to large) and others switched faster from wet to dry (or large to small). Predicted equilibrium was reached after about 140 generations in strain USDA 76. In all but one strain (CIAT 3030) the growth rate of the wetter colony type was greater than or similar to that of the drier type. The mean difference in generation time between the two colony types was 0.37 h. Doubling times calculated for either colony type after 7 days of growth on the agar surface ranged from 6.0 to 7.3 h. The formation of two persistent colony types by one strain (clonal or colony dimorphism) may be a common phenomenon among Bradyrhizobium strains. Images PMID:16347599

Conduction band structure and electron mobility in uniaxially strained Si via externally applied strain in nanomembranes

Energy Technology Data Exchange (ETDEWEB)

Chen Feng [Xi' an Jiaotong University, Xi' an, Shaanxi 710049 (China); Euaruksakul, Chanan; Himpsel, F J; Lagally, Max G [University of Wisconsin-Madison, Madison, WI 53706 (United States); Liu Zheng; Liu Feng, E-mail: lagally@engr.wisc.edu [University of Utah, Salt Lake City, UT 84112 (United States)

2011-08-17

Strain changes the band structure of semiconductors. We use x-ray absorption spectroscopy to study the change in the density of conduction band (CB) states when silicon is uniaxially strained along the [1 0 0] and [1 1 0] directions. High stress can be applied to silicon nanomembranes, because their thinness allows high levels of strain without fracture. Strain-induced changes in both the sixfold degenerate {Delta} valleys and the eightfold degenerate L valleys are determined quantitatively. The uniaxial deformation potentials of both {Delta} and L valleys are directly extracted using a strain tensor appropriate to the boundary conditions, i.e., confinement in the plane in the direction orthogonal to the straining direction, which correspond to those of strained CMOS in commercial applications. The experimentally determined deformation potentials match the theoretical predictions well. We predict electron mobility enhancement created by strain-induced CB modifications.

Studies on Drosophila radiosensitive strains

International Nuclear Information System (INIS)

Varentsova, E.P.; Zakharov, I.A.

1976-01-01

45 of radiosensitive strains of Drosophila melanogaster were isolated by Curly/Lobe technique after EMS treatment of Livadia population males. The lethality of non-Curly late larvae after gamma-irradiation (4000r) characterized radiosensitivity strains. Most of them exhibited higher frequency of the spontaneous dominant lethals (up to 69%). The males of 6 strains were semi-sterile. 5 of these strains exhibited higher frequency of X-chromosome non-disjunction

Segregation of genes from donor strain during the production of recombinant congenic strains.

Science.gov (United States)

van Zutphen, L F; Den Bieman, M; Lankhorst, A; Demant, P

1991-07-01

Recombinant congenic strains (RCS) constitute a set of inbred strains which are designed to dissect the genetic control of multigenic traits, such as tumour susceptibility or disease resistance. Each RCS contains a small fraction of the genome of a common donor strain, while the majority of genes stem from a common background strain. We tested at two stages of the inbreeding process in 20 RCS, derived from BALB/cHeA and STS/A, to see whether alleles from the STS/A donor strain are distributed over the RCS in a ratio as would theoretically be expected. Four marker genes (Pep-3; Pgm-1; Gpi-1 and Es-3) located at 4 different chromosomes were selected and the allelic distribution was tested after 3-4 and after 12 generations of inbreeding. The data obtained do not significantly deviate from the expected pattern, thus supporting the validity of the concept of RCS.

Breed-Specific Haematologic Reference Values in Adult Turkeys (Meleagris gallopavo in the Humid Tropics of Nigeria

Directory of Open Access Journals (Sweden)

Daniel-Igwe G.

2017-03-01

Full Text Available One hundred (50 males and 50 females B-not strain indigenous turkeys, Meleagris gallopavo, were used to determine the reference values for their haematological parameters. The turkeys were housed in the poultry unit and jugular venepunctures were used to collect their blood. The haematological parameters were determined using standard procedures. The mean values of: the packed cell volume (PCV; 37.29 ± 0.37 %, red blood cell (RBC counts (2.50 ± 0.44 × 106.µl−1, haemoglobin concentration (Hbc; 10.89 ± 0.34 g.dl−1, mean corpuscular volume (MCV; 150.63 ± 0.73 fl, mean corpuscular haemoglobin (MCH; 44.29 ± 1.78 pg, mean corpuscular haemoglobin concentration (MCHC; 29.10 ± 0.73 g.dl−1, and white blood cell (WBC counts (12.41 ± 0.83 × 103 µl−1 were determined. No significant differences were found between the male and female B-not strain turkeys in this study. The results will help in the interpretation of cases of disease when there are variations in the values and serve as baseline data for B-not strain of turkeys in the humid tropics.

Ads(3)/CFT(2) to Ads(2)/CFT(1)

OpenAIRE

Gupta, Rajesh Kumar; Sen, Ashoke

2008-01-01

It has been suggested that the quantum generalization of the Wald entropy for an extremal black hole is the logarithm of the ground state degeneracy of a dual quantum mechanics in a fixed charge sector. We test this proposal for supersymmetric extremal BTZ black holes for which there is an independent definition of the quantum entropy as the logarithm of the degeneracy of appropriate states in the dual 1+1 dimensional superconformal field theory. We find that the two proposals agree. This ana...

A new strain gage method for measuring the contractile strain ratio of Zircaloy tubing

International Nuclear Information System (INIS)

Hwang, S.K.; Sabol, G.P.

1988-01-01

An improved strain gage method for determining the contractile strain ratio (CSR) of Zircaloy tubing was developed. The new method consists of a number of load-unload cyclings at approximately 0.2% plastic strain interval. With this method the CSR of Zircaloy-4 tubing could be determined accurately because it was possible to separate the plastic strains from the elastic strain involvement. The CSR values determined by use of the new method were in good agreement with those calculated from conventional post-test manual measurements. The CSR of the tubing was found to decrease with the amount of deformation during testing because of uneven plastic flow in the gage section. A new technique of inscribing gage marks by use of a YAG laser is discussed. (orig.)

Strain localization band width evolution by electronic speckle pattern interferometry strain rate measurement

Energy Technology Data Exchange (ETDEWEB)

Guelorget, Bruno [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)], E-mail: bruno.guelorget@utt.fr; Francois, Manuel; Montay, Guillaume [Institut Charles Delaunay-LASMIS, Universite de technologie de Troyes, FRE CNRS 2848, 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)

2009-04-15

In this paper, electronic speckle pattern interferometry strain rate measurements are used to quantify the width of the strain localization band, which occurs when a sheet specimen is submitted to tension. It is shown that the width of this band decreases with increasing strain. Just before fracture, this measured width is about five times wider than the shear band and the initial sheet thickness.

Thermal strain measurement of EAST W/Cu divertor structure using electric resistance strain gauges

Energy Technology Data Exchange (ETDEWEB)

Wang, Xingli [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Wang, Wanjing, E-mail: wjwang@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wang, Jichao [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Wei, Ran; Sun, Zhaoxuan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Li, Qiang; Xie, Chunyi [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Chen, Hong-En; Wang, Kaiqiang; Wu, Lei; Chen, Zhenmao [State Key Lab for Strength and Vibration of Mechanical Structures, Xi’an Jiaotong University (China); Luo, Guang-Nan [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei, 230031 (China); Science Island Branch of Graduate School, University of Science & Technology of China, Hefei, 230031 (China); Hefei Center for Physical Science and Technology, Hefei, 230022 (China); Hefei Science Center of Chinese Academy of Sciences, Hefei, 230027 (China)

2016-12-15

Highlights: • To understand the service behavior of W/Cu divertor, an electrical resistance strain gauge system had been introduced in a thermal strain measurement experiment. • The measurement system successfully finished the experiment and obtained valued thermal strain data. • Two thermomechanical analyses had also been carried out and compared with the measurement results. • Experiment results corresponded well to simulations and threw a light upon the failure of W/Cu divertor in the previous baking tests. - Abstract: W/Cu divertor has complex structure and faces extreme work environment in EAST Tokamak device. To measure its thermal strain shall be a valued way to understand its service behavior and then optimize its design and manufacturing process. This work presents a preliminary study on measuring thermal strain of EAST W/Cu divertor structure using electric resistance strain gauges. Eight gauges had been used in the experiment and the heating temperature had been set to 230 °C with respect to the work temperature. To realize the measuring experiment, an appropriate fixing method of gauges in divertor narrow spaces had been taken and tested, which could not only withstand high temperature but also had no damage to the divertor sample. The measurement results were that three gauges showed positive strain while other three showed negative strain after having been compensated, which corresponded to tensile stress and compressed stress respectively. Two thermomechanical simulations had also been carried out and used for comparing with the experiment.

RG flows in the D-series of minimal CFTs

International Nuclear Information System (INIS)

Klassen, T.R.; Melzer, E.

1993-01-01

Using results of the thermodynamic Bethe ansatz approach and conformal perturbation theory we argue that the φ 1,3 perturbation of a unitary minimal (1+1)-dimensional conformal field theory (CFT) in the D-series of modular invariant partition functions induces a renormalization group (RG) flow to the next-lower model in the D-series. An exception is the first model in the series, the three-state Potts CFT, which under the Z 2 -even φ 1,3 -perturbation flows to the tricritical Ising CFT, the second model in the A-series. We present arguments that in the A-series flow corresponding to this exceptional case, interpolating between the tetracritical and the tricritical Ising CFT, the IR fixed point is approached from 'exactly the opposite direction'. Our results indicate how (most of) the relevant conformal fields evolve from the UV to the IR CFT. (orig.)

Two-dimensional conformal field theory and beyond. Lessons from a continuing fashion

International Nuclear Information System (INIS)

Todorov, I.

2000-01-01

Two-dimensional conformal field theory (CFT) has several sources: the search for simple examples of quantum field theory, tile description of surface critical phenomena, the study of (super)string vacua (which made it particularly fashionable). In the present overview of tile subject we emphasize the role of CFT in bridging the gap between mathematics and quantum field theory and discuss some new physical concepts that emerged in the study of CFT models: anomalous dimensions, rational CFT, braid group statistics. In an aside, at tile end of the paper, we share tile misgivings, recently expressed by Penrose, about some dominant trends in fundamental theoretical physics. (author)

Noninvasive characterization of carotid plaque strain.

Science.gov (United States)

Khan, Amir A; Sikdar, Siddhartha; Hatsukami, Thomas; Cebral, Juan; Jones, Michael; Huston, John; Howard, George; Lal, Brajesh K

2017-06-01

Current risk stratification of internal carotid artery plaques based on diameter-reducing percentage stenosis may be unreliable because ischemic stroke results from plaque disruption with atheroembolization. Biomechanical forces acting on the plaque may render it vulnerable to rupture. The feasibility of ultrasound-based quantification of plaque displacement and strain induced by hemodynamic forces and their relationship to high-risk plaques have not been determined. We studied the feasibility and reliability of carotid plaque strain measurement from clinical B-mode ultrasound images and the relationship of strain to high-risk plaque morphology. We analyzed carotid ultrasound B-mode cine loops obtained in patients with asymptomatic ≥50% stenosis during routine clinical scanning. Optical flow methods were used to quantify plaque motion and shear strain during the cardiac cycle. The magnitude (maximum absolute shear strain rate [MASSR]) and variability (entropy of shear strain rate [ESSR] and variance of shear strain rate [VSSR]) of strain were combined into a composite shear strain index (SSI), which was assessed for interscan repeatability and correlated with plaque echolucency. Nineteen patients (mean age, 70 years) constituting 36 plaques underwent imaging; 37% of patients (n = 7) showed high strain (SSI ≥0.5; MASSR, 2.2; ESSR, 39.7; VSSR, 0.03) in their plaques; the remaining clustered into a low-strain group (SSI routine B-mode imaging using clinical ultrasound machines. High plaque strain correlates with known high-risk echolucent morphology. Strain measurement can complement identification of patients at high risk for plaque disruption and stroke. Copyright © 2017 Society for Vascular Surgery. Published by Elsevier Inc. All rights reserved.

Revealing differences in metabolic flux distributions between a mutant strain and its parent strain Gluconacetobacter xylinus CGMCC 2955.

Directory of Open Access Journals (Sweden)

Cheng Zhong

Full Text Available A better understanding of metabolic fluxes is important for manipulating microbial metabolism toward desired end products, or away from undesirable by-products. A mutant strain, Gluconacetobacter xylinus AX2-16, was obtained by combined chemical mutation of the parent strain (G. xylinus CGMCC 2955 using DEC (diethyl sulfate and LiCl. The highest bacterial cellulose production for this mutant was obtained at about 11.75 g/L, which was an increase of 62% compared with that by the parent strain. In contrast, gluconic acid (the main byproduct concentration was only 5.71 g/L for mutant strain, which was 55.7% lower than that of parent strain. Metabolic flux analysis indicated that 40.1% of the carbon source was transformed to bacterial cellulose in mutant strain, compared with 24.2% for parent strain. Only 32.7% and 4.0% of the carbon source were converted into gluconic acid and acetic acid in mutant strain, compared with 58.5% and 9.5% of that in parent strain. In addition, a higher flux of tricarboxylic acid (TCA cycle was obtained in mutant strain (57.0% compared with parent strain (17.0%. It was also indicated from the flux analysis that more ATP was produced in mutant strain from pentose phosphate pathway (PPP and TCA cycle. The enzymatic activity of succinate dehydrogenase (SDH, which is one of the key enzymes in TCA cycle, was 1.65-fold higher in mutant strain than that in parent strain at the end of culture. It was further validated by the measurement of ATPase that 3.53-6.41 fold higher enzymatic activity was obtained from mutant strain compared with parent strain.

