Stern-Center Potsdam; Stern-Center Potsdam
Energy Technology Data Exchange (ETDEWEB)
Anon.
1999-07-01
The ''Stern-Center Potsdam'' is a star-shaped shopping mall in the city center. [German] Das Stern-Center in Potsdam bietet als Einkaufszentrum vor den Toren Berlins Platz fuer eine Vielzahl von Geschaeften. Die sternfoermige Gebaeudestruktur des Centers bildet den Mittelpunkt des Stadtviertels 'Am Stern'. (orig.)
Students' Understanding of Stern Gerlach Experiment
International Nuclear Information System (INIS)
Zhu Guangtian; Singh, Chandralekha
2009-01-01
The Stern Gerlach experiment has played a central role in the discovery of spin angular momentum and it has also played a pivotal role in elucidating foundational issues in quantum mechanics. Here, we discuss investigation of students' difficulties related to the Stern Gerlach experiment by giving written tests and interviewing advanced undergraduate and graduate students in quantum mechanics. We also discuss preliminary data that suggest that the Quantum Interactive Learning Tutorial (QuILT) related to the Stern Gerlach experiment is helpful in improving students' understanding of these concepts.
Anatol Stern e Bruno Jasieński [Anatol Stern and Bruno Jasieński
Directory of Open Access Journals (Sweden)
Giovanna Tomassucci
2016-12-01
Full Text Available The Author presents her first Italian translation of Anatol Stern’s article (excerpted from his monograph on Polish Avantgarde Rebelled Poetry. Sketches on Interwar Period Poetry [1964, 2nd issue 1970] about another prominent initiator and ideologist of Polish futurism, Bruno Jasieński. After the Thaw, Stern first contributed to Jasieński’s rehabilitation, publishing his poetry and the novel I burn Paris and writing several essays about his work. The article presented also offers a choice of translated fragments of Jasieński’s poetry, just a few known in Italy, and an artistic profile of Stern.
Stern-Gerlach experiment, electron spin and intermediate quantum mechanics
Energy Technology Data Exchange (ETDEWEB)
Mackintosh, A.R. (Copenhagen Univ. (Denmark). H.C. Oersted Inst.)
1983-01-01
The paper deals with the theory of electron spin. The Stern-Gerlach experiment, the anticommutation relations and the properties of spin operators are discussed. The Pauli theory, Dirac transformation theory, the double Stern-Gerlach experiment, the EPR paradox and Bell's inequality are also covered.
46 CFR 171.100 - Shaft tunnels and stern tubes.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Shaft tunnels and stern tubes. 171.100 Section 171.100... PERTAINING TO VESSELS CARRYING PASSENGERS Additional Subdivision Requirements § 171.100 Shaft tunnels and... passengers on an international voyage. (b) The watertight seal in the bulkhead between the stern tube space...
Did the Stern Review underestimate US and global climate damages?
International Nuclear Information System (INIS)
Ackerman, Frank; Stanton, Elizabeth A.; Hope, Chris; Alberth, Stephane
2009-01-01
The Stern Review received widespread attention for its innovative approach to the economics of climate change when it appeared in 2006, and generated controversies that have continued to this day. One key controversy concerns the magnitude of the expected impacts of climate change. Stern's estimates, based on results from the PAGE2002 model, sounded substantially greater than those produced by many other models, leading several critics to suggest that Stern had inflated his damage figures. We reached the opposite conclusion in a recent application of PAGE2002 in a study of the costs to the US economy of inaction on climate change. This article describes our revisions to the PAGE estimates, and explains our conclusion that the model runs used in the Stern Review may well underestimate US and global damages. Stern's estimates from PAGE2002 implied that mean business-as-usual damages in 2100 would represent just 0.4 percent of GDP for the United States and 2.2 percent of GDP for the world. Our revisions and reinterpretation of the PAGE model imply that climate damages in 2100 could reach 2.6 percent of GDP for the United States and 10.8 percent for the world.
Spin state determination using Stern-Gerlach device
International Nuclear Information System (INIS)
Shirokov, M.I.
1996-01-01
The well-known Stern-Gerlach device is proposed here for determination of a particle spin state instead of using it for measurement of spin observables. It is shown that measurement of particle momentum distributions (before and after the action of the device magnetic field) allows one to determine the particle initial spin state in the case of an arbitrary spin value. It is demonstrated that one cannot use for this purpose the usual treatment of the Stern-Gerlach experiment based on the entanglement of spin and spatial states. 11 refs
The Stern-Gerlach experiment, electron spin and intermediate quantum mechanics
International Nuclear Information System (INIS)
Mackintosh, A.R.
1983-01-01
The paper deals with the theory of electron spin. The Stern-Gerlach experiment, the anticommutation relations and the properties of spin operators are discussed. The Pauli theory, Dirac transformation theory, the double Stern-Gerlach experiment, the EPR paradox and Bell's inequality are also covered. (U.K.)
All-Optical Stern-Gerlach Effect
Karnieli, Aviv; Arie, Ady
2018-01-01
We introduce a novel formalism in which the paraxial coupled wave equations of the nonlinear optical sum-frequency generation process are shown to be equivalent to the Pauli equation describing the dynamics of a spin-1 /2 particle in a spatially varying magnetic field. This interpretation gives rise to a new classical state of paraxial light, described by a mutual beam comprising of two frequencies. As a straightforward application, we propose the existence of an all-optical Stern-Gerlach effect, where an idler beam is deflected by a gradient in the nonlinear coupling, into two mutual beams of the idler and signal waves (equivalent to oppositely oriented spinors), propagating in two discrete directions. The Stern-Gerlach deflection angle and the intensity pattern in the far field are then obtained analytically, in terms of the parameters of the original optical system, laying the grounds for future experimental realizations.
The stern review: A deconstruction
Tol, R.S.J.; Yohe, G.W.
2009-01-01
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time
The Stern Review: A deconstruction
International Nuclear Information System (INIS)
Tol, Richard S.J.; Yohe, Gary W.
2009-01-01
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis
The Stern Review: A deconstruction
Energy Technology Data Exchange (ETDEWEB)
Tol, Richard S.J. [Economic and Social Research Institute, Dublin (Ireland); Institute for Environmental Studies, Vrije Universiteit, Amsterdam (Netherlands); Department of Spatial Economics, Vrije Universiteit, Amsterdam (Netherlands); Department of Engineering and Public Policy, Carnegie Mellon University, Pittsburgh, PA (United States)], E-mail: richard.tol@esri.ie; Yohe, Gary W. [Department of Economics, Wesleyan University, Middletown, CT (United States)
2009-03-15
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis.
The Stern Review. A deconstruction
Energy Technology Data Exchange (ETDEWEB)
Tol, Richard S.J. [Economic and Social Research Institute, Dublin (Ireland)]|[Institute for Environmental Studies, Vrije Universiteit, Amsterdam (Netherlands)]|[Department of Spatial Economics, Vrije Universiteit, Amsterdam (Netherlands)]|[Department of Engineering and Public Policy, Carnegie Mellon University, Pittsburgh, PA (United States); Yohe, Gary W. [Department of Economics, Wesleyan University, Middletown, CT (United States)
2009-03-15
Using a simple model designed for transparency but nonetheless calibrated to support the much-quoted damage estimates of the Stern Review of the Economics of Climate Change, we demonstrate significant sensitivity of those results to assumptions about the pure rate of time preference, the time horizon, and the rates of risk and equity aversion used to compute certainty- and equity-equivalent annuities. Most importantly, we demonstrate enormous sensitivity to presumed constant regional vulnerability and underlying assumptions about adaptive capacity. Manipulation of any of these parameters one at a time across reasonable ranges can diminish damage estimates by as much as 84% or, in the case of extending the time horizon with the Review's low discount rate, increase damage estimates by 900%. We also confirm the usual result that limiting atmospheric concentrations to specific benchmarks above 400 ppm cannot eliminate all damages. Nonetheless, we applaud the Stern Review author team for reconfirming that the climate problem can be approached productively as an economic problem whose solutions can be explored with the tools of decision analysis. (author)
Effects of stern-foil submerged elevation on the lift and drag of a hydrofoil craft
Suastika, K.; Apriansyah
2018-03-01
Effects of the stern-foil submerged elevation on the lift and drag of a hydrofoil craft are studied by using computational fluid dynamics (CFD) and by considering three alternative stern-foil submerged elevations. The submerged elevation of the front foil is kept constant in all the alternatives. From among the alternatives, the deepest stern-foil placement results in the highest stern-foil lift with the highest foil’s lift-to-drag ratio. However, considering the lift-to-drag ratio of the whole foil-strut-hull system, the shallowest stern-foil placement results in the highest lift-to-drag ratio. The struts and the foil’s submerged elevation significantly affects the drag of the whole foil-strut-hull system.