Impaired Leydig cell function in infertile men

DEFF Research Database (Denmark)

Andersson, A-M; Jørgensen, N; Frydelund-Larsen, L

2004-01-01

, and calculated free T index (cFT) were compared between the two groups.A shift toward lower serum T levels, cFT, and T/LH ratio and higher serum LH, E(2), and E(2)/T levels was observed in the group of infertile men. On average, the infertile men had 18, 26, and 34% lower serum T, cFT, and T/LH levels...

Mumps Hoshino and Torii vaccine strains were distinguished from circulating wild strains.

Science.gov (United States)

Sawada, Akihito; Yamaji, Yoshiaki; Nakayama, Tetsuo

2013-06-01

Aseptic meningitis and acute parotitis have been observed after mumps vaccination. Mumps outbreaks have been reported in Japan because of low vaccine coverage, and molecular differentiation is required to determine whether these cases are vaccine associated. RT-nested PCR was performed in the small hydrophobic gene region, and viruses were differentiated by restriction fragment length polymorphism assay. A total of 584 nucleotides were amplified. The PCR product of the Hoshino strain was cut into two fragments (313 and 271 nucleotides) by MfeI; that of the Torii strain was digested with EcoT22I, resulting in 332- and 252-nucleotide fragments. Both strains were genotype B and had an XbaI site, resulting in two fragments: 299 and 285 nucleotides. Current circulating wild types were cut only by XbaI or MfeI. However, the MfeI site of the wild types was different from that of the Hoshino strain, resulting in 451- and 133-nucleotide fragments. Using three restriction enzymes, two mumps vaccine strains were distinguished from wild types, and this separation was applied to the identification of vaccine-related adverse events.

An Embeddable Strain Sensor with 30 Nano-Strain Resolution Based on Optical Interferometry

Directory of Open Access Journals (Sweden)

Chen Zhu

2018-04-01

Full Text Available A cost-effective, robust and embeddable optical interferometric strain sensor with nanoscale strain resolution is presented in this paper. The sensor consists of an optical fiber, a quartz rod with one end coated with a thin gold layer, and two metal shells employed to transfer the strain and orient and protect the optical fiber and the quartz rod. The optical fiber endface, combining with the gold-coated surface, forms an extrinsic Fabry–Perot interferometer. The sensor was firstly calibrated, and the result showed that our prototype sensor could provide a measurement resolution of 30 nano-strain (nε and a sensitivity of 10.01 µε/µm over a range of 1000 µε. After calibration of the sensor, the shrinkage strain of a cubic brick of mortar in real time during the drying process was monitored. The strain sensor was compared with a commercial linear variable displacement transducer, and the comparison results in four weeks demonstrated that our sensor had much higher measurement resolution and gained more detailed and useful information. Due to the advantages of the extremely simple, robust and cost-effective configuration, it is believed that the sensor is significantly beneficial to practical applications, especially for structural health monitoring.

Holographic Rényi entropy in AdS{sub 3}/LCFT{sub 2} correspondence

Energy Technology Data Exchange (ETDEWEB)

Chen, Bin [Department of Physics and State Key Laboratory of Nuclear Physics and Technology,Peking University, 5 Yiheyuan Rd, Beijing 100871 (China); Collaborative Innovation Center of Quantum Matter, 5 Yiheyuan Rd, Beijing 100871 (China); Center for High Energy Physics, Peking University, 5 Yiheyuan Rd, Beijing 100871 (China); Beijing Center for Mathematics and Information Interdisciplinary Sciences,105 W 3rd Ring Rd N, Beijing 100048 (China); Song, Feng-yan; Zhang, Jia-ju [Department of Physics and State Key Laboratory of Nuclear Physics and Technology,Peking University, 5 Yiheyuan Rd, Beijing 100871 (China)

2014-03-31

The recent study in AdS{sub 3}/CFT{sub 2} correspondence shows that the tree level contribution and 1-loop correction of holographic Rényi entanglement entropy (HRE) exactly match the direct CFT computation in the large central charge limit. This allows the Rényi entanglement entropy to be a new window to study the AdS/CFT correspondence. In this paper we generalize the study of Rényi entanglement entropy in pure AdS{sub 3} gravity to the massive gravity theories at the critical points. For the cosmological topological massive gravity (CTMG), the dual conformal field theory (CFT) could be a chiral conformal field theory or a logarithmic conformal field theory (LCFT), depending on the asymptotic boundary conditions imposed. In both cases, by studying the short interval expansion of the Rényi entanglement entropy of two disjoint intervals with small cross ratio x, we find that the classical and 1-loop HRE are in exact match with the CFT results, up to order x{sup 6}. To this order, the difference between the massless graviton and logarithmic mode can be seen clearly. Moreover, for the cosmological new massive gravity (CNMG) at critical point, which could be dual to a logarithmic CFT as well, we find the similar agreement in the CNMG/LCFT correspondence. Furthermore we read the 2-loop correction of graviton and logarithmic mode to HRE from CFT computation. It has distinct feature from the one in pure AdS{sub 3} gravity.

Holographic Rényi entropy in AdS3/LCFT2 correspondence

International Nuclear Information System (INIS)

Chen, Bin; Song, Feng-yan; Zhang, Jia-ju

2014-01-01

The recent study in AdS 3 /CFT 2 correspondence shows that the tree level contribution and 1-loop correction of holographic Rényi entanglement entropy (HRE) exactly match the direct CFT computation in the large central charge limit. This allows the Rényi entanglement entropy to be a new window to study the AdS/CFT correspondence. In this paper we generalize the study of Rényi entanglement entropy in pure AdS 3 gravity to the massive gravity theories at the critical points. For the cosmological topological massive gravity (CTMG), the dual conformal field theory (CFT) could be a chiral conformal field theory or a logarithmic conformal field theory (LCFT), depending on the asymptotic boundary conditions imposed. In both cases, by studying the short interval expansion of the Rényi entanglement entropy of two disjoint intervals with small cross ratio x, we find that the classical and 1-loop HRE are in exact match with the CFT results, up to order x 6 . To this order, the difference between the massless graviton and logarithmic mode can be seen clearly. Moreover, for the cosmological new massive gravity (CNMG) at critical point, which could be dual to a logarithmic CFT as well, we find the similar agreement in the CNMG/LCFT correspondence. Furthermore we read the 2-loop correction of graviton and logarithmic mode to HRE from CFT computation. It has distinct feature from the one in pure AdS 3 gravity

Counterfactual Thinking Deficit in Huntington’s Disease

Science.gov (United States)

Solca, Federica; Poletti, Barbara; Zago, Stefano; Crespi, Chiara; Sassone, Francesca; Lafronza, Annalisa; Maraschi, Anna Maria; Sassone, Jenny; Silani, Vincenzo; Ciammola, Andrea

2015-01-01

Background and Objective Counterfactual thinking (CFT) refers to the generation of mental simulations of alternatives to past events, actions and outcomes. CFT is a pervasive cognitive feature in every-day life and is closely related to decision-making, planning and problem-solving – all of which are cognitive processes linked to unimpaired frontal lobe functioning. Huntington’s Disease (HD) is a neurodegenerative disorder characterised by motor, behavioral and cognitive dysfunctions. Because an impairment in frontal and executive functions has been described in HD, we hypothesised that HD patients may have a CFT impairment. Methods Tests of spontaneous counterfactual thoughts and counterfactual-derived inferences were administered to 24 symptomatic HD patients and 24 age- and sex-matched healthy subjects. Results Our results show a significant impairment in the spontaneous generation of CFT and low performance on the Counterfactual Inference Test (CIT) in HD patients. Low performance on the spontaneous CFT test significantly correlates with impaired attention abilities, verbal fluency and frontal lobe efficiency, as measured by Trail Making Test – Part A, Phonemic Verbal Fluency Test and FAB. Conclusions Spontaneous CFT and the use of this type of reasoning are impaired in HD patients. This deficit may be related to frontal lobe dysfunction, which is a hallmark of HD. Because CFT has a pervasive role in patients’ daily lives regarding their planning, decision making and problem solving skills, cognitive rehabilitation may improve HD patients’ ability to analyse current behaviors and future actions. PMID:26070155

An ultrasensitive strain sensor with a wide strain range based on graphene armour scales.

Science.gov (United States)

Yang, Yi-Fan; Tao, Lu-Qi; Pang, Yu; Tian, He; Ju, Zhen-Yi; Wu, Xiao-Ming; Yang, Yi; Ren, Tian-Ling

2018-06-12

An ultrasensitive strain sensor with a wide strain range based on graphene armour scales is demonstrated in this paper. The sensor shows an ultra-high gauge factor (GF, up to 1054) and a wide strain range (ε = 26%), both of which present an advantage compared to most other flexible sensors. Moreover, the sensor is developed by a simple fabrication process. Due to the excellent performance, this strain sensor can meet the demands of subtle, large and complex human motion monitoring, which indicates its tremendous application potential in health monitoring, mechanical control, real-time motion monitoring and so on.

Strain rate measurement by Electronic Speckle Pattern Interferometry: A new look at the strain localization onset

International Nuclear Information System (INIS)

Guelorget, Bruno; Francois, Manuel; Vial-Edwards, Cristian; Montay, Guillaume; Daniel, Laurent; Lu, Jian

2006-01-01

In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force (ε t ≅ 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements

Strain rate measurement by Electronic Speckle Pattern Interferometry: A new look at the strain localization onset

Energy Technology Data Exchange (ETDEWEB)

Guelorget, Bruno [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)]. E-mail: bruno.guelorget@utt.fr; Francois, Manuel [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Vial-Edwards, Cristian [Departemento de Ingenieria Mecanica y Metalurgica, Pontificia Universidad Catolica de Chile, Vicuna Mackenna 4860, 6904411 Santiago (Chile); Montay, Guillaume [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Daniel, Laurent [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France); Lu, Jian [Universite de Technologie de Troyes (UTT), Laboratoire des Systemes Mecaniques et d' ingenierie Simultanee (LASMIS, CNRS FRE 2719), 12 rue Marie Curie, B.P. 2060, 10010 Troyes Cedex (France)

2006-01-15

In-plane Electronic Speckle Pattern Interferometry has been successfully used during tensile testing of semi-hard copper sheets in order to measure the strain rate. On one hand, heterogeneity in strain rate field has been found before the maximum of the tensile force ({epsilon} {sup t} {approx_equal} 19.4 and 25.4%, respectively). Thus, a localization phenomenon occurs before the classic Considere's criterion (dF = 0) for the diffuse neck initiation. On the other hand, strain rate measurement before fracture shows the moment where one of the two slip band systems becomes predominant, then strain concentrates in a small area, the shear band. Uncertainty evaluation has been carried out, which shows a very good accuracy of the total strain and the strain rate measurements.

Mechanical strength model for plastic bonded granular materials at high strain rates and large strains

International Nuclear Information System (INIS)

Browning, R.V.; Scammon, R.J.

1998-01-01

Modeling impact events on systems containing plastic bonded explosive materials requires accurate models for stress evolution at high strain rates out to large strains. For example, in the Steven test geometry reactions occur after strains of 0.5 or more are reached for PBX-9501. The morphology of this class of materials and properties of the constituents are briefly described. We then review the viscoelastic behavior observed at small strains for this class of material, and evaluate large strain models used for granular materials such as cap models. Dilatation under shearing deformations of the PBX is experimentally observed and is one of the key features modeled in cap style plasticity theories, together with bulk plastic flow at high pressures. We propose a model that combines viscoelastic behavior at small strains but adds intergranular stresses at larger strains. A procedure using numerical simulations and comparisons with results from flyer plate tests and low rate uniaxial stress tests is used to develop a rough set of constants for PBX-9501. Comparisons with the high rate flyer plate tests demonstrate that the observed characteristic behavior is captured by this viscoelastic based model. copyright 1998 American Institute of Physics

Standardization of fixation, processing and staining methods for the central nervous system of vertebrates.

Science.gov (United States)

Aldana Marcos, H J; Ferrari, C C; Benitez, I; Affanni, J M

1996-12-01

This paper reports the standardization of methods used for processing and embedding various vertebrate brains of different size in paraffin. Other technical details developed for avoiding frequent difficulties arising during laboratory routine are also reported. Some modifications of the Nissl and Klüver-Barrera staining methods are proposed. These modifications include: 1) a Nissl stain solution with a rapid and efficient action with easier differentiation; 2) the use of a cheap microwave oven for the Klüver-Barrera stain. These procedures have the advantage of permitting Nissl and Klüver-Barrera staining of nervous tissue in about five and fifteen minutes respectively. The proposed procedures have been tested in brains obtained from fish, amphibians, reptiles and mammals of different body sizes. They are the result of our long experience in preparing slides for comparative studies. Serial sections of excellent quality were regularly obtained in all the specimens studied. These standardized methods, being simple and quick, are recommended for routine use in neurobiological laboratories.

A strain gauge

DEFF Research Database (Denmark)

2017-01-01

The invention relates to a strain gauge of a carrier layer and a meandering measurement grid (101) positioned on the carrier layer, wherein the measurement grid comprises a number of measurement grid sections placed side by side with gaps in between, and a number of end loops (106) interconnecting...... relates to a method for manufacturing a strain gauge as mentioned above....

Origin of the Strain Sensitivity for an Organic Heptazole Thin-Film and Its Strain Gauge Application

Science.gov (United States)

Bae, Heesun; Jeon, Pyo Jin; Park, Ji Hoon; Lee, Kimoon

2018-04-01

The authors report on the origin of the strain sensitivity for an organic C26H16N2 (heptazole) thinfilm and its application for the detection of tensile strain. From the electrical characterization on the thin-film transistor adopting a heptazole channel, heptazole film exhibits p-channel conduction with a relatively low value of field-effect mobility (0.05 cm2/Vs), suggesting a hopping conduction behavior via hole carriers. By analyzing the strain and temperature dependences of the electrical conductivity, we reveal that the electrical conduction for a heptazole thin-film is dominated by the variable range hopping process with quite a large energy separation (224.9 meV) between the localized states under a relatively long attenuation length (10.46 Å). This indicates that a change in the inter-grain spacing that is much larger than the attenuation length is responsible for the reversible modification of electrical conductivity depending on strain for the heptazole film. By utilizing our heptazole thin-film both as a strain sensitive passive resistor and an active semiconducting channel layer, we can achieve a strain gauge device exhibiting reversible endurance for tensile strains up to 2.12%. Consequently, this study advances the understanding of the fundamental strain sensing mechanism in a heptazole thin-film toward finding a promise material with a strain gauge for applications as potential flexible devices and/or wearable electronics.

Asymptomatic bacteriuria Escherichia coli strains

DEFF Research Database (Denmark)

Hancock, Viktoria; Nielsen, E.M.; Klemm, Per

2006-01-01

Urinary tract infections (UTIs) affect millions of people each year. Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU) in humans. Persons affected by ABU may carry a particular E. coli strain for extended periods of time without any symptoms. In contrast...... to uropathogenic E. coli (UPEC) that cause symptomatic UTI, very little is known about the mechanisms by which these strains colonize the urinary tract. Here, we have investigated the growth characteristics in human urine as well as adhesin repertoire of nine ABU strains; the ability of ABU strains to compete...

Strain-controlled nonvolatile magnetization switching

Science.gov (United States)

Geprägs, S.; Brandlmaier, A.; Brandt, M. S.; Gross, R.; Goennenwein, S. T. B.

2014-11-01

We investigate different approaches towards a nonvolatile switching of the remanent magnetization in single-crystalline ferromagnets at room temperature via elastic strain using ferromagnetic thin film/piezoelectric actuator hybrids. The piezoelectric actuator induces a voltage-controllable strain along different crystalline directions of the ferromagnetic thin film, resulting in modifications of its magnetization by converse magnetoelastic effects. We quantify the magnetization changes in the hybrids via ferromagnetic resonance spectroscopy and superconducting quantum interference device magnetometry. These measurements demonstrate a significant strain-induced change of the magnetization, limited by an inefficient strain transfer and domain formation in the particular system studied. To overcome these obstacles, we address practicable engineering concepts and use a model to demonstrate that a strain-controlled, nonvolatile magnetization switching should be possible in appropriately engineered ferromagnetic/piezoelectric actuator hybrids.

Strain and strain rate by two-dimensional speckle tracking echocardiography in a maned wolf Strain e strain rate por meio de ecocardiogratia speckle traking bidimensional em um lobo-guará

Directory of Open Access Journals (Sweden)

Matheus M. Mantovani

2012-12-01

Full Text Available The measurement of cardiovascular features of wild animals is important, as is the measurement in pets, for the assessment of myocardial function and the early detection of cardiac abnormalities, which could progress to heart failure. Speckle tracking echocardiography (2D STE is a new tool that has been used in veterinary medicine, which demonstrates several advantages, such as angle independence and the possibility to provide the early diagnosis of myocardial alterations. The aim of this study was to evaluate the left myocardial function in a maned wolf by 2D STE. Thus, the longitudinal, circumferential and radial strain and strain rate were obtained, as well as, the radial and longitudinal velocity and displacement values, from the right parasternal long axis four-chamber view, the left parasternal apical four chamber view and the parasternal short axis at the level of the papillary muscles. The results of the longitudinal variables were -13.52±7.88, -1.60±1.05, 4.34±2.52 and 3.86±3.04 for strain (%, strain rate (1/s, displacement (mm and velocity (cm/s, respectively. In addition, the radial and circumferential Strain and Strain rate were 24.39±14.23, 1.86±0.95 and -13.69±6.53, -1.01±0.48, respectively. Thus, the present study provides the first data regarding the use of this tool in maned wolves, allowing a more complete quantification of myocardial function in this species.A obtenção de parâmetros cardiovasculares em animais selvagens são importantes de serem avaliados, assim como em animais de companhia, para a obtenção da função miocárdica e determinação precoce de alterações cardíacas que poderiam evoluir para insuficiência cardíaca . A ecocardiografia speckle tracking (2D STE é uma ferramenta nova que tem sido utilizada em medicina veterinária, a qual tem demonstrado várias vantagens quanto ao seu uso, como a independência do ângulo de insonação e a possibilidade de se obter o diagnóstico precoce de altera

Asymmetric interiors for small black holes

Energy Technology Data Exchange (ETDEWEB)

Kabat, Daniel [Department of Physics and Astronomy, Lehman College,City University of New York, Bronx NY 10468 (United States); Lifschytz, Gilad [Department of Mathematics, Faculty of Natural Science,University of Haifa, Haifa 31905 (Israel)

2016-08-16

We develop the representation of infalling observers and bulk fields in the CFT as a way to understand the black hole interior in AdS. We first discuss properties of CFT states which are dual to black holes. We then show that in the presence of a Killing horizon bulk fields can be decomposed into pieces we call ingoing and outgoing. The ingoing field admits a simple operator representation in the CFT, even inside a small black hole at late times, which leads to a simple CFT description of infalling geodesics. This means classical infalling observers will experience the classical geometry in the interior. The outgoing piece of the field is more subtle. In an eternal two-sided geometry it can be represented as an operator on the left CFT. In a stable one-sided geometry it can be described using entanglement via the PR construction. But in an evaporating black hole trans-horizon entanglement breaks down at the Page time, which means that for old black holes the PR construction fails and the outgoing field does not see local geometry. This picture of the interior allows the CFT to reconcile unitary Hawking evaporation with the classical experience of infalling observers.

Failure strains and proposed limit strains for an reactor pressure vessel under severe accident conditions

International Nuclear Information System (INIS)

Krieg, R.

2005-01-01

The local failure strains of essential design elements of a reactor vessel are investigated. The size influence of the structure is of special interest. Typical severe accident conditions including elevated temperatures and dynamic loads are considered. The main part of work consists of test families with specimens under uniaxial and biaxial load. Within one test family the specimen geometry and the load conditions are similar, but the size is varied up to reactor dimensions. Special attention is given to geometries with a hole or a notch causing non-uniform stress and strain distributions typical for the reactor vessel. A key problem is to determine the local failure strain. Here suitable methods had to be developed including the so-called 'vanishing gap method', and the 'forging die method'. They are based on post-test geometrical measurements of the fracture surfaces and reconstructions of the related strain fields using finite element models. The results indicate that stresses versus dimensionless deformations are approximately size independent up to failure for specimens of similar geometry under similar load conditions. Local failure strains could be determined. The values are rather high and size dependent. Statistical evaluation allow the proposal of limit strains which are also size dependent. If these limit strains are not exceeded, the structures will not fracture

General Strain Theory and Delinquency: Focusing on the Influences of Key Strain Characteristics on Delinquency

Science.gov (United States)

Moon, Byongook; Blurton, David; McCluskey, John D.

2008-01-01

The study examines the effects of recent, older, and chronic strains and of perceived injustice of strain on delinquency, sampling 777 Korean youth. Seven key strains most likely leading to delinquency, some of which were often overlooked in previous research, were included, and these are family conflict, parental punishment, teachers' punishment,…

Enzyme markers in inbred rat strains: genetics of new markers and strain profiles.

Science.gov (United States)

Adams, M; Baverstock, P R; Watts, C H; Gutman, G A

1984-08-01

Twenty-six inbred strains of the laboratory rat (Rattus norvegicus) were examined for electrophoretic variation at an estimated 97 genetic loci. In addition to previously documented markers, variation was observed for the enzymes aconitase, aldehyde dehydrogenase, and alkaline phosphatase. The genetic basis of these markers (Acon-1, Ahd-2, and Akp-1) was confirmed. Linkage analysis between 35 pairwise comparisons revealed that the markers Fh-1 and Pep-3 are linked. The strain profiles of the 25 inbred strains at 11 electrophoretic markers are given.

Effects of gauge volume on pseudo-strain induced in strain measurement using time-of-flight neutron diffraction

International Nuclear Information System (INIS)

Suzuki, Hiroshi; Harjo, Stefanus; Abe, Jun; Xu, Pingguang; Aizawa, Kazuya; Akita, Koichi

2013-01-01

Spurious or pseudo-strains observed in time-of-flight (TOF) neutron diffraction due to neutron attenuation, surface-effects and a strain distribution within the gauge volume were investigated. Experiments were carried out on annealed and bent ferritic steel bars to test these effects. The most representative position in the gauge volume corresponds to the neutron-weighted center of gravity (ncog), which takes into account variations in intensity within the gauge volume due to neutron attenuation and/or absence of material in the gauge volume. The average strain in the gauge volume was observed to be weighted towards the ncog position but following an increase in the size of the gauge volume the weighted average strain was changed because of the change in the ncog position when a strain gradient appeared within the gauge volume. On the other hand, typical pseudo-strains, which are well known, did appear in through-surface strain measurements when the gauge volume was incompletely filled by the sample. Tensile pseudo-strains due to the surface-effect increased near the sample surface and exhibited a similar trend regardless of the size of the gauge volume, while the pseudo-strains increased faster for the smaller gauge volume. Furthermore, a pseudo-strain due to a change in the ncog position was observed even when the gauge volume was perfectly filled in the sample, and it increased with an increase in the size of the gauge volume. These pseudo-strains measured were much larger than those simulated by the conventional modeling, whereas they were simulated by taking into account an incident neutron beam divergence additionally in the model. Therefore, the incident divergence of the incident neutron beam must be carefully designed to avoid pseudo-strains in time-of-flight neutron diffractometry

A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses.

Science.gov (United States)

Szpara, Moriah L; Tafuri, Yolanda R; Parsons, Lance; Shamim, S Rafi; Verstrepen, Kevin J; Legendre, Matthieu; Enquist, L W

2011-10-01

Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1) and 2, and varicella zoster virus (VZV). These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV), causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs), a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit limited sequence

Hydrogen production from microbial strains

Science.gov (United States)

Harwood, Caroline S; Rey, Federico E

2012-09-18

The present invention is directed to a method of screening microbe strains capable of generating hydrogen. This method involves inoculating one or more microbes in a sample containing cell culture medium to form an inoculated culture medium. The inoculated culture medium is then incubated under hydrogen producing conditions. Once incubating causes the inoculated culture medium to produce hydrogen, microbes in the culture medium are identified as candidate microbe strains capable of generating hydrogen. Methods of producing hydrogen using one or more of the microbial strains identified as well as the hydrogen producing strains themselves are also disclosed.

Bacteriocin-like inhibitory activities of seven Lactobacillus delbrueckii subsp. bulgaricus strains against antibiotic susceptible and resistant Helicobacter pylori strains.

Science.gov (United States)

Boyanova, L; Gergova, G; Markovska, R; Yordanov, D; Mitov, I

2017-12-01

The aim of the study was to detect anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains by four cell-free supernatant (CFS) types. Activity of non-neutralized and non-heat-treated (CFSs1), non-neutralized and heat-treated (CFSs2), pH neutralized, catalase-treated and non-heat-treated (CFSs3), or neutralized, catalase- and heat-treated (CFSs4) CFSs against 18 H. pylori strains (11 of which with antibiotic resistance) was evaluated. All GLB strains produced bacteriocin-like inhibitory substances (BLISs), the neutralized CFSs of two GLB strains inhibited >81% of test strains and those of four GLB strains were active against >71% of antibiotic resistant strains. Two H. pylori strains were BLIS resistant. The heating did not reduce the CFS activity. Briefly, all GLB strains evaluated produced heat-stable BLISs, although GLB and H. pylori strain susceptibility patterns exhibited differences. Bacteriocin-like inhibitory substance activity can be an advantage for the probiotic choice for H. pylori infection control. In this study, anti-Helicobacter pylori activity of seven Lactobacillus delbrueckii subsp. bulgaricus (GLB) strains was evaluated by four cell-free supernatant (CFS) types. The GLB strains produced heat-stable bacteriocin-like inhibitory substances (BLISs) with a strong anti-H. pylori activity and some neutralized, catalase- and heat-treated CFSs inhibited >83% of the test strains. Bacteriocin-like inhibitory substance production of GLB strains can render them valuable probiotics in the control of H. pylori infection. © 2017 The Society for Applied Microbiology.

Validity of Serum Testosterone, Free Androgen Index, and Calculated Free Testosterone in Women with Suspected Hyperandrogenism

Directory of Open Access Journals (Sweden)

Manal K. Al Kindi

2012-11-01

Full Text Available Objectives: There are technical limitations for the currently available methods of measuring serum total and free testosteronein females. The study objectives were to evaluate the usefulness of serum total testosterone, sex hormone-binding globulin (SHBG, free androgen index (FAI, and calculated free testosterone (CFT in the assessment of androgen status in women investigated for suspected hyperandrogenism.Methods: This is a case control study that was conducted during the period from 1st May 2011 to 31st October 2011 on 122 patients aged (18-45 years whom were referred to the Clinical Biochemistry Laboratory from the Endocrinology and Gynecology Clinics, Royal Hospital, Oman. Women with no clinical feature or laboratory data indicative of hormonal dysfunction and with midluteal progesterone >30 nmol/L were selected as controls (group 1; n=18. The patients were divided into subgroups based on the clinical/laboratory diagnosis of polycystic ovary syndrome (PCOS [group 2; n=19, hirsutism (group 3; n=18, menstrual disturbances (irregularities or infertility (group 4; n=49, as well as combination of PCOS or hirsutism and menstrual disturbances or infertility (group 5;n=18. Serum total testosterone and SHBG were measured, FAI was calculated as percentage ratio of total testosterone to SHBG values, and CFT was calculated according to Vermeulen equation.Results: There was a statistically significant difference in the mean levels of testosterone, FAI and CFT in each patient group compared with the control group. For diagnosing hyperandrogenism, each indicator was selected at the recommended cut-off: testosterone >3.0 nmol/L, SHBG 5%, and CFT >32 pmol/L. In group 2, 89.5% and 94.7% of the patients had increased FAI and CFT, respectively; compared with 36.4% for increased testosterone. In group 3, 88.9% and 88.9% of the patients had similarly increased FAI and CFT, respectively; compared with 66.7% for testosterone. In group 4, patients had 63.3% and 73

Pin clad strains in Phenix

International Nuclear Information System (INIS)

Languille, A.