Chrismianto, D.; Tuswan; Manik, P.
2018-03-01
In this study, the stern tunnel to improve the efficiency of ship propulsion system is analysed. Stern tunnels installed on the two sides of the ship stern. Analysis of ship resistance and wake friction of the ship using CFD are carried out. The stern tunnel height (Hw) and length (L) are implemented to find the better stern tunnel form of the ship. The result of analysis showed that model has a high stern tunnels (Hw) of 1,444 m or additional high stern tunnels ratio of 16% and stern long tunnels (L) about 7 m is a model that has the smallest resistance about 1.1137 N or able to make reduction of resistance amount 11.2582%. While, the model with the addition of height of 0.2 m and a length of 9 m of stern tunnel is a model that has the better advanced speed about 4,927% in increase, and better wake friction about 30.4% in reduce.
Stern-Gerlach interaction in fermion beams
International Nuclear Information System (INIS)
Cameron, P.; Luccio, A.U.; MacKay, W.W.; Conte, M.; Ferro, M.; Gemme, G.; Palazzi, M.; Parodi, R.; Pusterla, M.
2001-01-01
The Stern-Gerlach interaction, between a moving charged particle endowed with a magnetic moment and a radio-frequency e.m. field, is studied by means of a semi-classical approach. Theoretical results are presented, and a possible experimental check of this theory is discussed
THE STERN PROJECT–HANDS ON ROCKETS SCIENCE FOR UNIVERSITY STUDENT
Schüttauf, Katharina; Stamminger, Andreas; Lappöhn, Karsten
2017-01-01
In April 2012, the German Aerospace Center DLR initiated a sponsorship program for university students to develop, build and launch their own rockets over a period of three years. The program designation STERN was abbreviated from the German “STudentische Experimental-RaketeN”, which translates to Student- Experimental-Rockets. The primary goal of the STERN program is to inspire students in the subject of space transportation through hands-on activities within a pro...
Simulation turbulenter Konvektion in Supernova-Explosionen massereicher Sterne.
Janka, H.-T.; Müller, E.; Ruffert, M.
Contents: 1. Das Projekt: Numerische Simulation von Typ-II-Supernovae. 2. Die numerischen Verfahren. 3. Die Visualisierung von dreidimensionalen Datensätzen. 4. Die Ergebnisse: Einblick in explodierende Sterne.
Transaktionsgegenstand: Schweizer 5 Sterne Hotellerie
Kullmann, Patrick; Schegg, Roland
2012-01-01
Internationale Untersuchungen belegen, dass die Hotellerie im Jahr 2011 deutlich mehr Akquisitionen und Fusionen aufwies als im Jahr 2010. Auch die Schweizer 5 Sterne Hotellerie zählte in den letzten Jahren diverse Transaktionen, nicht zuletzt deshalb, weil schon heute eine Vielzahl in- und ausländischer Investoren Hotels besitzen, um diese nach erreichtem Wertzuwachs wieder zu veräussern. Dieser Artikel soll sowohl potentiellen Hotelinvestoren als auch der Geschäftsführung von Hotels zur Ori...
Stern-judging: A simple, successful norm which promotes cooperation under indirect reciprocity.
Pacheco, Jorge M; Santos, Francisco C; Chalub, Fabio A C C
2006-12-29
We study the evolution of cooperation under indirect reciprocity, believed to constitute the biological basis of morality. We employ an evolutionary game theoretical model of multilevel selection, and show that natural selection and mutation lead to the emergence of a robust and simple social norm, which we call stern-judging. Under stern-judging, helping a good individual or refusing help to a bad individual leads to a good reputation, whereas refusing help to a good individual or helping a bad one leads to a bad reputation. Similarly for tit-for-tat and win-stay-lose-shift, the simplest ubiquitous strategies in direct reciprocity, the lack of ambiguity of stern-judging, where implacable punishment is compensated by prompt forgiving, supports the idea that simplicity is often associated with evolutionary success.
Stern-judging: A simple, successful norm which promotes cooperation under indirect reciprocity.
Directory of Open Access Journals (Sweden)
Jorge M Pacheco
2006-12-01
Full Text Available We study the evolution of cooperation under indirect reciprocity, believed to constitute the biological basis of morality. We employ an evolutionary game theoretical model of multilevel selection, and show that natural selection and mutation lead to the emergence of a robust and simple social norm, which we call stern-judging. Under stern-judging, helping a good individual or refusing help to a bad individual leads to a good reputation, whereas refusing help to a good individual or helping a bad one leads to a bad reputation. Similarly for tit-for-tat and win-stay-lose-shift, the simplest ubiquitous strategies in direct reciprocity, the lack of ambiguity of stern-judging, where implacable punishment is compensated by prompt forgiving, supports the idea that simplicity is often associated with evolutionary success.
Influence of Stern Shaft Inclination on the Cooling Performance of Water-Lubricated Bearing
Directory of Open Access Journals (Sweden)
Zou Li
2016-01-01
Full Text Available The water film model of the marine water-lubricated stern bearing was established by FLUENT. The influence law of water flow rate on the cooling performance of water-lubricated bearing was studied in consideration of the stern shaft inclination. It will be helpful to improve the performance of marine water-lubricated stern bearing and both security and reliability of propulsion system. The simulation results show that the increase of cooling water flow rate in a certain range can effectively reduce bearing temperature. The bearing temperature rises sharply with thinning of water film thickness which is caused by the increase of inclination angle. Larger inclination angle can deteriorate the operating reliability of bearing.
Stern-Gerlach Experiments and Complex Numbers in Quantum Physics
Sivakumar, S.
2012-01-01
It is often stated that complex numbers are essential in quantum theory. In this article, the need for complex numbers in quantum theory is motivated using the results of tandem Stern-Gerlach experiments
Internationalization of Brazilian brands of luxury: a case study of the H. Stern jewelry
Directory of Open Access Journals (Sweden)
José Coelho de Andrade Albino
2009-03-01
Full Text Available This case study analyses the issues concerning the management of global luxury brands, specially those originated from third world countries, such as Brazil. In order to perform this research, the case study approach has been chosen, having as empirical object the Brazilian jewelry H. Stern. The study is based on bibliographical research as well as interviews with the company’s managers; technical visits to H. Stern’s headquarters and main stores, documental research and discourse analysis of the jewelry’s national and international advertisements compared to its competitors. The results found indicate that H. Stern has followed the Uppsala School´s assumptions in order to promote it´s internationalization. H. Stern branding practices can be considered a transition between the first and the second wave of branding, according to Antorini and Schultz (2005 classification. Related to the luxury brand managing model developed by Beverland (2004, it can be affirmed that H. Stern manages it´s brand in a global context, in a consistent and integrated way.
Contingency and its consequences in Tristram Shandy by Laurence Sterne
Directory of Open Access Journals (Sweden)
Tomasz Umerle
2010-06-01
Full Text Available My paper proposes a new approach to the famous novel by Laurence Sterne Tristram Shandy. In my reading of this work I use the category of contingency which I define by referring to the German philosopher Odo Marquard and literary theories of a monographer of the contigency in literature and film Rafał Koschany. These are the basic inspirations for reflections on Tristram as a character, and simultaneously, narrator in the novel. In my view contingency manifests itself in Sterne's work in a two-fold manner it affects Tristram's life and narration. I will try to focus on the different ways in which these manifestations relate to each other.
Daniel Stern's journey in infant psychiatry: interview by John A. Talbot.
Stern, Daniel
2012-12-01
This interview with Professor Daniel Stern, conducted on February 16, 2012 by Dr. John Talbott, reviews the field of infant psychiatry, the history of which goes back more than 100 years. Sigmund Freud, then Melanie Klein, Anna Freud, Donald Winnicott, and, finally, Margaret Mahler, all psychoanalysts, influenced its development. Direct observation of very young infants and their mothers began in the latter half of the 20th century, and the subsequent course shifted through the influence of developmental psychologists and ethologists. This review concludes with Dr. Stern's predictions and fears about future directions of the field.
STERN-Educational Benefits for the Space Industry
Schuttauf, K.; Stamminger, A.; Lappohn, K.; Ciezki, H.; Kitsche, W.
2015-09-01
STERN, the German word for star, is also an acronym for STudentische Experimental-RaketeN. It is a program to provide students with “hands-on” experience in space systems and research. This name was chosen for two reasons. The first reason was to emphasize the idealistic goals of spaceflight providing students with the opportunity to “reach for the stars”. The second and most important one was that the program offers engineering students a practical chance to experience the scope of aerospace and should motivate them to become a new star in this field. Currently eight German universities are participating in the STERN-program. STERN was initiated in April 2012, by the DLR Space Administration in Bonn and is supported by funds from the German Federal Ministry of Economics and Technology (BMWi). During the project runtime of three years the students should develop and launch their own rocket. There are no limits regarding trajectory, altitude or the propulsion system used (solid fuel, liquid fuel, steam or hybrid). The reason for the “no limits” strategy is to create a new perspective of a problem and encourage new technological ideas. The students shall not be limited in their creativity. Nevertheless the spacecraft should have a telemetry system to transmit key trajectory and housekeeping data back to earth during flight and provide information to the students including the rocket altitude. Moreover the rocket shall reach a velocity of at least Mach 1 . The project requirements are set to show the real world of work to the students. To reach the project goal, the students have to work project-oriented and in teams. In order to teach students engineering and science, as well as to put their technical knowledge to the test as early as possible in their studies, they are integrated into courses at their universities, which already deal with various aspects of rocket technology and space research. As in any development program, the students have to pass
Effect of stern hull shape on turning circle of ships
Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman
2012-06-01
Many factors such as: stern hull shape, length, draught, trim, propulsion system and external forces affecting the drift angle influence rate of turn and size of turning circle of ships. This paper discusses turning circle characteristics of U and V stern hull shape of Very Large Crude Oil Carrier (VLCC) ships. The ships have same principal dimension such as length, beam, and draught. The turning circle characteristics of the VLCC ships are simulated at 35 degree of rudder angle. In the analysis, firstly, turning circle performance of U-type VLCC ship is simulated. In the simulation, initial ship speed is determined using given power and rpm. Hydrodynamic derivatives coefficients are determined by including effect of fullness of aft run. Using the obtained, speed and hydrodynamic coefficients, force and moment acting on hull, force and moment induced by propeller, force and moment induced by rudder are determined. Finally, ship trajectory, ratio of speed, yaw angle and drift angle are determined. Results of simulation results of the VLCC ship are compared with the experimental one as validation. Using the same method, V-type VLCC is simulated and the simulation results are compared with U-type VLCC ship. Results shows the turning circle of U-type is larger than V-type due to effect stern hul results of simulation are.
Energy Technology Data Exchange (ETDEWEB)
Ogle, Ken J.; Carter, Craig D. [Thordon Bearings Inc., Burlington, Ontario (Canada)], email: keno@thordonbearings.com, email: craigc@thordonbearings.com
2010-07-01
Icebreakers are prone to oil discharges from the stern tube, and lubricants that are biodegradable elsewhere may not be biodegradable enough in the Arctic and have a toxic effect on the food chain. The vulnerable element is the shaft seal, which must leak a small amount to operate in the first place, and ice milling causes very fast shaft movements that increase the leakage. Also, other objects such as fishing lines seriously compromise the operation of the seal. However, there is an alternative-namely the conversion of oil-lubricated bearings to Thordon COMPAC seawater-lubricated bearings. In this operation, white-metal bearings are replaced with Thordon non-metallic bearings; then, seawater is used as the lubrication and cooling medium. The seawater enters the front part of the stern, passes through the front and aft bearing before returning to the sea. This system totally eliminates the risk of polluting the Arctic ecosystem.
STERNE EM MEMÓRIAS PÓSTUMAS DE BRÁS CUBAS E DOM CASMURRO
Directory of Open Access Journals (Sweden)
LUANA FERREIRA DE FREITAS
Full Text Available Este trabalho parte da leitura e análise de The Life and Opinions of Tristram Shandy, Gentleman e A Sentimental Journey, de Laurence Sterne, e de Memórias póstumas de Brás Cubas e Dom Casmurro, de Machado de Assis, para fazer um exame da presença de traços estilísticos do texto machadiano explorados por Sterne 132 anos antes. Para tal, serão consideradas a digressão e a subjetividade dos narradores.
A quantum mechanical analogue of the Stern-Volmer equation
Nitzan, A.; Jortner, J.; Kommandeur, J.; Drent, E.
1971-01-01
We discuss the role of interference effects in intramolecular electronic energy quenching of an excited electrocic state of a large molecule. For a small electronic energy gap the Stern-Volmer relation is obtained in the limit of strong coupling, while in intermediate cases the ( pressure dependent)
The economics of climate change the stern report one year on
International Nuclear Information System (INIS)
Godard, O.
2007-01-01
In this article Olivier Godard, a specialist in environmental issues, looks back at the Stern Report on the economics of climate change, which was commissioned by the British government and published at the fall 2006. Having first recalled the general background to the report with regard to global warming and the lively debate that it generated, Godard sets it in perspective. He starts by describing the overall methodology and the main ideas in the Stern Report: a strong warning (that-without swift and decisive action to deal with the problem, the growth in human activities will cause serious, large-scale upheavals in this century and the next) coupled with an optimistic view (that nothing is inevitable provided that action is indeed swift, decisive and properly co-ordinated internationally, and the cost is relatively moderate). He puts figures to an evaluation of the damage to the environment suggested in various scenarios for the period up to 2200, as well as calculations showing that the feared climate change catastrophe is not unavoidable. He summarizes the policy recommendations offered in the Stern Report, emphasizing in passing that even the toughest policies cannot overcome all the problems. Godard goes on to discuss the key issue in the controversy that divides economists: what level to set the discount rate. He first describes the way this rate is calculated and then shows how the choices involved reflect above all the ethical trade-off with regard to the treatment of future generations and how the hypotheses underlying the economic evaluations of the impacts of climate change are far from being as scientifically objective as they claim to be. The Stern Report, he concludes, will at least have had the merit of bringing greater transparency in this regard and, despite certain limitations, it will have demonstrated the urgent need for co-ordinated action at global level to tackle climate change. (author)
Kumar, Bharat; Crittenden, Scott R
2013-11-01
We demonstrate the ability to measure Stern potential and Debye length in dilute ionic solution with atomic force microscopy. We develop an analytic expression for the second harmonic force component of the capacitive force in an ionic solution from the linearized Poisson-Boltzmann equation. This allows us to calibrate the AFM tip potential and, further, obtain the Stern potential of sample surfaces. In addition, the measured capacitive force is independent of van der Waals and double layer forces, thus providing a more accurate measure of Debye length.
International Nuclear Information System (INIS)
Kumar, Bharat; Crittenden, Scott R
2013-01-01
We demonstrate the ability to measure Stern potential and Debye length in dilute ionic solution with atomic force microscopy. We develop an analytic expression for the second harmonic force component of the capacitive force in an ionic solution from the linearized Poisson–Boltzmann equation. This allows us to calibrate the AFM tip potential and, further, obtain the Stern potential of sample surfaces. In addition, the measured capacitive force is independent of van der Waals and double layer forces, thus providing a more accurate measure of Debye length. (paper)
Stern-Gerlach effect without magnetic-field gradient
International Nuclear Information System (INIS)
Zimmer, O.; Felber, J.; Schaerpf, O.
2001-01-01
The Stern-Gerlach effect is the well-known spin-dependent splitting of a neutral particle beam by a magnetic-field gradient. Guided by the pseudomagnetic analogy, we performed a similar experiment where no magnetic-field gradient is involved. The effect is due to the spin-dependence of neutron scattering from polarised nuclei, i.e. caused by the strong interaction between neutrons and nuclei. The beam splitting is proportional to the nuclear polarisation and to the spin-dependent part of the neutron scattering length. Thus it can be used to measure one of both quantities. (orig.)
A modified Stern-Gerlach experiment using a quantum two-state magnetic field
Daghigh, Ramin G.; Green, Michael D.; West, Christopher J.