1979-07-01

The Phenix reactor has operated for 4 years in a satisfactory manner. The first 2 sub-assembly loadings contained pins clad in solution treated 316. The principal pin strains are: diametral strain (swelling and irradiation creep), ovality and spiral bending of the pin (interaction of wire and pin cluster and wrapper). A pin cluster irradiated to a dose of 80 dpa F reached a pin diameter strain of 5%. This strain is principally due to swelling (low fission gas pressure). The principal parameters governing the swelling are instantaneous dose, time and temperature for a given type of pin cladding. Other types of steel are or will be irradiated in Phenix. In particular, cold-worked titanium stabilised 316 steel should contribute towards a reduction in the pin clad strains and increase the target burn-up in this reactor. (author)

Strain screen and haplotype association mapping of wheel running in inbred mouse strains.

Science.gov (United States)

Lightfoot, J Timothy; Leamy, Larry; Pomp, Daniel; Turner, Michael J; Fodor, Anthony A; Knab, Amy; Bowen, Robert S; Ferguson, David; Moore-Harrison, Trudy; Hamilton, Alicia

2010-09-01

Previous genetic association studies of physical activity, in both animal and human models, have been limited in number of subjects and genetically homozygous strains used as well as number of genomic markers available for analysis. Expansion of the available mouse physical activity strain screens and the recently published dense single-nucleotide polymorphism (SNP) map of the mouse genome (approximately 8.3 million SNPs) and associated statistical methods allowed us to construct a more generalizable map of the quantitative trait loci (QTL) associated with physical activity. Specifically, we measured wheel running activity in male and female mice (average age 9 wk) in 41 inbred strains and used activity data from 38 of these strains in a haplotype association mapping analysis to determine QTL associated with activity. As seen previously, there was a large range of activity patterns among the strains, with the highest and lowest strains differing significantly in daily distance run (27.4-fold), duration of activity (23.6-fold), and speed (2.9-fold). On a daily basis, female mice ran further (24%), longer (13%), and faster (11%). Twelve QTL were identified, with three (on Chr. 12, 18, and 19) in both male and female mice, five specific to males, and four specific to females. Eight of the 12 QTL, including the 3 general QTL found for both sexes, fell into intergenic areas. The results of this study further support the findings of a moderate to high heritability of physical activity and add general genomic areas applicable to a large number of mouse strains that can be further mined for candidate genes associated with regulation of physical activity. Additionally, results suggest that potential genetic mechanisms arising from traditional noncoding regions of the genome may be involved in regulation of physical activity.

Temperature and strain registration by fibre-optic strain sensor in the polymer composite materials manufacturing

Science.gov (United States)

Matveenko; Kosheleva; Shardakov; Voronkov

2018-04-01

The presence of process-induced strains induced by various manufacturing and operational factors is one of the characteristics of polymer composite materials (PCM). Conventional methods of registration and evaluation of process-induced strains can be laborious, time-consuming and demanding in terms of technical applications. The employment of embedded fibre-optic strain sensors (FOSS) offers a real prospect of measuring residual strains. This paper demonstrates the potential for using embedded FOSS for recording technological strains in a PCM plate. The PCM plate is manufactured from prepreg, using the direct compression-moulding method. In this method, the prepared reinforcing package is placed inside a mould, heated, and then exposed to compaction pressure. The examined technology can be used for positioning FOSS between the layers of the composite material. Fibre-optic sensors, interacting with the material of the examined object, make it possible to register the evolution of the strain process during all stages of polymer-composite formation. FOSS data were recorded with interrogator ASTRO X 327. The obtained data were processed using specially developed algorithms.

Sensitivity Enhancement of FBG-Based Strain Sensor.

Science.gov (United States)

Li, Ruiya; Chen, Yiyang; Tan, Yuegang; Zhou, Zude; Li, Tianliang; Mao, Jian

2018-05-17

A novel fiber Bragg grating (FBG)-based strain sensor with a high-sensitivity is presented in this paper. The proposed FBG-based strain sensor enhances sensitivity by pasting the FBG on a substrate with a lever structure. This typical mechanical configuration mechanically amplifies the strain of the FBG to enhance overall sensitivity. As this mechanical configuration has a high stiffness, the proposed sensor can achieve a high resonant frequency and a wide dynamic working range. The sensing principle is presented, and the corresponding theoretical model is derived and validated. Experimental results demonstrate that the developed FBG-based strain sensor achieves an enhanced strain sensitivity of 6.2 pm/με, which is consistent with the theoretical analysis result. The strain sensitivity of the developed sensor is 5.2 times of the strain sensitivity of a bare fiber Bragg grating strain sensor. The dynamic characteristics of this sensor are investigated through the finite element method (FEM) and experimental tests. The developed sensor exhibits an excellent strain-sensitivity-enhancing property in a wide frequency range. The proposed high-sensitivity FBG-based strain sensor can be used for small-amplitude micro-strain measurement in harsh industrial environments.

Haemophilus ducreyi Cutaneous Ulcer Strains Diverged from Both Class I and Class II Genital Ulcer Strains: Implications for Epidemiological Studies.

Directory of Open Access Journals (Sweden)

Dharanesh Gangaiah

2016-12-01

Full Text Available Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown.We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree.CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.

Haemophilus ducreyi Cutaneous Ulcer Strains Diverged from Both Class I and Class II Genital Ulcer Strains: Implications for Epidemiological Studies.

Science.gov (United States)

Gangaiah, Dharanesh; Spinola, Stanley M

2016-12-01

Haemophilus ducreyi has emerged as a major cause of cutaneous ulcers (CU) in yaws-endemic regions of the tropics in the South Pacific, South East Asia and Africa. H. ducreyi was once thought only to cause the genital ulcer (GU) disease chancroid; GU strains belong to 2 distinct classes, class I and class II. Using whole-genome sequencing of 4 CU strains from Samoa, 1 from Vanuatu and 1 from Papua New Guinea, we showed that CU strains diverged from the class I strain 35000HP and that one CU strain expressed β-lactamase. Recently, the Center for Disease Control and Prevention released the genomes of 11 additional CU strains from Vanuatu and Ghana; however, the evolutionary relationship of these CU strains to previously-characterized CU and GU strains is unknown. We performed phylogenetic analysis of 17 CU and 10 GU strains. Class I and class II GU strains formed two distinct clades. The class I strains formed two subclades, one containing 35000HP and HD183 and the other containing the remainder of the class I strains. Twelve of the CU strains formed a subclone under the class I 35000HP subclade, while 2 CU strains formed a subclone under the other class I subclade. Unexpectedly, 3 of the CU strains formed a subclone under the class II clade. Phylogenetic analysis of dsrA-hgbA-ncaA sequences yielded a tree similar to that of whole-genome phylogenetic tree. CU strains diverged from multiple lineages within both class I and class II GU strains. Multilocus sequence typing of dsrA-hgbA-ncaA could be reliably used for epidemiological investigation of CU and GU strains. As class II strains grow relatively poorly and are relatively more susceptible to vancomycin than class I strains, these findings have implications for methods to recover CU strains. Comparison of contemporary CU and GU isolates would help clarify the relationship between these entities.

Acquisition Management System and Data Requirements Control List

Science.gov (United States)

1998-04-01

o m Moio^Lnun o in ID r-or-r-r-vD -J (*) (N ^^jt^sJt^CN HÖH HHHHHH COCOCOLDCOCOCOCOCOCO r« o PH o PH pii PH 0- 0. PH r>l t...y^ w H W H H J Cfl W W W CO W CU ffi IX) P* CO Cft o CO CO CO CO Cft Cft o H oj rn o o o o HHHHHH OOOOOOOOOOOOOOHHH (N

Strain quantification in epitaxial thin films

International Nuclear Information System (INIS)

Cushley, M

2008-01-01

Strain arising in epitaxial thin films can be beneficial in some cases but devastating in others. By altering the lattice parameters, strain may give a thin film properties hitherto unseen in the bulk material. On the other hand, heavily strained systems are prone to develop lattice defects in order to relieve the strain, which can cause device failure or, at least, a decrease in functionality. Using convergent beam electron diffraction (CBED) and high-resolution transmission electron microscopy (HRTEM), it is possible to determine local strains within a material. By comparing the results from CBED and HRTEM experiments, it is possible to gain a complete view of a material, including the strain and any lattice defects present. As well as looking at how the two experimental techniques differ from each other, I will also look at how results from different image analysis algorithms compare. Strain in Si/SiGe samples and BST/SRO/MgO capacitor structures will be discussed.

Brucella abortus strain 2308 Wisconsin genome: importance of the definition of reference strains

Directory of Open Access Journals (Sweden)

Marcela Suárez-Esquivel

2016-09-01

Full Text Available Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing (WGS analysis of the reference strain Brucella abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version at www.wikipedia.Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised.

An evaluation of the impact of introducing compassion focused therapy to a standard treatment programme for people with eating disorders.

Science.gov (United States)

Gale, Corinne; Gilbert, Paul; Read, Natalie; Goss, Ken

2014-01-01

This study explored the outcome of introducing Compassion Focused Therapy (CFT) into a standard treatment programme for people with eating disorders. In particular, the aim was to evaluate the principle that CFT can be used with people with eating disorders and improve eating disorder symptomatology. Routinely collected questionnaire data were used to assess cognitive and behavioural aspects of eating disorders and social functioning/well being (n = 99). There were significant improvements on all questionnaire measures during the programme. An analysis by diagnosis found that people with bulimia nervosa improved significantly more than people with anorexia nervosa on most of the subscales. Also, in terms of clinical significance, 73% of those with bulimia nervosa were considered to have made clinically reliable and significant improvements at the end of treatment (compared with 21% of people with anorexia nervosa and 30% of people with atypical eating disorders). This study demonstrates the potential benefits of using CFT with people with eating disorders and highlights the need for further research on this new approach. CFT offers new ways to conceptualize and formulate some of the self-critical and shame-based difficulties associated with eating disorders. CFT offers a framework that can enable people with eating disorders to conceptualize their difficulties in different ways. CFT can be combined with standard therapies especially cognitive behavioural therapy. CFT can be especially useful in a group context where the relationships between members can become increasingly compassionate, validating, supportive and encouraging. Copyright © 2012 John Wiley & Sons, Ltd.

Molecular characterization of the probiotic strain Bacillus cereus var. toyoi NCIMB 40112 and differentiation from food poisoning strains.

Science.gov (United States)

Klein, Günter

2011-07-01

Bacillus cereus var. toyoi strain NCIMB 40112 (Toyocerin), a probiotic authorized in the European Union as feed additive for swine, bovines, poultry, and rabbits, was characterized by DNA fingerprinting applying pulsed-field gel electrophoresis and multilocus sequence typing and was compared with reference strains (of clinical and environmental origins). The probiotic strain was clearly characterized by pulsed-field gel electrophoresis using the restriction enzymes Apa I and Sma I resulting in unique DNA patterns. The comparison to the clinical reference strain B. cereus DSM 4312 was done with the same restriction enzymes, and again a clear differentiation of the two strains was possible by the resulting DNA patterns. The use of the restriction enzymes Apa I and Sma I is recommended for further studies. Furthermore, multilocus sequence typing analysis revealed a sequence type (ST 111) that was different from all known STs of B. cereus strains from food poisoning incidents. Thus, a strain characterization and differentiation from food poisoning strains for the probiotic strain was possible. Copyright ©, International Association for Food Protection

Microstructure and strain distribution in freestanding Si membrane strained by Si{sub x}N{sub y} deposition

Energy Technology Data Exchange (ETDEWEB)

Gao Hongye, E-mail: qgaohongye@msn.com [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Ikeda, Ken-ichi; Hata, Satoshi; Nakashima, Hideharu [Faculty of Engineering Sciences, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan); Wang Dong; Nakashima, Hiroshi [Art, Science and Technology Center for Cooperative Research, Kyushu University, 6-1 Kasuga-koen, Kasuga, Fukuoka 816-8580 (Japan)

2010-09-25

Research highlights: {yields} Strain is introduced by deposition of amorphous Si{sub x}N{sub y} to improve the carrier mobility for a relatively large-size freestanding semiconductor film, which can be used for the fabrication of relatively large devices such like a bipolar junction transistor. However, standard Raman spectroscopy and X-ray diffraction cannot provide sufficient lateral resolution to the strain in a relatively long (x {mu}m in length) and thin (x nm in thickness) freestanding semiconductor film. {yields} In present research, strain in a bridge-shaped freestanding Si membrane (FSSM) was measured by convergent-beam electron diffraction (CBED) and finite element method (FEM). Compressive strain distribution was shown in three dimensions (3D) in FSSM, where no threading dislocation or stacking fault was found. Relaxation of the strain in FSSM in 3D was discussed based on a comparison of the strain magnitudes in FSSM as measured by CBED and FEM. - Abstract: Strain in a bridge-shaped freestanding Si membrane (FSSM) induced by depositing an amorphous Si{sub x}N{sub y} layer was measured by convergent-beam electron diffraction (CBED). CBED results show that the strain magnitude depends negatively on the FSSM thickness. FEM is a supplement of the result of CBED due to the relaxation of TEM samples during fabricating. The FEM analysis results ascertain the strain property in three dimensions, and show that the strain magnitude depends negatively on the length of FSSM, and the magnitude of the compressive strain in FSSM increases as the position is closer to the upper Si/Si{sub x}N{sub y} interface.