2018-06-01
The Stern-Gerlach experiment has played an important role in our understanding of quantum behavior. We propose and analyze a modified version of this experiment where the magnetic field of the detector is in a quantum superposition, which may be experimentally realized using a superconducting flux qubit. We show that if incident spin-1/2 particles couple with the two-state magnetic field, a discrete target distribution results that resembles the distribution in the classical Stern-Gerlach experiment. As an application of the general result, we compute the distribution for a Gaussian waveform of the incident fermion. This analysis allows us to demonstrate theoretically: (1) the quantization of the intrinsic angular momentum of a spin-1/2 particle, and (2) a correlation between EPR pairs leading to nonlocality, without necessarily collapsing the particle's spin wavefunction.
New York University's Stern School of Business: A Centennial Retrospective.
Gitlow, Abraham L.
This volume traces the history of the first hundred years of the Stern School of Business at New York University. Chapter 1 describes the school's original mission and founding. Chapter 2 describes how the school changed and developed as it responded to trends from 1900 to 1950. Chapter 3 explores the school's dramatic decline between 1955 and…
Kan Daniel Sterns kernebegreber bidrage til en fænomenologisk orienteret musikpsykologi?
DEFF Research Database (Denmark)
Holgersen, Sven-Erik
2007-01-01
Daniel Stern har igennem hele sit forfatterskab været optaget af, hvordan bevidsthed konstitueres i samspillet mellem subjekt og omverden. Han har i stigende grad ladet sig inspirere af fænomenologi, og artiklen diskuterer, hvilke konsekvenser dette har for forståelsen af centrale begreber som...
Observation of the continuous stern-gerlach effect on an electron bound in an atomic Ion
Hermanspahn; Haffner; Kluge; Quint; Stahl; Verdu; Werth
2000-01-17
We report on the first observation of the continuous Stern-Gerlach effect on an electron bound in an atomic ion. The measurement was performed on a single hydrogenlike ion ( 12C5+) in a Penning trap. The measured g factor of the bound electron, g = 2.001 042(2), is in excellent agreement with the theoretical value, confirming the relativistic correction at a level of 0.1%. This proves the possibility of g-factor determinations on atomic ions to high precision by using the continuous Stern-Gerlach effect. The result demonstrates the feasibility of conducting experiments on single heavy highly charged ions to test quantum electrodynamics in the strong electric field of the nucleus.
Directory of Open Access Journals (Sweden)
L.R.F. Alleoni
1994-08-01
Full Text Available Modelos teóricos da dupla camada difusa de Gouy-Chapman e de Stern foram aplicados a um latossolo variação Una ácrico, de Guaira e a dois latossolos roxos ácricos, localizados em Ribeirão Preto e Guaíra, cidades ao norte do Estado de São Paulo, onde solos com caráter ácrico ocupam vasta área nas quais são cultivadas várias culturas de interesse econômico. Na concentração mais elevada do eletrólito suporte (KCl 0,1N, os dados obtidos em laboratório adaptaram-se melhor ao modelo de Stern. Entretanto, nas menores concentrações (KCl 0,01 e 0,001N, correspondentes a valores mais comuns encontrados em solos altamente intemperizados, o modelo de Gouy-Chapman representou melhor a variação da densidade superficial de carga com o potencial elétrico das amostras estudadas.Theoretical models of Gouy-Chapman and Stern, referred to diffuse double layer, were applied to three acric Oxisols, two named dusky red latosol and one Una variant latosol, from the São Paulo State - Brazil. Samples were collected in Ribeirão Preto and Guaira, regions of large occurrence of these soils, supporting many economic crops. In the highest concentration of the electrolyte (KC1 0.1N, the obtained values were better related to the Stern model. On the other hand, in more dilluted solutions (KC1 0.01 and 0.001N, corresponding to more usual ionic strenght of highly weathered soils, the variation of surface charge density of the samples with electric potential was in better agreement with the Gouy-Chapman theory.
Microscopic Stern-Gerlach effect and spin-orbit pendulum
International Nuclear Information System (INIS)
Rozmej, P.; Arvieu, R.
1996-01-01
The motion of a particle with spin in spherical harmonic oscillator potential with spin-orbit interaction is discussed. The attention is focused on the spatial motion of wave packets. The particular case of wave packets moving along the circular orbits for which the most transparent and pedagogical description is possible is considered. The splitting of the wave packets into two components moving differently along classical orbits reflects a strong analogy with the Stern-Gerlach experiment. The periodic transfer of average angular momentum between spin and orbital subspaces accompanying this time evolution is called the spin-orbit pendulum. (author). 6 refs, 3 figs
On the Einstein-Stern model of rotational heat capacities
DEFF Research Database (Denmark)
Dahl, Jens Peder
1998-01-01
The Einstein-Stern model for the rotational contribution to the heat capacity of a diatomic gas has recently been resuscitated. In this communication, we show that the apparent success of the model is illusory, because it is based on what has turned out to be an unfortunate comparison with experi...... with experiment. We also take exception to the possibility of assigning any meaning to the rotational zero-point energy introduced by the model. (C) 1998 American Institute of Physics. [S0021-9606(98)02448-9]....
Brown, Matthew A; Bossa, Guilherme Volpe; May, Sylvio
2015-10-27
In one of the most commonly used phenomenological descriptions of the electrical double layer, a charged solid surface and a diffuse region of mobile ions are separated from each other by a thin charge-depleted Stern layer. The Stern layer acts as a capacitor that improves the classical Gouy-Chapman model by increasing the magnitude of the surface potential and limiting the maximal counterion concentration. We show that very similar Stern-like properties of the diffuse double layer emerge naturally from adding a nonelectrostatic hydration repulsion to the electrostatic Coulomb potential. The interplay of electrostatic attraction and hydration repulsion of the counterions and the surface leads to the formation of a diffuse counterion layer that remains well separated from the surface. In addition, hydration repulsions between the ions limit and control the maximal ion concentration and widen the width of the diffuse double layer. Our mean-field model, which we express in terms of electrostatic and hydration potentials, is physically consistent and conceptually similar to the classical Gouy-Chapman model. It allows the incorporation of ion specificity, accounts for hydration properties of charged surfaces, and predicts Stern layer properties, which we analyze in terms of the effective size of the hydrated counterions.
Simulation Analysis of Spherical Mechanical Seal Property of Marine Stern Shaft
Zhou Xu Hui; Zou Li
2016-01-01
The finite element model of spherical mechanical seal wasestablished with ANSYS, and the influence of seawater pressure, shaft speed and other factors on the sealing performance was discussed. The study results show that local contact situation of the spherical mechanical seal is in the outside of the seal rings, and both maximum contact pressure and temperature appearat the same position. As sea water pressure and stern shaft rotary speed are increased, the contact pressure and temperature o...
Effect of animal sera on Bacillus anthracis Sterne spore germination and vegetative cell growth.
Bensman, M D; Mackie, R S; Minter, Z A; Gutting, B W
2012-08-01
The aims of this work were to investigate the effects of sera on B. anthracis Sterne germination and growth. Sera examined included human, monkey and rabbit sera, as well as sera from eight other species. Standard dilution plate assay (with and without heat kill) was used as a measure of germination, and spectroscopy was used to measure growth. In addition, a Coulter Counter particle counter was used to monitor germination and growth based on bacterial size. Spores germinated best in foetal bovine and monkey sera, moderately with human sera and showed limited germination in the presence of rabbit or rat sera. Vegetative bacteria grew best in foetal bovine sera and moderately in rabbit sera. Human and monkey sera supported little growth of vegetative bacteria. The data suggested sera can have a significant impact on germination and growth of Sterne bacteria. These data should be considered when conducting in vitro cell culture studies and may aid in interpreting in vivo infection studies. © 2012 The Authors Journal of Applied Microbiology © 2012 The Society for Applied Microbiology.
Directory of Open Access Journals (Sweden)
William Valentine Redmond
2011-01-01
Full Text Available Os humoristas britânicos, especialmente Swift e Sterne são tradicionalmente vistos como escritores que influenciaram a obra de Machado de Assis. Entretanto, foi o crítico Eugenio Gomes que provou, com precisão, a sutileza e o bom gosto que Machado obteve dessa influência. Em uma abordagem contemporânea, torna-se interessante questionar essa idéia de influência e examinar, à luz da intertextualidade, esse contato do humor entre as obras de Machado e as dessas duas grandes figuras da Literatura na Língua Inglesa.The British humourists, especially Swift and Sterne are traditionallyseen as writers who influenced Machado de Assis’ works. However it was the critic Eugenio Gomes who showed with precision the sublety and excellent taste of Machado obtained through this influence. With our contemporary approaches, it becomes interesting to question the idea of influence and examine in the light of intertextuality this contact of humour between the works of Machado and those of these two great figures of Literature in the English Language.
Numerical Investigation of Resistance Reduction of Fishing Boat by Improving Stern Part
Baso, Suandar
2013-01-01
In recent years, to achieve a goal of reducing greenhouse gas, a fishing boat which is very economical on gas should be needed. Over the last two decades, improvements of bow part in fishing boat have been researched to reduce water resistance. Moreover, stern End Bulb research took place mostly in Japan. No one finds universal knowledge for reducing drag resistance because many fishing boats run with individual catching styles for each fish. It is also difficult to appropriate some technique...
Modeling variable density turbulence in the wake of an air-entraining transom stern
Hendrickson, Kelli; Yue, Dick
2015-11-01
This work presents a priori testing of closure models for the incompressible highly-variable density turbulent (IHVDT) flows in the near wake region of a transom stern. This three-dimensional flow is comprised of convergent corner waves that originate from the body and collide on the ship center plane forming the ``rooster tail'' that then widens to form the divergent wave train. These violent free-surface flows and breaking waves are characterized by significant turbulent mass flux (TMF) at Atwood number At = (ρ2 -ρ1) / (ρ2 +ρ1) ~ 1 for which there is little guidance in turbulence closure modeling for the momentum and scalar transport along the wake. To whit, this work utilizes high-resolution simulations of the near wake of a canonical three-dimensional transom stern using conservative Volume-of-Fluid (cVOF), implicit Large Eddy Simulation (iLES), and Boundary Data Immersion Method (BDIM) to capture the turbulence and large scale air entrainment. Analysis of the simulation results across and along the wake for the TMF budget and turbulent anisotropy provide the physical basis of the development of multiphase turbulence closure models. Performance of isotropic and anisotropic turbulent mass flux closure models will be presented. Sponsored by the Office of Naval Research.
Tomasello y Stern: Dos perspectivas actuales incluyentes del Desarrollo Infantil
Directory of Open Access Journals (Sweden)
Marta Isabel López Giraldo
2011-10-01
Full Text Available The objective of the present article is to illustrate two current perspectives of child development that areinclusive rather than exclusive -Michael Tomasello (cognitive and Daniel Stern (social-subjective-, in the sense that theyintegrate the discoveries of the early skills of the baby -carried out as of 1970-80- to their explanation, without giving upthe particular theoretical paradigm they come from. They recognize these early skills and the fundamental role of the various factors involved in development -the innate, the environmental (social and cultural-, different research methods and thelimitations of a reductionist view. In addition they postulate that the dialog between the different theoretical perspectives isnecessary to achieve a description of the infant as a unit.
International Nuclear Information System (INIS)
Trimeche, Azer
2013-01-01
This work focuses on the study and implementation of a new technique of deceleration of a supersonic beam of paramagnetic particles using a co-moving progressive wave of magnetic field. This technique relies on a method of slowing based on Stern-Gerlach forces acting on a paramagnetic system in motion in the presence of a co-propagating magnetic field. This highly innovative approach has the advantage of being applicable to a wide range of species and opens up new opportunities. A suitable theoretical approach is followed, that allows for a direct link between theory, programming of experimental parameters, and experimental results in a systematic, rational and predictive manner. The understanding and control of the dynamics of trapping at a given speed, acceleration and deceleration require decoupling between the transverse and longitudinal effects of the wave. These effects are clearly visible when the added uniform magnetic field limits the transverse effects of the progressive wave of magnetic field. The outlooks for the new Zeeman Stern Gerlach decelerator are numerous. Deceleration paramagnetic molecules, free radicals and neutrons are possible. (author) [fr
Studies on halogen quenching through the Stern-Volmer plot
International Nuclear Information System (INIS)
Takiue, Makoto; Ishikawa, Hiroaki.
1978-01-01
The quenching effect for halogenated benzenes, methanes and ethanes have been investigated. The halogen quenching was accurately measured using the internal conversion electrons emitted from 113 Sn-sup(113m)In. From the quenching constants determined by the Stern-Volmer plots with respect to various halogen quenchers, the following results have been obtained. (1) The quenching constants increase with the number of halogen substituents, so as linearly in halogenated benzenes and exponentially in halogenated methanes and ethanes. Even the isomers of halogenides have different quenching constants. (2) There is a linearity between logarithm of the quenching constant and a polarographic half-wave reduction potential. (3) Electron excitation provides larger quenching constants than UV excitation for halogenated methanes. Based on these results, the mechanism of halogen quenching have been discussed in connection with the exciplex formation. (auth.)
O'Shea, Thomas T.; Beale, Kristy L. C.; Brucker, Kyle A.; Wyatt, Donald C.; Drazen, David; Fullerton, Anne M.; Fu, Tom C.; Dommermuth, Douglas G.
2010-11-01
Numerical Flow Analysis (NFA) predictions of the flow around a transom-stern hull form are compared to laboratory measurements collected at NSWCCD. The simulations are two-phase, three-dimensional, and unsteady. Each required 1.15 billion grid cells and 200,000 CPU hours to accurately resolve the unsteady flow and obtain a sufficient statistical ensemble size. Two speeds, 7 and 8 knots, are compared. The 7 knots (Fr=Uo /√gLo=0.38) case is a partially wetted transom condition and the 8 knots (Fr=0.43) case is a dry transom condition. The results of a detailed comparison of the mean free surface elevation, surface roughness (RMS), and spectra of the breaking stern-waves, measured by Light Detection And Ranging (LiDAR) and Quantitative Visualization (QViz) sensors, are presented. All of the comparisons showed excellent agreement. The concept of height-function processing is introduced, and the application of this type of processing to the simulation data shows a k-5/3 power law behavior for both the 7 and 8 knot cases. The simulations also showed that a multiphase shear layer forms in the rooster-tail region and that its thickness depends on the Froude number.
The politics of psychiatry and the vicissitudes of faith circa 1950: Karl Stern's psychiatric novel.
Burston, Daniel
2015-01-01
Karl Stern, MD (1906-1975) was the author of The Pillar of Fire (1951) and three nonfiction books on psychiatry, psychoanalysis, and religion. His novel, Through Dooms of Love (1960), written with the assistance of his friend and admirer Graham Greene, covers a number of topics that were to psychiatric theory, treatment, and research at mid-century, and reflects several features of his own personal and professional vicissitudes. © 2015 Wiley Periodicals, Inc.
Rapid and accurate determination of Stern-Volmer quenching constants
International Nuclear Information System (INIS)
Goodpaster, John V.; McGuffin, Victoria L.
1999-01-01
In this work, a novel system has been designed, characterized, and validated for the determination of fluorescence quenching constants. Capillary flow injection methods are used to automate the preparation and mixing of the fluorophore and quencher solutions. Because of the small diameter of the capillary (75-200 μm), fluorescence measurements can be made without corrections for primary and secondary absorbance effects. The fluorescence spectrometer is equipped with a charge-coupled device (CCD) that has a detection limit of 3.0x10 -9 M (2.3 ppb) and a linear dynamic range of 10 5 for integration times of 0.01-10 s. This spectrometer has a 300 nm spectral range with 1 nm resolution, allowing the fluorescence quenching constants to be calculated at single wavelengths or over integrated wavelength ranges. This system was validated by comparison to traditional methods for the determination of Stern-Volmer constants for alternant and nonalternant polycyclic aromatic hydrocarbons with nitromethane and triethylamine. (c) 2000 Society for Applied Spectroscopy
International Nuclear Information System (INIS)
Arend, Nikolas; Gaehler, Roland; Keller, Thomas; Georgii, Robert; Hils, Thomas; Boeni, Peter
2004-01-01
If a neutron pulse passes through an NRSE flipper coil, the coherent splitting in energy of the spin-up and spin-down states leads to their macroscopic spatial separation, depending on the experimental parameters (longitudinal Stern-Gerlach effect). We furthermore present a discussion about the effects measurability and propose two possible setups
Energy Technology Data Exchange (ETDEWEB)
Arend, Nikolas; Gaehler, Roland; Keller, Thomas; Georgii, Robert; Hils, Thomas; Boeni, Peter
2004-06-21
If a neutron pulse passes through an NRSE flipper coil, the coherent splitting in energy of the spin-up and spin-down states leads to their macroscopic spatial separation, depending on the experimental parameters (longitudinal Stern-Gerlach effect). We furthermore present a discussion about the effects measurability and propose two possible setups.