The asymptomatic bacteriuria Escherichia coli strain 83972 outcompetes uropathogenic E. coli strains in human urine

DEFF Research Database (Denmark)

Hancock, Viktoria; Ulett, G.C.; Schembri, M.A.

2006-01-01

Escherichia coli is the most common organism associated with asymptomatic bacteriuria (ABU). In contrast to uropathogenic E. coli (UPEC), which causes symptomatic urinary tract infections (UTI), very little is known about the mechanisms by which these strains colonize the human urinary tract....... The prototype ABU E. coli strain 83972 was originally isolated from a girl who had carried it asymptomatically for 3 years. Deliberate colonization of UTI-susceptible individuals with E. coli 83972 has been used successfully as an alternative approach for the treatment of patients who are refractory...... to conventional therapy. Colonization with strain 83972 appears to prevent infection with UPEC strains in such patients despite the fact that this strain is unable to express the primary adhesins involved in UTI, viz. P and type 1 fimbriae. Here we investigated the growth characteristics of E. coli 83972 in human...

Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

International Nuclear Information System (INIS)

Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil

2009-01-01

In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Acquirement of true stress-strain curve using true fracture strain obtained by tensile test and FE analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Kim, Tae Hyung; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of)

2009-07-01

In this work, we predict a true fracture strain using load-displacement curves from tensile test and Finite Element Analysis (FEA), and suggest a method for acquiring true Stress-Strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Acquirement of True Stress-strain Curve Using True Fracture Strain Obtained by Tensile Test and FE Analysis

Energy Technology Data Exchange (ETDEWEB)

Lee, Kyoung Yoon; Lee, Hyung Yil [Sogang University, Seoul (Korea, Republic of); Kim, Tae Hyung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2009-10-15

In this work, we predict a true fracture strain using load-displacement curves from tensile test and finite element analysis (FEA), and suggest a method for acquiring true stress-strain (SS) curves by predicted fracture strain. We first derived the true SS curve up to necking point from load-displacement curve. As the beginning, the posterior necking part of true SS curve is linearly extrapolated with the slope at necking point. The whole SS curve is then adopted for FE simulation of tensile test. The Bridgman factor or suitable plate correction factors are applied to pre and post FEA. In the load-true strain curve from FEA, the true fracture strain is determined as the matching point to test fracture load. The determined true strain is validated by comparing with test fracture strain. Finally, we complete the true SS curve by combining the prior necking part and linear part, the latter of which connects necking and predicted fracture points.

Atlas of stress-strain curves

CERN Document Server

2002-01-01

The Atlas of Stress-Strain Curves, Second Edition is substantially bigger in page dimensions, number of pages, and total number of curves than the previous edition. It contains over 1,400 curves, almost three times as many as in the 1987 edition. The curves are normalized in appearance to aid making comparisons among materials. All diagrams include metric (SI) units, and many also include U.S. customary units. All curves are captioned in a consistent format with valuable information including (as available) standard designation, the primary source of the curve, mechanical properties (including hardening exponent and strength coefficient), condition of sample, strain rate, test temperature, and alloy composition. Curve types include monotonic and cyclic stress-strain, isochronous stress-strain, and tangent modulus. Curves are logically arranged and indexed for fast retrieval of information. The book also includes an introduction that provides background information on methods of stress-strain determination, on...

Graphene spin diode: Strain-modulated spin rectification

Energy Technology Data Exchange (ETDEWEB)

Wang, Yunhua; Wang, B., E-mail: stslyl@mail.sysu.edu.cn, E-mail: wangbiao@mail.sysu.edu.cn [Sino-French Institute of Nuclear Engineering and Technology, School of Physics and Engineering, State Key Laboratory of Optoelectronic Materials and Technologies, Sun Yat-sen University, Guangzhou 510275 (China); Liu, Yulan, E-mail: stslyl@mail.sysu.edu.cn, E-mail: wangbiao@mail.sysu.edu.cn [School of Engineering, Sun Yat-sen University, Guangzhou 510275 (China)

2014-08-04

Strain effects on spin transport in a ferromagnetic/strained/normal graphene junction are explored theoretically. It is shown that the spin-resolved Fermi energy range can be controlled by the armchair direction strain because the strain-induced pseudomagnetic field suppresses the current. The spin rectification effect for the bias reversal occurs because of a combination of ferromagnetic exchange splitting and the broken spatial symmetry of the junction. In addition, the spin rectification performance can be tuned remarkably by manipulation of the strains. In view of this strain-modulated spin rectification effect, we propose that the graphene-based ferromagnetic/strained/normal junction can be used as a tunable spin diode.

Lactobacillus acidophilus induces a slow but more sustained chemokine and cytokine response in naïve foetal enterocytes compared to commensal Escherichia coli

Directory of Open Access Journals (Sweden)

Nellemann Christine

2010-01-01

Full Text Available Abstract Background The first exposure to microorganisms at mucosal surfaces is critical for immune maturation and gut health. Facultative anaerobic bacteria are the first to colonise the infant gut, and the impact of these bacteria on intestinal epithelial cells (IEC may be determinant for how the immune system subsequently tolerates gut bacteria. Results To mirror the influence of the very first bacterial stimuli on infant IEC, we isolated IEC from mouse foetuses at gestational day 19 and from germfree neonates. IEC were stimulated with gut-derived bacteria, Gram-negative Escherichia coli Nissle and Gram-positive Lactobacillus acidophilus NCFM, and expression of genes important for immune regulation was measured together with cytokine production. E. coli Nissle and L. acidophilus NCFM strongly induced chemokines and cytokines, but with different kinetics, and only E. coli Nissle induced down-regulation of Toll-like receptor 4 and up-regulation of Toll-like receptor 2. The sensitivity to stimulation was similar before and after birth in germ-free IEC, although Toll-like receptor 2 expression was higher before birth than immediately after. Conclusions In conclusion, IEC isolated before gut colonisation occurs at birth, are highly responsive to stimulation with gut commensals, with L. acidophilus NCFM inducing a slower, but more sustained response than E. coli Nissle. E. coli may induce intestinal tolerance through very rapid up-regulation of chemokine and cytokine genes and down-regulation of Toll-like receptor 4, while regulating also responsiveness to Gram-positive bacteria.

[Curcumin alleviates early brain injury following subarachnoid hemorrhage in rats by inhibiting JNK/c-Jun signal pathway].

Science.gov (United States)

Li, Xia; Zhu, Ji

2018-03-01

Objective To investigate the inhibitory effect of curcumin on early brain injury following subarachnoid hemorrhage (SAH) by inhibiting JNK/ c-Jun signal pathway. Methods Sixty adult male SD rats were randomly divided into four groups: sham operation group (sham group), SAH group, SAH group treated with 100 mg/(kg.d) curcumin and SAH group treated with 200 mg/(kg.d) curcumin, with 15 rats in each group. Endovascular puncture was used to induce SAH model. Nissl staining was used to test whether neurons were broken. TUNEL staining was used to detect apoptosis. Immunohistochemistry was used to investigate the expression of caspase-3. Western blot analysis was used to detect the expressions of p-JNK, JNK, p-c-Jun, c-Jun, and caspase-3. Results Nissl staining indicated the decrease of Nissl bodies in SAH group, but increase of Nissl bodies in SAH group treated with curcumin. TUNEL staining showed that there were more apoptotic neurons in SAH group compared with sham group, while apoptotic neurons decreased after the treatment with curcumin, more obviously in the group treated with 200 mg/(kg.d) curcumin. The expressions of p-JNK, JNK, p-c-Jun, c-Jun, and caspase-3 were up-regulated in SAH group compared with sham group. However, the expressions of those proteins were down-regulated after the treatment with curcumin, especially by higher-dose curcumin treatment. Conclusion Curcumin might suppress early brain injury after SAH by inhibiting JNK/c-Jun signal pathway and neuron apoptosis.

Development of Industrial Yeast Platform Strains

DEFF Research Database (Denmark)

Bergdahl, Basti; Dato, Laura; Förster, Jochen

2014-01-01

Most of the current metabolic engineering projects are carried out using laboratory strains as the starting host. Although such strains are easily manipulated genetically, their robustness does not always meet the requirements set by industrial fermentation conditions. In such conditions, the cells...... screening of the 36 industrial and laboratory yeast strains. In addition, progress in the development of molecular biology methods for generating the new strains will be presented....

Taxonomic and Strain-Specific Identification of the Probiotic Strain Lactobacillus rhamnosus 35 within the Lactobacillus casei Group▿

Science.gov (United States)

Coudeyras, Sophie; Marchandin, Hélène; Fajon, Céline; Forestier, Christiane

2008-01-01

Lactobacilli are lactic acid bacteria that are widespread in the environment, including the human diet and gastrointestinal tract. Some Lactobacillus strains are regarded as probiotics because they exhibit beneficial health effects on their host. In this study, the long-used probiotic strain Lactobacillus rhamnosus 35 was characterized at a molecular level and compared with seven reference strains from the Lactobacillus casei group. Analysis of rrn operon sequences confirmed that L. rhamnosus 35 indeed belongs to the L. rhamnosus species, and both temporal temperature gradient gel electrophoresis and ribotyping showed that it is closer to the probiotic strain L. rhamnosus ATCC 53103 (also known as L. rhamnosus GG) than to the species type strain. In addition, L. casei ATCC 334 gathered in a coherent cluster with L. paracasei type strains, unlike L. casei ATCC 393, which was closer to L. zeae; this is evidence of the lack of relatedness between the two L. casei strains. Further characterization of the eight strains by pulsed-field gel electrophoresis repetitive DNA element-based PCR identified distinct patterns for each strain, whereas two isolates of L. rhamnosus 35 sampled 40 years apart could not be distinguished. By subtractive hybridization using the L. rhamnosus GG genome as a driver, we were able to isolate five L. rhamnosus 35-specific sequences, including two phage-related ones. The primer pairs designed to amplify these five regions allowed us to develop rapid and highly specific PCR-based identification methods for the probiotic strain L. rhamnosus 35. PMID:18326671

Brucella abortus Strain 2308 Wisconsin Genome: Importance of the Definition of Reference Strains

Science.gov (United States)

Suárez-Esquivel, Marcela; Ruiz-Villalobos, Nazareth; Castillo-Zeledón, Amanda; Jiménez-Rojas, César; Roop II, R. Martin; Comerci, Diego J.; Barquero-Calvo, Elías; Chacón-Díaz, Carlos; Caswell, Clayton C.; Baker, Kate S.; Chaves-Olarte, Esteban; Thomson, Nicholas R.; Moreno, Edgardo; Letesson, Jean J.; De Bolle, Xavier; Guzmán-Verri, Caterina

2016-01-01

Brucellosis is a bacterial infectious disease affecting a wide range of mammals and a neglected zoonosis caused by species of the genetically homogenous genus Brucella. As in most studies on bacterial diseases, research in brucellosis is carried out by using reference strains as canonical models to understand the mechanisms underlying host pathogen interactions. We performed whole genome sequencing analysis of the reference strain B. abortus 2308 routinely used in our laboratory, including manual curated annotation accessible as an editable version through a link at https://en.wikipedia.org/wiki/Brucella#Genomics. Comparison of this genome with two publically available 2308 genomes showed significant differences, particularly indels related to insertional elements, suggesting variability related to the transposition of these elements within the same strain. Considering the outcome of high resolution genomic techniques in the bacteriology field, the conventional concept of strain definition needs to be revised. PMID:27746773

Different distribution patterns of ten virulence genes in Legionella reference strains and strains isolated from environmental water and patients.

Science.gov (United States)

Zhan, Xiao-Yong; Hu, Chao-Hui; Zhu, Qing-Yi

2016-04-01

Virulence genes are distinct regions of DNA which are present in the genome of pathogenic bacteria and absent in nonpathogenic strains of the same or related species. Virulence genes are frequently associated with bacterial pathogenicity in genus Legionella. In the present study, an assay was performed to detect ten virulence genes, including iraA, iraB, lvrA, lvrB, lvhD, cpxR, cpxA, dotA, icmC and icmD in different pathogenicity islands of 47 Legionella reference strains, 235 environmental strains isolated from water, and 4 clinical strains isolated from the lung tissue of pneumonia patients. The distribution frequencies of these genes in reference or/and environmental L. pneumophila strains were much higher than those in reference non-L. pneumophila or/and environmental non-L. pneumophila strains, respectively. L. pneumophila clinical strains also maintained higher frequencies of these genes compared to four other types of Legionella strains. Distribution frequencies of these genes in reference L. pneumophila strains were similar to those in environmental L. pneumophila strains. In contrast, environmental non-L. pneumophila maintained higher frequencies of these genes compared to those found in reference non-L. pneumophila strains. This study illustrates the association of virulence genes with Legionella pathogenicity and reveals the possible virulence evolution of non-L. pneumophia strains isolated from environmental water.