Vangaveti, S; Travesset, A
2014-12-28
We present here a method to separate the Stern and diffuse layer in general systems into two regions that can be analyzed separately. The Stern layer can be described in terms of Bjerrum pairing and the diffuse layer in terms of Poisson-Boltzmann theory (monovalent) or strong coupling theory plus a slowly decaying tail (divalent). We consider three anionic phospholipids: phosphatidyl serine, phosphatidic acid, and phosphatidylinositol(4,5)bisphosphate (PIP2), which we describe within a minimal coarse-grained model as a function of ionic concentration. The case of mixed lipid systems is also considered, which shows a high level of binding cooperativity as a function of PIP2 localization. Implications for existing experimental systems of lipid heterogeneities are also discussed.
Tomasello y Stern: Dos perspectivas actuales incluyentes del Desarrollo Infantil
Directory of Open Access Journals (Sweden)
Mata Isabel López
2011-01-01
Full Text Available El presente artículo tiene como objetivo ilustrar dos perspectivas actuales del desarrollo infantil incluyentes más que excluyentes -Michael Tomasello (cognitivo y Daniel Stern (social-subjetivo-, en cuanto a que integran a su explicación los descubrimientos de las capacidades tempranas del bebé -realizados a partir de 1970/80- y, sin renunciar al paradigma teórico particular del que provienen, reconocen junto a estas competencias tempranas el rol fundamental de los diversos factores intervinientes en el desarrollo -lo innato y lo ambiental (social y cultural-, los diferentes métodos de investigación y las limitaciones de una mirada reduccionista. Además, postulan que se hace necesaria la conversación entre las diferentes perspectivas teóricas, para lograr una descripción del infante como una unidad.
The economics of climate change impacts a la Stern. Novel and nuanced or rhetorically restricted?
International Nuclear Information System (INIS)
Spash, Clive L.
2007-01-01
The Stern report conducts an estimation of Greenhouse Gas control costs weighed against the benefits of avoiding damages at the global scale. As I show, Stern and colleagues are aware of the limits to CBA (cost benefit analysis), although they chose to ignore the considerable literature on the subject, the many contributions by ecological economists, and especially work specific to the enhanced Greenhouse Effect. Various problems are raised or mentioned in the report including: strong uncertainty, incommensurability, plural values, non-utilitarian ethics, rights, distributional inequity, poverty, and treatment of future generations. How then can this report, acknowledging so many of those aspects of climate change that render CBA an unsuitable tool for generating policy recommendations, go ahead to conduct a global CBA and make policy recommendations? I explain how issues are suppressed and sidelined in a careful and methodical manner, with the pretence they have been addressed by 'state of the art' solutions. Meanwhile, the authors maintain allegiance to an economic orthodoxy which perpetuates the dominant political myth that traditional economic growth can be both sustained and answer all our problems. Besides perpetuating myths, this diverts attention away from alternative approaches, away from ethical debates over harming the innocent, the poor and future generations, and away from the fundamental changes needed to tackle the very real and serious problems current economic systems pose for environmental systems. (author)
The economics of climate change impacts a la Stern. Novel and nuanced or rhetorically restricted?
Energy Technology Data Exchange (ETDEWEB)
Spash, Clive L. [CSIRO, Sustainable Ecosystems Division, GPO Box 284, Canberra, ACT 2601 (Australia)
2007-09-15
The Stern report conducts an estimation of Greenhouse Gas control costs weighed against the benefits of avoiding damages at the global scale. As I show, Stern and colleagues are aware of the limits to CBA (cost benefit analysis), although they chose to ignore the considerable literature on the subject, the many contributions by ecological economists, and especially work specific to the enhanced Greenhouse Effect. Various problems are raised or mentioned in the report including: strong uncertainty, incommensurability, plural values, non-utilitarian ethics, rights, distributional inequity, poverty, and treatment of future generations. How then can this report, acknowledging so many of those aspects of climate change that render CBA an unsuitable tool for generating policy recommendations, go ahead to conduct a global CBA and make policy recommendations? I explain how issues are suppressed and sidelined in a careful and methodical manner, with the pretence they have been addressed by 'state of the art' solutions. Meanwhile, the authors maintain allegiance to an economic orthodoxy which perpetuates the dominant political myth that traditional economic growth can be both sustained and answer all our problems. Besides perpetuating myths, this diverts attention away from alternative approaches, away from ethical debates over harming the innocent, the poor and future generations, and away from the fundamental changes needed to tackle the very real and serious problems current economic systems pose for environmental systems. (author)
Directory of Open Access Journals (Sweden)
Mehmet Atlar
2013-06-01
Full Text Available While displacement type Deep-V mono hulls have superior seakeeping behaviour at speed, catamarans typically have modest behaviour in rough seas. It is therefore a logical progression to combine the superior seakeeping performance of a displacement type Deep-V mono-hull with the high-speed benefits of a catamaran to take the advantages of both hull forms. The displacement Deep-V catamaran concept was developed in Newcastle University and Newcastle University's own multi-purpose research vessel, which was launched in 2011, pushed the design envelope still further with the successful adoption of a novel anti-slamming bulbous bow and tunnel stern for improved efficiency. This paper presents the hullform development of this unique vessel to understand the contribution of the novel bow and stern features on the performance of the Deep-V catamaran. The study is also a further validation of the hull resistance by using advanced numerical analysis methods in conjunction with the model test. An assessment of the numerical predictions of the hull resistance is also made against physical model test results and shows a good agreement between them.
INTERNACIONALIZAÇÃO DE MARCAS DE LUXO BRASILEIRAS: UM ESTUDO DE CASO DA JOALHERIA H. STERN
Directory of Open Access Journals (Sweden)
José Coelho de Andrade Albino
2009-01-01
Full Text Available Este estudo analisa os desafios que envolvem a gestão de marcas globais que atuam no campodo luxo, principalmente aquelas com origem em países do terceiro mundo como o Brasil. Paraa realização da pesquisa, adotou-se como estratégia metodológica o estudo de caso único,tendo-se como objeto empírico a joalheria H. Stern. O estudo se baseia em pesquisasbibliográficas; entrevistas em profundidade com os dirigentes da empresa; visitas técnicas àsua sede e principais lojas, pesquisa documental e análise de discurso das campanhasnacionais e internacionais da marca e dos seus principais concorrentes. Concluiu-se, ao finalda pesquisa, que a empresa seguiu os pressupostos da Escola de Uppsala ao promover suainternacionalização, assim como se encontra em fase de transição entre a primeira e segundacorrente do branding, conforme classificação proposta por Schultz, Antorini e Csaba (2005.Já com relação ao modelo de gestão de marcas de luxo desenvolvido por Beverland (2004,pode-se afirmar que a H. Stern gerencia, de forma consistente e integrada, sua marca emcontexto global.
DEFF Research Database (Denmark)
Andersen, Mathias Bækbo; Frey, J.; Bruus, Henrik
2010-01-01
Fundamental understanding of the unique physics at the solid-liquid interface in nanofluidic channels is essential for the advancement of basic scientific knowledge and the development of novel applications for pharmaceuticals, environmental health and safety, energy harvesting and biometrics [1......]. The current models used to describe surface phenomena in nanofluidics can differ by orders of magnitude from experimentally measured values [2]. To mitigate the discrepancies, we hypothesize that the Stern-layer capacitance Cs and the surface equilibrium constants pKa, vary with the composition of the solid...
Construction of exact solutions for the Stern-Gerlach effect
International Nuclear Information System (INIS)
Diaz Bulnes, J.; Oliveira, I.S.