Decisive role of lipopolysaccharide in activating nitric oxide and cytokine production by the probiotic Escherichia coli strain Nissle 1917

Czech Academy of Sciences Publication Activity Database

Zídek, Zdeněk; Kmoníčková, Eva; Kostecká, Petra; Tlaskalová-Hogenová, Helena

2010-01-01

Roč. 55, č. 2 (2010), s. 181-189 ISSN 0015-5632 R&D Projects: GA ČR GA305/08/0535 Institutional research plan: CEZ:AV0Z50390512; CEZ:AV0Z50200510 Keywords : Lipopolysaccharide * Nitric Oxide * Escherichia coli Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 0.977, year: 2010

Development of high temperature strain gage, (5)

International Nuclear Information System (INIS)

Yuuki, Hiroshi; Kobayashi, Yukio; Kanai, Kenji; Yamaura, Yoshio

1976-01-01

Development and improvement of resistance wire type strain gages usable for experimental measurement of thermal strains generated at high temperature in various structures and equipments that consist of a Fast Breeder Reactor have been carried out, and various characteristics of the strain gages have been investigated. Based on the results obtained up to now, development and research of this time mainly aim to improve strain and fatigue characteristics. As the results, characteristics of strain gages with sensing elements of nichrome V are improved, specifically mechanical hysteresis is decreased, strain limit is increased, etc. Also, improvement is recognized in thermal output, and it becomes clear that dummy gages work effectively. However, a filling method of MgO and an inserting method of active-dummy elements are selected as primary objects to improve strain characteristics, and many hours are taken for these objects, so confirmations of characteristics of platinum-tungsten strain gages, strain sensing elements of which are troublesome to produce, have not been completely done, though the performance of the gages has been improved in several points. As to nichrome V strain gages, there is a fair prospect of obtaining ones, specifications of which are quite close to the goal, though problems in manufacturing technics remain for future. As to platinum-tungsten strain gages, it is expected that similar strain gages to nichrome V are obtainable by improvement in manufacturing of sensing elements. (auth.)

Differentiation of five strains of infectious bursal disease virus: Development of a strain-specific multiplex PCR

DEFF Research Database (Denmark)

Kusk, M.; Kabell, Susanne; Jørgensen, Poul Henrik

2005-01-01

and histopathology. Since these methods are laborious and have low specificity alternatives are needed. In the present study, we report the development of a strain-specific multiplex RT-PCR technique, which can detect and differentiate between field strains of IBDV and vaccine virus strains including a so-called hot...

MM98.57 Quantification of Combined Strain Paths

DEFF Research Database (Denmark)

Nielsen, Morten Sturgård; Wanheim, Tarras

1998-01-01

this curve into useful scalar relations from experimental data.The strain history for plane strain when assuming volume constancy may be plotted in a shear strain, normal strain diagram, which has the property of showing both the rotation of principal deformation axes during the deformation and the amount...... is to describe the total strain history as a curve in the 6-dimensional shear strain, normal strain space. In order to be able to use these experimental data for calculation, the development of this strain curve must be transformed into a set of scalar relations that may be used for predicting the yield surface...... at a given point in a new strain history. A simple example of this concept is to take the length of the strain curve as describing scalar relation: E.g. to use the equivalent strain as parameter for describing the yield stress. This paper focuses on the strain curve concept and the possibilities to convert...

Job strain and male fertility.

Science.gov (United States)

Hjollund, Niels Henrik I; Bonde, Jens Peter E; Henriksen, Tine Brink; Giwercman, Aleksander; Olsen, Jørn

2004-01-01

Job strain, defined as high job demands and low job control, has not previously been explored as a possible determinant of male fertility. We collected prospective data on job strain among men, and describe the associations with semen quality and probability of conceiving a clinical pregnancy during a menstrual cycle. Danish couples (N = 399) who were trying to become pregnant for the first time were followed for up to 6 menstrual periods. All men collected semen samples, and a blood sample was drawn from both partners. Job demand and job control were measured by a self-administered questionnaire at entry, and in each cycle the participants recorded changes in job control or job demand during the previous 30 days. In adjusted analyses, no associations were found between any semen characteristic or sexual hormones and any job strain variable. The odds for pregnancy were not associated with job strain. Psychologic job strain encountered in normal jobs in Denmark does not seem to affect male reproductive function.

Improved thermal stability and hole mobilities in a strained-Si/strained-Si1-yGe y/strained-Si heterostructure grown on a relaxed Si1-xGe x buffer

International Nuclear Information System (INIS)

Gupta, Saurabh; Lee, Minjoo L.; Isaacson, David M.; Fitzgerald, Eugene A.

2005-01-01

A dual channel heterostructure consisting of strained-Si/strained-Si 1-y Ge y on relaxed Si 1-x Ge x (y > x), provides a platform for fabricating metal-oxide-semiconductor field-effect transistors (MOSFETs) with high hole mobilities (μ eff ) which depend directly on Ge concentration and strain in the strained-Si 1-y Ge y layer. Ge out-diffuses from the strained-Si 1-y Ge y layer into relaxed Si 1-x Ge x during high temperature processing, reducing peak Ge concentration and strain in the strained-Si 1-y Ge y layer and degrades hole μ eff in these dual channel heterostructures. A heterostructure consisting of strained-Si/strained-Si 1-y Ge y /strained-Si, referred to as a trilayer heterostructure, grown on relaxed Si 1-x Ge x has much reduced Ge out-flux from the strained-Si 1-y Ge y layer and retains higher μ eff after thermal processing. Improved hole μ eff over similar dual channel heterostructures is also observed in this heterostructure. This could be a result of preventing the hole wavefunction tunneling into the low μ eff relaxed Si 1-x Ge x layer due to the additional valence band offset provided by the underlying strained-Si layer. A diffusion coefficient has been formulated and implemented in a finite difference scheme for predicting the thermal budget of the strained SiGe heterostructures. It shows that the trilayer heterostructures have superior thermal budgets at higher Ge concentrations. Ring-shaped MOSFETs were fabricated on both platforms and subjected to various processing temperatures in order to compare the extent of μ eff reduction with thermal budget. Hole μ eff enhancements are retained to a much higher extent in a trilayer heterostructure after high temperature processing as compared to a dual channel heterostructure. The improved thermal stability and hole μ eff of a trilayer heterostructure makes it an ideal platform for fabricating high μ eff MOSFETs that can be processed over higher temperatures without significant losses in hole �

Predicting creep rupture from early strain data

International Nuclear Information System (INIS)

Holmstroem, Stefan; Auerkari, Pertti

2009-01-01

To extend creep life modelling from classical rupture modelling, a robust and effective parametric strain model has been developed. The model can reproduce with good accuracy all parts of the creep curve, economically utilising the available rupture models. The resulting combined model can also be used to predict rupture from the available strain data, and to further improve the rupture models. The methodology can utilise unfailed specimen data for life assessment at lower stress levels than what is possible from rupture data alone. Master curves for creep strain and rupture have been produced for oxygen-free phosphorus-doped (OFP) copper with a maximum testing time of 51,000 h. Values of time to specific strain at given stress (40-165 MPa) and temperature (125-350 deg. C) were fitted to the models in the strain range of 0.1-38%. With typical inhomogeneous multi-batch creep data, the combined strain and rupture modelling involves the steps of investigation of the data quality, extraction of elastic and creep strain response, rupture modelling, data set balancing and creep strain modelling. Finally, the master curves for strain and rupture are tested and validated for overall fitting efficiency. With the Wilshire equation as the basis for the rupture model, the strain model applies classical parametric principles with an Arrhenius type of thermal activation and a power law type of stress dependence for the strain rate. The strain model also assumes that the processes of primary and secondary creep can be reasonably correlated. The rupture model represents a clear improvement over previous models in the range of the test data. The creep strain information from interrupted and running tests were assessed together with the rupture data investigating the possibility of rupture model improvement towards lower stress levels by inverse utilisation of the combined rupture based strain model. The developed creep strain model together with the improved rupture model is

A wide extent of inter-strain diversity in virulent and vaccine strains of alphaherpesviruses.

Directory of Open Access Journals (Sweden)

Moriah L Szpara

2011-10-01

Full Text Available Alphaherpesviruses are widespread in the human population, and include herpes simplex virus 1 (HSV-1 and 2, and varicella zoster virus (VZV. These viral pathogens cause epithelial lesions, and then infect the nervous system to cause lifelong latency, reactivation, and spread. A related veterinary herpesvirus, pseudorabies (PRV, causes similar disease in livestock that result in significant economic losses. Vaccines developed for VZV and PRV serve as useful models for the development of an HSV-1 vaccine. We present full genome sequence comparisons of the PRV vaccine strain Bartha, and two virulent PRV isolates, Kaplan and Becker. These genome sequences were determined by high-throughput sequencing and assembly, and present new insights into the attenuation of a mammalian alphaherpesvirus vaccine strain. We find many previously unknown coding differences between PRV Bartha and the virulent strains, including changes to the fusion proteins gH and gB, and over forty other viral proteins. Inter-strain variation in PRV protein sequences is much closer to levels previously observed for HSV-1 than for the highly stable VZV proteome. Almost 20% of the PRV genome contains tandem short sequence repeats (SSRs, a class of nucleic acids motifs whose length-variation has been associated with changes in DNA binding site efficiency, transcriptional regulation, and protein interactions. We find SSRs throughout the herpesvirus family, and provide the first global characterization of SSRs in viruses, both within and between strains. We find SSR length variation between different isolates of PRV and HSV-1, which may provide a new mechanism for phenotypic variation between strains. Finally, we detected a small number of polymorphic bases within each plaque-purified PRV strain, and we characterize the effect of passage and plaque-purification on these polymorphisms. These data add to growing evidence that even plaque-purified stocks of stable DNA viruses exhibit

Holographic space and time: Emergent in what sense?

Science.gov (United States)

Vistarini, Tiziana

2017-08-01

This paper proposes a metaphysics for holographic duality. In addition to the AdS/CFT correspondence I also consider the dS/CFT conjecture of duality. Both involve non-perturbative string theory and both are exact dualities. But while the AdS/CFT keeps time at the margins of the story, the dS/CFT conjecture gives to time the "space" it deserves by presenting an interesting holographic model of it. My goals in this paper can be summarized in the following way. First, I argue that the formal structure and physical content of the duality do not support the standard philosophical reading of the relation in terms of grounding. Second, I put forward a philosophical scheme mainly extrapolated from the double aspect monism theory. I read holographic duality in this framework as it seems to fit the mathematical and physical structure of the duality smoothly. Inside this framework I propose a notion of spacetime emergence alternative to those ones commonly debated in the AdS/CFT physics and philosophy circles.

[Characteristics of Lactobacillus strains contained in pharmaceuticals].

Science.gov (United States)

Banach, W; Bucholc, B; Wójcik, B

2001-01-01

The aim of the study was to characterize lactic acid bacteria (LAB) which are components of drugs administered orally in cases of intestinal disturbances, or antibiotic--related diarrhea. Biochemical properties, growth behavior, bile tolerance, and survival at low pH of six LAB strains (four strains L. rhamnosus and two L. acidophilus) were studied. The survival at low pH was determined in MRS broth (Difco) acidified to pH 1; 2; 3; and 4. Bile tolerance was tested on MRS broth with 0.3% oxgall (Difco). Between tested strains differences in ability to grow at low pH and survival in bile were observed. Only 0.01% inoculum of all examined strains survived at pH 1. Differences between strains in survival at low pH (pH 2 and pH 3) and tolerance of bile were observed. However, after 2 h incubation at pH 4, 100% of strains stayed alive. Examined strains demonstrated good 3% bile tolerance. All strains met the criteria for probiotic strains: ability to survive at pH 3 and in the presence of bile.

Strain histograms are equal to strain ratios in predicting malignancy in breast tumours

DEFF Research Database (Denmark)

Carlsen, Jonathan Frederik; Ewertsen, Caroline; Sletting, Susanne

2017-01-01

Objectives: To assess whether strain histograms are equal to strain ratios in predicting breast tumour malignancy and to see if either could be used to upgrade Breast Imaging Reporting and Data System (BI-RADS) 3 tumours for immediate biopsy. Methods: Ninety-nine breast tumours were examined using...

Strains and Stressors: An Analysis of Touchscreen Learning in Genetically Diverse Mouse Strains

Science.gov (United States)

Graybeal, Carolyn; Bachu, Munisa; Mozhui, Khyobeni; Saksida, Lisa M.; Bussey, Timothy J.; Sagalyn, Erica; Williams, Robert W.; Holmes, Andrew

2014-01-01

Touchscreen-based systems are growing in popularity as a tractable, translational approach for studying learning and cognition in rodents. However, while mouse strains are well known to differ in learning across various settings, performance variation between strains in touchscreen learning has not been well described. The selection of appropriate genetic strains and backgrounds is critical to the design of touchscreen-based studies and provides a basis for elucidating genetic factors moderating behavior. Here we provide a quantitative foundation for visual discrimination and reversal learning using touchscreen assays across a total of 35 genotypes. We found significant differences in operant performance and learning, including faster reversal learning in DBA/2J compared to C57BL/6J mice. We then assessed DBA/2J and C57BL/6J for differential sensitivity to an environmental insult by testing for alterations in reversal learning following exposure to repeated swim stress. Stress facilitated reversal learning (selectively during the late stage of reversal) in C57BL/6J, but did not affect learning in DBA/2J. To dissect genetic factors underlying these differences, we phenotyped a family of 27 BXD strains generated by crossing C57BL/6J and DBA/2J. There was marked variation in discrimination, reversal and extinction learning across the BXD strains, suggesting this task may be useful for identifying underlying genetic differences. Moreover, different measures of touchscreen learning were only modestly correlated in the BXD strains, indicating that these processes are comparatively independent at both genetic and phenotypic levels. Finally, we examined the behavioral structure of learning via principal component analysis of the current data, plus an archival dataset, totaling 765 mice. This revealed 5 independent factors suggestive of “reversal learning,” “motivation-related late reversal learning,” “discrimination learning,” “speed to respond,” and �

Relating high-temperature flow stress of AISI 316 stainless steel to strain and strain rate

International Nuclear Information System (INIS)

Matteazzi, S.; Paitti, G.; Boerman, D.