2001-01-01
We obtain exact solutions for the Schroedinger-Pauli matrix equation for a neutral particle of spin 1/2 in a magnetic field with a field gradient. The analytical wave functions are written on the symmetry plane Y = 0, which contains the incident and splitted beams, in terms of the Airy functions. The time-evolution of the probability, |Ψ+| 2 and |Ψ-| 2 , and the eigenenergies are calculated. The include a small contribution from the field gradient, α, proportional to (α ℎ) 2/3 , which amount to equal energy displacements on both magnetic levels. The results are generalized for spin S = 3/2, and in this case we found that the m = ±1/2 and m = ±3/2 magnetic sublevels are unequally splitted by the field gradient, being the difference in energy of the order 0.4 MHz. Replacing real experimental parameters we obtained a spatial splitting of the spin up and spin down states of the order Δz ≅4 mm, in accordance to a real Stern-Gerlach experiment. (author)
Dietz, Simon; Morton, Alec
2011-01-01
In this article, we compare two high-profile strategic policy reviews undertaken for the U.K. government on environmental risks: radioactive waste management and climate change. These reviews took very different forms, both in terms of analytic approach and deliberation strategy. The Stern Review on the Economics of Climate Change was largely an exercise in expert modeling, building, within a cost-benefit framework, an argument for immediate reductions in carbon emissions. The Committee on Radioactive Waste Management, on the other hand, followed a much more explicitly deliberative and participative process, using multicriteria decision analysis to bring together scientific evidence and stakeholder and public values. In this article, we ask why the two reviews were different, and whether the differences are justified. We conclude that the differences were mainly due to political context, rather than the underpinning science, and as a consequence that, while in our view "fit for purpose," they would both have been stronger had they been less different. Stern's grappling with ethical issues could have been strengthened by a greater degree of public and stakeholder engagement, and the Committee on Radioactive Waste Management's handling of issues of uncertainty could have been strengthened by the explicitly probabilistic framework of Stern. © 2010 Society for Risk Analysis.
Hendrickson, Kelli; Yue, Dick
2016-11-01
This work presents the development and a priori testing of closure models for the incompressible highly-variable density turbulent (IHVDT) flow in the near wake region of a transom stern. This complex, three-dimensional flow includes three regions with distinctly different flow behavior: (i) the convergent corner waves that originate from the body and collide on the ship center plane; (ii) the "rooster tail" that forms from the collision; and (iii) the diverging wave train. The characteristics of these regions involve violent free-surface flows and breaking waves with significant turbulent mass flux (TMF) at Atwood number At = (ρ2 -ρ1) / (ρ2 +ρ1) 1 for which there is little guidance in turbulence closure modeling for the momentum and scalar transport along the wake. Utilizing datasets from high-resolution simulations of the near wake of a canonical three-dimensional transom stern using conservative Volume-of-Fluid (cVOF), implicit Large Eddy Simulation (iLES), and Boundary Data Immersion Method (BDIM), we develop explicit algebraic turbulent mass flux closure models that incorporate the most relevant physical processes. Performance of these models in predicting the turbulent mass flux in all three regions of the wake will be presented. Office of Naval Research.
Ivanov, Dmitri
2003-01-01
Kirjanik A. A. Shahhovski komöödias "Uus Stern" (1805) esitatud "tundliku kangelase" ja "veidriku" teemade intertekstuaalne võrdlus J. B. Knjazhnini komöödiaga "Veidrikud" (1790) ja koomilise ooperiga "Nesthastije ot karetõ" (1779)
ASSERT validation against the Stern Laboratories' single-phase pressure drop tests
International Nuclear Information System (INIS)
Waddington, G.M.; Kiteley, J.C.; Carver, M.B.
1995-01-01
This paper describes the preliminary validation of ASSERT-IV against the single-phase pressure drop tests from the 37-element CHF (critical heat flux) experiments conducted at Stern Laboratories, and shows how this study fits into the overall ASSERT validation plan. The effects on the pressure drop of several friction and form loss models are evaluated, including the geometry-based K-factor model. The choice of friction factor has a small effect on the predicted channel pressure drop, compared to the form loss model choice. Using the uniform K-factors of Hameed, the computed pressure drops are in excellent agreement with the experimental results from the nominal pressure tube tests. For future ASSERT applications, either Hameed's uniform K-factors or the geometry-based model using Idelchik's thick-edged orifice equation are recommended, as are the friction factor correlations of Colebrook-White, Selander, and Aly and Groeneveld. More analysis of the geometry-based K-factor model is required. (author). 23 refs., 4 tabs., 9 figs
Simulation Analysis of Spherical Mechanical Seal Property of Marine Stern Shaft
Directory of Open Access Journals (Sweden)
Zhou Xu Hui
2016-01-01
Full Text Available The finite element model of spherical mechanical seal wasestablished with ANSYS, and the influence of seawater pressure, shaft speed and other factors on the sealing performance was discussed. The study results show that local contact situation of the spherical mechanical seal is in the outside of the seal rings, and both maximum contact pressure and temperature appearat the same position. As sea water pressure and stern shaft rotary speed are increased, the contact pressure and temperature of the spherical seal surface are raised, and when the contact pressure of seal surface is 0, the spherical seal surface forms two zones including contact one and clearance zone. The former is near the outside of the seal ring, the lateris close to the inside of one. These research results are of important theoretical significance and engineering application value for the development of new kinds of mechanical seals, and improvement of both safety and survivability of underwater vehicles.
2015-06-19
decontamination strategies>> Maryline DEFEZ 1, Melissa HUNTER3J Susan WELKOS :~J Christopher COTE3 1 University Grenoble-Alpes, Grenoble, France. 1...inosine hydrolase and alanine racemase to enhance the germination of Bacillus anthracis Sterne spores potential spore decontamination strategies 5a...8217 • Accidentally in Humans • Natural reservoir is soil • Anthrax Disease Cycle: - animals infected by soilborne spores in food and water or bites from certain
Attraction between two similar particles in an electrolyte: effects of Stern layer absorption
Directory of Open Access Journals (Sweden)
Franck Plouraboué
2010-03-01
Full Text Available When Debye length is comparable or larger than the distance between two identical particles, the overlapping among the particles double-layers can play an important role in their interactions. This paper presents a theoretical analysis of the interaction among two identical particles with overlapped double-layers. We particularly focus on the effect of a Stern electro static condition from linearization of the adsorption isotherm near the isoelectric (neutrality point in order to capture how polyvalent ion condensation affect sand reverses the surface charge. The stationary potential problem is solved within the framework of an asymptotic lubrication approach for a mean-field Poisson-Boltzmann model. Both spherical and cylindrical particles are analyzed. The results are finally discussed in the context of Debye-Hückel (D-H limit and beyond it.Quando o comprimento de Debye é comparável ou maior do que as distâncias entre duas partículas idênticas, a interseção entre as duplas camadas pode desempenhar papel importante na interação entre elas. Este artigo apresenta uma análise teórica da interação entre duas partículas idênticas as quais apresentam interseção entre as camadas duplas. Nós particularmente focamos a análise sobre o efeito da condição eletrostática de Stern a partir da linearização da isoterma de adsorção perto do ponto isoelétrico para capturar como a condensação do íon polivalente afeta e reverte a densidade de carga superficial. O problema que governa o potencial estacionário é resolvido no contexto de uma teoria assintótica de lubrificação para o modelo de Poisson-Boltzmann. O modelo é analisado para partículas cilíndricas e esféricas. Os resultados são finalmente discutidos no contexto do limite de Debye-Hückel e além dele.
Phaswana, P H; Ndumnego, O C; Koehler, S M; Beyer, W; Crafford, J E; van Heerden, H
2017-09-07
The Sterne live spore vaccine (34F2) is the most widely used veterinary vaccine against anthrax in animals. Antibody responses to several antigens of Bacillus anthracis have been described with a large focus on those against protective antigen (PA). The focus of this study was to evaluate the protective humoral immune response induced by the live spore anthrax vaccine in goats. Boer goats vaccinated twice (week 0 and week 12) with the Sterne live spore vaccine and naive goats were used to monitor the anti-PA and toxin neutralizing antibodies at week 4 and week 17 (after the second vaccine dose) post vaccination. A/J mice were passively immunized with different dilutions of sera from immune and naive goats and then challenged with spores of B. anthracis strain 34F2 to determine the protective capacity of the goat sera. The goat anti-PA ELISA titres indicated significant sero-conversion at week 17 after the second doses of vaccine (p = 0.009). Mice receiving undiluted sera from goats given two doses of vaccine (twice immunized) showed the highest protection (86%) with only 20% of mice receiving 1:1000 diluted sera surviving lethal challenge. The in vitro toxin neutralization assay (TNA) titres correlated to protection of passively immunized A/J mice against lethal infection with the vaccine strain Sterne 34F2 spores using immune goat sera up to a 1:10 dilution (r s ≥ 0.522, p = 0.046). This study suggests that the passive mouse protection model could be potentially used to evaluate the protective immune response in livestock animals vaccinated with the current live vaccine and new vaccines.