1982-01-01

The authors have performed an experimental determination of tensile stress-strain curves for different strain rates (4.67 x 10 - 5 , 4.67 x 10 - 2 s - 1 ) and for a variety of temperature conditions (773-1073 K) of AISI 316H stainless steel (annealed conditions) and also a computer analysis of the experimental curves using a fitting program which takes into consideration different constitutive relations describing the plastic flow behaviour of the metals. The results show that the materials tested are clearly affected by strain rate only at the highest temperature investigated (1073 K) and that the plastic strain is the more significant variable. Of the constitutive equations considered, Voce's relation gives the best fit for the true stress-time-strain curves. However, the Ludwik and Ludwigson equations also provide a description of the experimental data, whereas Hollomon's equation does not suitably characterize AISI 316H stainless steel and can be applied with some accuracy only at 1073 K. (author)

Evaluating location specific strain rates, temperatures, and accumulated strains in friction welds through microstructure modeling

Directory of Open Access Journals (Sweden)

Javed Akram

2018-04-01

Full Text Available A microstructural simulation method is adopted to predict the location specific strain rates, temperatures, grain evolution, and accumulated strains in the Inconel 718 friction welds. Cellular automata based 2D microstructure model was developed for Inconel 718 alloy using theoretical aspects of dynamic recrystallization. Flow curves were simulated and compared with experimental results using hot deformation parameter obtained from literature work. Using validated model, simulations were performed for friction welds of Inconel 718 alloy generated at three rotational speed i.e., 1200, 1500, and 1500 RPM. Results showed the increase in strain rates with increasing rotational speed. These simulated strain rates were found to match with the analytical results. Temperature difference of 150 K was noticed from center to edge of the weld. At all the rotational speeds, the temperature was identical implying steady state temperature (0.89Tm attainment. Keywords: Microstructure modeling, Dynamic recrystallization, Friction welding, Inconel 718, EBSD, Hot deformation, Strain map

Intraspecies diversity of Lactobacillus sakei response to oxidative stress and variability of strain performance in mixed strains challenges.

Science.gov (United States)

Guilbaud, Morgan; Zagorec, Monique; Chaillou, Stéphane; Champomier-Vergès, Marie-Christine

2012-04-01

Lactobacillus sakei is a meat-borne lactic acid bacterium species exhibiting a wide genomic diversity. We have investigated the diversity of response to various oxidative compounds, between L. sakei strains, among a collection representing the genomic diversity. We observed various responses to the different compounds as well as a diversity of response depending on the aeration conditions used for cell growth. A principal component analysis revealed two main phenotypic groups, partially correlating with previously described genomic clusters. We designed strains mixes composed of three different strains, in order to examine the behavior of each strain, when cultured alone or in the presence of other strains. The strains composing the mixtures were chosen as diverse as possible, i.e. exhibiting diverse responses to oxidative stress and belonging to different genomic clusters. Growth and survival rates of each strain were monitored under various aeration conditions, with or without heme supplementation. The results obtained suggest that some strains may act as "helper" or "burden" strains depending on the oxidative conditions encountered during incubation. This study confirms that resistance to oxidative stress is extremely variable within the L. sakei species and that this property should be considered when investigating starter performance in the complex meat bacterial ecosystems. Copyright © 2011 Elsevier Ltd. All rights reserved.

Genetic analysis of Saccharomyces cerevisiae strains isolated from palm wine in eastern Nigeria. Comparison with other African strains.

Science.gov (United States)

Ezeronye, O U; Legras, J-L

2009-05-01

To study the yeast diversity of Nigerian palm wines by comparison with other African strains. Twenty-three Saccharomyces cerevisiae strains were obtained from palm wine samples collected at four locations in eastern Nigeria, and characterized using different molecular techniques: internal transcribed spacer restriction fragment length polymorphism and sequence analysis, pulsed field gel electrophoresis, inter delta typing and microsatellite multilocus analysis. These techniques revealed that palm wine yeasts represent a group of closely related strains that includes other West African isolates (CBS400, NCYC110, DVPG6044). Population analysis revealed an excess of homozygote strains and an allelic richness similar to wine suggestive of local domestication. Several other African yeast strains were not connected to this group. Ghana sorghum beer strains and other African strains (DBVPG1853 and MUCL28071) displayed strikingly high relatedness with European bread, beer or wine strains, and the genome of strain MUCL30909 contained African and wine-type alleles, indicating its hybrid origin. Nigerian palm wine yeast represents a local specific yeast flora, whereas a European origin or hybrid was suspected for several other Africa isolates. This study presents the first genetic characterization of an autochthonous African palm wine yeast population and confirms the idea that human intervention has favoured yeast migration.

A coarse-grained generalized second law for holographic conformal field theories

Science.gov (United States)

Bunting, William; Fu, Zicao; Marolf, Donald

2016-03-01

We consider the universal sector of a d\\gt 2 dimensional large-N strongly interacting holographic CFT on a black hole spacetime background B. When our CFT d is coupled to dynamical Einstein-Hilbert gravity with Newton constant G d , the combined system can be shown to satisfy a version of the thermodynamic generalized second law (GSL) at leading order in G d . The quantity {S}{CFT}+\\frac{A({H}B,{perturbed})}{4{G}d} is non-decreasing, where A({H}B,{perturbed}) is the (time-dependent) area of the new event horizon in the coupled theory. Our S CFT is the notion of (coarse-grained) CFT entropy outside the black hole given by causal holographic information—a quantity in turn defined in the AdS{}d+1 dual by the renormalized area {A}{ren}({H}{{bulk}}) of a corresponding bulk causal horizon. A corollary is that the fine-grained GSL must hold for finite processes taken as a whole, though local decreases of the fine-grained generalized entropy are not obviously forbidden. Another corollary, given by setting {G}d=0, states that no finite process taken as a whole can increase the renormalized free energy F={E}{out}-{{TS}}{CFT}-{{Ω }}J, with T,{{Ω }} constants set by {H}B. This latter corollary constitutes a 2nd law for appropriate non-compact AdS event horizons.

Internal residual strain mapping in carburized chrome molybdenum steel after quenching by neutron strain scanning

International Nuclear Information System (INIS)

Sakaida, Yoshihisa; Serizawa, Takanobu; Manzanka, Michiya

2011-01-01

A hollow circular cylinder specimen with an annular U-notch of chrome molybdenum steel with 0.20 mass% C (SCM420) was carburized in carrier gas and quenched in oil bath. In order to determine the case depth, the specimen was cut off and carbon content and Vickers hardness gradients were measured experimentally near the carburized surface. The residual strain mapping in the interior of carburized cylinder was conducted nondestructively by neutron strain scanning. In this study, the neutron diffraction from Fe-211 plane was used for strain scanning. The neutron wavelength was tuned to 0.1654nm so that diffraction angle became about 90deg. Radial, hoop and axial residual strains were measured by scanning diffracting volume along the axial direction of cylinder specimen. Each residual strain was calculated from lattice spacing change. Unstressed lattice spacing was determined experimentally using reference coupon specimens that were cut from the interior of same carburized cylinder. As a result, the diffraction peak width at half height, FWHM, near the carburized surface was about 3.7 times wider than that of coupon specimens. On the other hand, the most peak widths in the interior equaled to that of coupon specimens. Peak width broadened slightly as the diffracting volume approached the carburized case layer. From the center to the quarter of cylinder specimen, the hoop and axial strains were tensile, and the radial one was compressive in the interior. From the quarter to the edge of the cylinder specimen, the hoop tensile strain increased, radial and axial strains changed to tensile and compressive, respectively. Therefore, the interior of the cylinder specimen was found to be deformed elastically to balance the existence of compressive residual stresses in the carburized case layer. (author)

Strain gradient effects in surface roughening

DEFF Research Database (Denmark)

Borg, Ulrik; Fleck, N.A.

2007-01-01

evidence for strain gradient effects. Numerical analyses of a bicrystal undergoing in-plane tensile deformation are also studied using a strain gradient crystal plasticity theory and also by using a strain gradient plasticity theory for an isotropic solid. Both theories include an internal material length...

Nanocomposite Strain Gauges Having Small TCRs

Science.gov (United States)

Gregory, Otto; Chen, Ximing

2009-01-01

Ceramic strain gauges in which the strain-sensitive electrically conductive strips made from nanocomposites of noble metal and indium tin oxide (ITO) are being developed for use in gas turbine engines and other power-generation systems in which gas temperatures can exceed 1,500 F (about 816 C). In general, strain gauges exhibit spurious thermally induced components of response denoted apparent strain. When temperature varies, a strain-gauge material that has a nonzero temperature coefficient of resistance (TCR) exhibits an undesired change in electrical resistance that can be mistaken for the change in resistance caused by a change in strain. It would be desirable to formulate straingauge materials having TCRs as small as possible so as to minimize apparent strain. Most metals exhibit positive TCRs, while most semiconductors, including ITO, exhibit negative TCRs. The present development is based on the idea of using the negative TCR of ITO to counter the positive TCRs of noble metals and of obtaining the benefit of the ability of both ITO and noble metals to endure high temperatures. The noble metal used in this development thus far has been platinum. Combinatorial libraries of many ceramic strain gauges containing nanocomposites of various proportions of ITO and platinum were fabricated by reactive co-sputtering from ITO and platinum targets onto alumina- and zirconia-based substrates mounted at various positions between the targets.

Strain-dependent diffusion behavior of H within tungsten

International Nuclear Information System (INIS)

Ding, Wenyi; He, Haiyan; Liu, Changsong; Ding, Rui; Chen, Junling; Pan, Bicai

2014-01-01

The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.

Strain-dependent diffusion behavior of H within tungsten

Energy Technology Data Exchange (ETDEWEB)

Ding, Wenyi; He, Haiyan [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Liu, Changsong [Key Laboratory of Materials Physics, Institute of Solid State Physics, Chinese Academy of Sciences, P.O. Box 1129, Hefei 230031 (China); Ding, Rui; Chen, Junling [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Pan, Bicai, E-mail: bcpan@ustc.edu.cn [Department of Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Hefei National Laboratory for Physical Science at Microscale, University of Science and Technology of China, Hefei, Anhui 230026 (China)

2014-06-15

The diffusion behaviors of H in tungsten, a promising material serving as the first wall facing the plasma in nuclear reactors, under either biaxial strain or isotropic strain are theoretically studied. We find that under the isotropic strain, an individual H atom may diffuse along all pathways, and under the biaxial strain, it preferably migrates along the direction perpendicular to the loaded strain. Moreover, in the case of either the isotropic or the biaxial strain, the loaded compressive strain weakens the diffusion of H, while the loaded tensile strain enhances the diffusion of H in bulk W.

Use of colony-based bacterial strain typing for tracking the fate of Lactobacillus strains during human consumption

Directory of Open Access Journals (Sweden)

Drevinek Pavel

2009-12-01

Full Text Available Abstract Background The Lactic Acid Bacteria (LAB are important components of the healthy gut flora and have been used extensively as probiotics. Understanding the cultivable diversity of LAB before and after probiotic administration, and being able to track the fate of administered probiotic isolates during feeding are important parameters to consider in the design of clinical trials to assess probiotic efficacy. Several methods may be used to identify bacteria at the strain level, however, PCR-based methods such as Random Amplified Polymorphic DNA (RAPD are particularly suited to rapid analysis. We examined the cultivable diversity of LAB in the human gut before and after feeding with two Lactobacillus strains, and also tracked the fate of these two administered strains using a RAPD technique. Results A RAPD typing scheme was developed to genetically type LAB isolates from a wide range of species, and optimised for direct application to bacterial colony growth. A high-throughput strategy for fingerprinting the cultivable diversity of human faeces was developed and used to determine: (i the initial cultivable LAB strain diversity in the human gut, and (ii the fate of two Lactobacillus strains (Lactobacillus salivarius NCIMB 30211 and Lactobacillus acidophilus NCIMB 30156 contained within a capsule that was administered in a small-scale human feeding study. The L. salivarius strain was not cultivated from the faeces of any of the 12 volunteers prior to capsule administration, but appeared post-feeding in four. Strains matching the L. acidophilus NCIMB 30156 feeding strain were found in the faeces of three volunteers prior to consumption; after taking the Lactobacillus capsule, 10 of the 12 volunteers were culture positive for this strain. The appearance of both Lactobacillus strains during capsule consumption was statistically significant (p Conclusion We have shown that genetic strain typing of the cultivable human gut microbiota can be

Strain and strain rate by two-dimensional speckle tracking echocardiography in a maned wolf

Directory of Open Access Journals (Sweden)

Matheus M. Mantovani

2012-12-01

Full Text Available The measurement of cardiovascular features of wild animals is important, as is the measurement in pets, for the assessment of myocardial function and the early detection of cardiac abnormalities, which could progress to heart failure. Speckle tracking echocardiography (2D STE is a new tool that has been used in veterinary medicine, which demonstrates several advantages, such as angle independence and the possibility to provide the early diagnosis of myocardial alterations. The aim of this study was to evaluate the left myocardial function in a maned wolf by 2D STE. Thus, the longitudinal, circumferential and radial strain and strain rate were obtained, as well as, the radial and longitudinal velocity and displacement values, from the right parasternal long axis four-chamber view, the left parasternal apical four chamber view and the parasternal short axis at the level of the papillary muscles. The results of the longitudinal variables were -13.52±7.88, -1.60±1.05, 4.34±2.52 and 3.86±3.04 for strain (%, strain rate (1/s, displacement (mm and velocity (cm/s, respectively. In addition, the radial and circumferential Strain and Strain rate were 24.39±14.23, 1.86±0.95 and -13.69±6.53, -1.01±0.48, respectively. Thus, the present study provides the first data regarding the use of this tool in maned wolves, allowing a more complete quantification of myocardial function in this species.

Engineering piezoresistivity using biaxially strained silicon

DEFF Research Database (Denmark)

Pedersen, Jesper Goor; Richter, Jacob; Brandbyge, Mads

2008-01-01

of the piezocoefficient on temperature and dopant density is altered qualitatively for strained silicon. In particular, we find that a vanishing temperature coefficient may result for silicon with grown-in biaxial tensile strain. These results suggest that strained silicon may be used to engineer the iezoresistivity...

Strain path dependency in metal plasticity

NARCIS (Netherlands)

Viatkina, E.M.; Brekelmans, W.A.M.; Geers, M.G.D.

2003-01-01

A change in strain path has a significant effect on the mechanical response of metals. Strain path change effects physically originate from a complex microstructure evolution. This paper deals with the contribution of cell structure evolution to the strain path change effect. The material with cells

Sensibility of different wheat varieties (strains) to Ar+ implantation

International Nuclear Information System (INIS)

Cui Huanhu; Jing Hua; Ma Aiping; Kang Xiuli; Yang Liping; Huang Mingjing; Ma Buzhou; Shanxi Academy of Agricultural Sciences, Taiyuan

2005-01-01

The sensibility of different wheat varieties (strains) to Ar + implantation was studied. The results showed that the survival rate of 21 wheat varieties (strains) at the dose of 6 x 10 16 Ar + /cm 2 could be divided into five groups: surplus sensitive varieties (strains), sensitive varieties (strains), transitional varieties (strains), obtuse varieties (strains) and surplus obtuse varieties (strains). The sensibility of wheat varieties (strains) to Ar + injection is high-moisture-fertility wheat varieties (strains) > medium-moisture-fertility wheat varieties (strains) > dry land wheat varieties (strains). The study has provided theoretical basis in induced mutation medial lethal dose of different wheat varieties (strains) to Ar + implantation. (authors)

drug resistant strains of Salmonella enterica

African Journals Online (AJOL)

Conclusions: The aqueous extract of Thonningia sanguinea can provide an alternative therapy for the treatment of salmonellosis, mainly for typhoid fever caused by MDR strains of S. Typhi.The extract also inhibits S.Hadar a MDR emerging strain in Ivory Coast. Keywords: Thonningia sanguinea; Salmonella, MDR strains, ...

Validation of perceptual strain index to evaluate the thermal strain in experimental hot conditions

Directory of Open Access Journals (Sweden)

Habibollah Dehghan

2015-01-01

Conclusions: The research findings showed when there is no access to other forms of methods to evaluate the heat stress, it can be used the PeSI in evaluating the strain because of its favorable correlation with the thermal strain.

Mechanical properties of biaxially strained poly(L-lactide) tubes: Strain rate and temperature dependence

DEFF Research Database (Denmark)

Løvdal, Alexandra Liv Vest; Andreasen, Jens Wenzel; Mikkelsen, Lars Pilgaard

2017-01-01

Poly(l-lactide) (PLLA) is a bioabsorbable polymer with high stiffness and strength compared to the other commercially available bioabsorbable polymers. The properties of PLLA can be improved by straining, causing deformation-mediated molecular orientation. PLLA tubes were biaxially strained above...

StrainSeeker: fast identification of bacterial strains from raw sequencing reads using user-provided guide trees.

Science.gov (United States)

Roosaare, Märt; Vaher, Mihkel; Kaplinski, Lauris; Möls, Märt; Andreson, Reidar; Lepamets, Maarja; Kõressaar, Triinu; Naaber, Paul; Kõljalg, Siiri; Remm, Maido

2017-01-01

Fast, accurate and high-throughput identification of bacterial isolates is in great demand. The present work was conducted to investigate the possibility of identifying isolates from unassembled next-generation sequencing reads using custom-made guide trees. A tool named StrainSeeker was developed that constructs a list of specific k -mers for each node of any given Newick-format tree and enables the identification of bacterial isolates in 1-2 min. It uses a novel algorithm, which analyses the observed and expected fractions of node-specific k -mers to test the presence of each node in the sample. This allows StrainSeeker to determine where the isolate branches off the guide tree and assign it to a clade whereas other tools assign each read to a reference genome. Using a dataset of 100 Escherichia coli isolates, we demonstrate that StrainSeeker can predict the clades of E. coli with 92% accuracy and correct tree branch assignment with 98% accuracy. Twenty-five thousand Illumina HiSeq reads are sufficient for identification of the strain. StrainSeeker is a software program that identifies bacterial isolates by assigning them to nodes or leaves of a custom-made guide tree. StrainSeeker's web interface and pre-computed guide trees are available at http://bioinfo.ut.ee/strainseeker. Source code is stored at GitHub: https://github.com/bioinfo-ut/StrainSeeker.

Modulation of virulence and antibiotic susceptibility of enteropathogenic Escherichia coli strains by Enterococcus faecium probiotic strain culture fractions.

Science.gov (United States)

Ditu, Lia-Mara; Chifiriuc, Mariana Carmen; Bezirtzoglou, Eugenia; Voltsi, Chrysa; Bleotu, Coralia; Pelinescu, Diana; Mihaescu, Grigore; Lazar, Veronica

2011-12-01

The increasing rate of antimicrobial resistance drastically reduced the efficiency of conventional antibiotics and led to the reconsideration of the interspecies interactions in influencing bacterial virulence and response to therapy. The aim of the study was the investigation of the influence of the soluble and cellular fractions of Enterococcus (E.) faecium CMGB16 probiotic culture on the virulence and antibiotic resistance markers expression in clinical enteropathogenic Escherichia (E.) coli strains. The 7 clinical enteropathogenic E. coli strains, one standard E. coli ATCC 25,922 and one Bacillus (B.) cereus strains were cultivated in nutrient broth, aerobically at 37 °C, for 24 h. The E. faecium CMGB16 probiotic strain was cultivated in anaerobic conditions, at 37 °C in MRS (Man Rogosa Sharpe) broth, and co-cultivated with two pathogenic strains (B. cereus and E. coli O28) culture fractions (supernatant, washed sediment and heat-inactivated culture) for 6 h, at 37 °C. After co-cultivation, the soluble and cellular fractions of the probiotic strain cultivated in the presence of two pathogenic strains were separated by centrifugation (6000 rpm, 10 min), heat-inactivated (15 min, 100 °C) and co-cultivated with the clinical enteropathogenic E. coli strains in McConkey broth, for 24 h, at 37 °C, in order to investigate the influence of the probiotic fractions on the adherence capacity and antibiotic susceptibility. All tested probiotic combinations influenced the adherence pattern of E. coli tested strains. The enteropathogenic E. coli strains susceptibility to aminoglycosides, beta-lactams and quinolones was increased by all probiotic combinations and decreased for amoxicillin-clavulanic acid. This study demonstrates that the plurifactorial anti-infective action of probiotics is also due to the modulation of virulence factors and antibiotic susceptibility expression in E. coli pathogenic strains. Copyright © 2011 Elsevier Ltd. All rights reserved.

Strain distributions and their influence on electronic structures of WSe2-MoS2 laterally strained heterojunctions

Science.gov (United States)

Zhang, Chendong; Li, Ming-Yang; Tersoff, Jerry; Han, Yimo; Su, Yushan; Li, Lain-Jong; Muller, David A.; Shih, Chih-Kang

2018-02-01

Monolayer transition metal dichalcogenide heterojunctions, including vertical and lateral p-n junctions, have attracted considerable attention due to their potential applications in electronics and optoelectronics. Lattice-misfit strain in atomically abrupt lateral heterojunctions, such as WSe2-MoS2, offers a new band-engineering strategy for tailoring their electronic properties. However, this approach requires an understanding of the strain distribution and its effect on band alignment. Here, we study a WSe2-MoS2 lateral heterojunction using scanning tunnelling microscopy and image its moiré pattern to map the full two-dimensional strain tensor with high spatial resolution. Using scanning tunnelling spectroscopy, we measure both the strain and the band alignment of the WSe2-MoS2 lateral heterojunction. We find that the misfit strain induces type II to type I band alignment transformation. Scanning transmission electron microscopy reveals the dislocations at the interface that partially relieve the strain. Finally, we observe a distinctive electronic structure at the interface due to hetero-bonding.

Crystallization and X-ray diffraction analysis of salicylate synthase, a chorismate-utilizing enyme involved in siderophore biosynthesis

International Nuclear Information System (INIS)

Parsons, James F.; Shi, Katherine; Calabrese, Kelly; Ladner, Jane E.

2006-01-01

Salicylate synthase, which catalyzes the first step in the synthesis of the siderophore yersiniabactin, has been crystallized. Diffraction data have been collected to 2.5 Å. Bacteria have evolved elaborate schemes that help them thrive in environments where free iron is severely limited. Siderophores such as yersiniabactin are small iron-scavenging molecules that are deployed by bacteria during iron starvation. Several studies have linked siderophore production and virulence. Yersiniabactin, produced by several Enterobacteriaceae, is derived from the key metabolic intermediate chorismic acid via its conversion to salicylate by salicylate synthase. Crystals of salicylate synthase from the uropathogen Escherichia coli CFT073 have been grown by vapour diffusion using polyethylene glycol as the precipitant. The monoclinic (P2 1 ) crystals diffract to 2.5 Å. The unit-cell parameters are a = 57.27, b = 164.07, c = 59.04 Å, β = 108.8°. The solvent content of the crystals is 54% and there are two molecules of the 434-amino-acid protein in the asymmetric unit. It is anticipated that the structure will reveal key details about the reaction mechanism and the evolution of salicylate synthase

Crystallization and X-ray diffraction analysis of salicylate synthase, a chorismate-utilizing enyme involved in siderophore biosynthesis

Energy Technology Data Exchange (ETDEWEB)

Parsons, James F., E-mail: parsonsj@umbi.umd.edu; Shi, Katherine; Calabrese, Kelly [Center for Advanced Research in Biotechnology, The University of Maryland Biotechnology Institute, 9600 Gudelsky Drive, Rockville, MD 20850 (United States); Ladner, Jane E. [Center for Advanced Research in Biotechnology, The University of Maryland Biotechnology Institute, 9600 Gudelsky Drive, Rockville, MD 20850 (United States); National Institute of Standards and Technology (United States)

2006-03-01

Salicylate synthase, which catalyzes the first step in the synthesis of the siderophore yersiniabactin, has been crystallized. Diffraction data have been collected to 2.5 Å. Bacteria have evolved elaborate schemes that help them thrive in environments where free iron is severely limited. Siderophores such as yersiniabactin are small iron-scavenging molecules that are deployed by bacteria during iron starvation. Several studies have linked siderophore production and virulence. Yersiniabactin, produced by several Enterobacteriaceae, is derived from the key metabolic intermediate chorismic acid via its conversion to salicylate by salicylate synthase. Crystals of salicylate synthase from the uropathogen Escherichia coli CFT073 have been grown by vapour diffusion using polyethylene glycol as the precipitant. The monoclinic (P2{sub 1}) crystals diffract to 2.5 Å. The unit-cell parameters are a = 57.27, b = 164.07, c = 59.04 Å, β = 108.8°. The solvent content of the crystals is 54% and there are two molecules of the 434-amino-acid protein in the asymmetric unit. It is anticipated that the structure will reveal key details about the reaction mechanism and the evolution of salicylate synthase.

Material Properties Test to Determine Ultimate Strain and True Stress-True Strain Curves for High Yield Steels

Energy Technology Data Exchange (ETDEWEB)

K.R. Arpin; T.F. Trimble

2003-04-01

This testing was undertaken to develop material true stress-true strain curves for elastic-plastic material behavior for use in performing transient analysis. Based on the conclusions of this test, the true stress-true strain curves derived herein are valid for use in elastic-plastic finite element analysis for structures fabricated from these materials. In addition, for the materials tested herein, the ultimate strain values are greater than those values cited as the limits for the elastic-plastic strain acceptance criteria for transient analysis.

Chemical Profile of Monascus ruber Strains

Directory of Open Access Journals (Sweden)

Ahamed M. Moharram

2012-01-01

Full Text Available Chemical profile of Monascus ruber strains has been studied using gas chromatography-mass spectrometry (GC/MS analysis. The colour intensity of the red pigment and secondary metabolic products of two M. ruber strains (AUMC 4066 and AUMC 5705 cultivated on ten different media were also studied. Metabolic products can be classified into four categories: anticholesterol, anticancer, food colouring, and essential fatty acids necessary for human health. Using GC/MS, the following 88 metabolic products were detected: butyric acid and its derivatives (25 products, other fatty acids and their derivatives (19 products, pyran and its derivatives (22 products and other metabolites (22 products. Among these, 32 metabolites were specific for AUMC 4066 strain and 34 for AUMC 5705 strain, whereas 22 metabolites were produced by both strains on different tested substrates. Production of some metabolites depended on the substrate used. High number of metabolites was recorded in the red pigment extract obtained by both strains grown on malt broth and malt agar. Also, 42 aroma compounds were recorded (4 alcohols, 2 benzaldehydes, 27 esters, 3 lactones, 1 phenol, 1 terpenoid, 3 thiol compounds and acetate-3-mercapto butyric acid. Thin layer chromatography and GC/MS analyses revealed no mycotoxin citrinin in any media used for the growth of the two M. ruber strains.