Kuusk, Priit, 1938-
1999-01-01
30. apr.-7. juunini toimuvast muusikafestivalist Schwetzingenis. D. Ellingtoni 100. sünniaastapäeva tähistamisest maailmas. Valmis Linzi uue ooperimaja planeering. I. Stern juhatas kümnepäevast seminari Kölni Kõrgema Muusikakooli juures. Rahvusvahelise Nüüdismuusika Ühingu (ISCM) iga-aastased maailma muusikapäevad toimuvad 2000. aastal Luksemburgis
Chen, C.; Bolle, L.J.; Boois I.J. de, Ingeborg
2016-01-01
Since 1972, the Demersal Fish Survey (DFS) in the Wadden Sea has been carried out with the RV Stern. Within a few years this vessel will be replaced by another vessel as a result of the current ship replacement policy of Rijkswaterstaat Rijksrederij. It is not yet clear which vessel will replace RV
Energy Technology Data Exchange (ETDEWEB)
Jaing, Crystal [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Vergez, Lisa [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Hinckley, Aubree [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thissen, James [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gardner, Shea [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); McLoughlin, Kevin [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jackson, Paul [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ellingson, Sally [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Hauser, Loren [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Brettin, Tom [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Fofanov, Viacheslav [Eureka Genomics, Hercules, CA (United States); Koshinsky, Heather [Eureka Genomics, Hercules, CA (United States); Fofanov, Yuriy [Univ. of Houston, TX (United States)
2011-06-21
The objective of this project is to provide DHS a comprehensive evaluation of the current genomic technologies including genotyping, Taqman PCR, multiple locus variable tandem repeat analysis (MLVA), microarray and high-throughput DNA sequencing in the analysis of biothreat agents from complex environmental samples. As the result of a different DHS project, we have selected for and isolated a large number of ciprofloxacin resistant B. anthracis Sterne isolates. These isolates vary in the concentrations of ciprofloxacin that they can tolerate, suggesting multiple mutations in the samples. In collaboration with University of Houston, Eureka Genomics and Oak Ridge National Laboratory, we analyzed the ciprofloxacin resistant B. anthracis Sterne isolates by microarray hybridization, Illumina and Roche 454 sequencing to understand the error rates and sensitivity of the different methods. The report provides an assessment of the results and a complete set of all protocols used and all data generated along with information to interpret the protocols and data sets.
Gaensbauer, Theodore J
2016-01-01
Lou Sander and Dan Stern made seminal contributions to our understanding of early child development, particularly in regard to the moment-to-moment intersubjective exchanges and mutual sensitivity that are at the core of the caregiver-infant relationship. Although their own studies focused primarily on the ways in which children's intersubjective experiences of mutual attunement lead to adaptive social relatedness and validate a healthy sense of self, this article focuses on the applicability of their theoretical conceptions to the development of pathological social relations. It explores the premise that the emotional validation derived from recurrent intersubjective experiences of mutual attunement involving negative affects can be as emotionally compelling from the child's standpoint as that derived from positive exchanges. Children's needs to recreate unhealthy, but affectively meaningful, moments with their caregivers can lead to ingrained, automatically operating pathological patterns of social behavior and affective expression that can take on a life of their own and strongly shape the child's subsequent socioemotional functioning. Following an overview of Sander's and Stern's conceptual thinking, developmental research and clinical case material will be utilized to illustrate how their work can enrich our understanding of developmental processes that can contribute to a number of emotion-specific, early relational disturbances. © 2016 Michigan Association for Infant Mental Health.
Beetz, Jürgen
2016-01-01
Jürgen Beetz zeigt zuerst den Ursprung der erdachten Geschichten der Physik aus der Steinzeit, denn vieles ist so einfach, dass es schon Steinzeitmenschen hätten verstehen können. Im Anschluss daran untersucht der Autor das Weltall auf seine Bestandteile: Monde, Planeten, Sterne, Galaxien usw. Daraus ergibt sich die Frage nach dessen Struktur und Dynamik: Ist das Universum ewig, endlos, konstant? Nichts davon: Es hat eine Entstehungsgeschichte, es expandiert und verändert sich – zum Teil aus noch ungeklärten Ursachen. Besonderes Augenmerk richtet er auf die Expansion des Weltalls und die sich daraus ergebenden Folgen.
Directory of Open Access Journals (Sweden)
Pasquale Caponnetto
2013-12-01
Full Text Available La coppia criminale è un fenomeno poco comune nell'ambito dei delitti in quanto la maggior parte dei criminali commette il crimine da solo o coinvolge altri individui solo per caso. Ciò nonostante, la letteratura rivela una serie di coppie criminali che hanno commesso diversi crimini, fino ad arrivare all’omicidio. Alcuni hanno ucciso per denaro, altri per odio, altri ancora per amore, per vendetta, per perversione. Bonnie e Clyde, Olindo e Rosa, Erika e Omar sono espressione di un viaggio nel fenomeno del “crimine di coppia” in cui manifestazioni di follia a due, al di là dell’infatuazione reciproca e della dipendenza psicologica, si svuotano di qualsiasi accezione romantica per concretizzarsi in qualcosa di spaventoso e incontenibile, capace di sfuggire ad ogni tipo di catalogazione e comprensione. Nel presente lavoro, in particolare, si andrà ad analizzare la coppia criminale degli autori della strage di Erba, che verrà esaminata nell’ottica della coscienza intersoggettiva di Stern. Le couple criminel est un phénomène rare puisque la majorité des crimes sont commis par des criminels seuls ou ce n’est que par hasard qu’ils impliquent d’autres personnes. Toutefois, la littérature parle d’une série de couples criminels qui ont commis des différents types de crimes (homicide inclus. Certains d’entre eux tuent pour de l’argent, certains autres à cause de la haine, de l’amour, de la revanche ou de la perversion. Bonnie et Clyde, Olindo et Rosa, Erika et Omar constituent des exemples du phénomène du « crime en couple ». Ce sont des situations de folie à deux qui n’ont aucune acception romantique et qui se traduisent en quelque chose d’horrifiant et d’incontrôlé. Dans cet article, les auteurs vont analyser le couple criminel composé par les responsables du massacre de Erba (Italie du Nord. L’objectif est d’examiner ce couple en utilisant l’approche de la conscience intersubjective de Daniel
Effects of hull form parameters on seakeeping for YTU gulet series with cruiser stern
Directory of Open Access Journals (Sweden)
Cakici Ferdi
2014-09-01
Full Text Available This study aims to identify the relations between seakeeping characteristics and hull form parameters for YTU Gulet series with cruiser stern. Seakeeping analyses are carried out by means of a computer software which is based on the strip theory and statistical short term response prediction method. Multiple regression analysis is used for numerical assessment through a computer software. RMS heave-pitch motions and absolute vertical accelerations on passenger saloon for Sea State 3 at head waves are investigated for this purpose. It is well known that while ship weight and the ratios of main dimensions are the primary factors on ship motions, other hull form parameters (CP, CWP, CVP, etc. are the secondary factors. In this study, to have an idea of geometric properties on ship motions of gulets three different regression models are developed. The obtained outcomes provide practical predictions of seakeeping behavior of gulets with a high level of accuracy that would be useful during the concept design stage
National Research Council Canada - National Science Library
Cusanelli, Dominic S; Chesnakas, Christopher J
2007-01-01
...) and Stock Propeller Powering and Stern Flap Evaluation tests (Series 3. In order to assist in the design of a propeller for the BSS hull, the nominal wakes in the inboard and outboard starboard propeller planes were measured using LDV...
Beyond the Stern Review. Lessons from a risky venture at the limits of the cost-benefit analysis
International Nuclear Information System (INIS)
Hourcade, Jean-Charles; Ambrosi, Philippe; Dumas, Patrice
2009-01-01
This paper argues that debates amongst economists triggered by the Stern Review are partly relevant, focusing on key parameters translating real ethical issues, and partly misplaced in that they do not consider enough other determinants of climate change damages: (1) the specifications of the utility function used for the assessments (preference for the environment, preference for smooth growth paths), (2) the interplay between uncertainty and the sequentiality of the decision, and (3) whether the growth engines behind the integrated assessment models can account for transient disequilibrium and sub-optimality. We derive some suggestions for any future research agenda in integrated assessment modelling, whatever the position of the analysts about the relevance of the intertemporal optimisation framework and the Bayesian approach to uncertainty in the climate affair. (author)
Lim, Jongil; Whitcomb, John; Boyd, James; Varghese, Julian
2007-01-01
A finite element implementation of the transient nonlinear Nernst-Planck-Poisson (NPP) and Nernst-Planck-Poisson-modified Stern (NPPMS) models is presented. The NPPMS model uses multipoint constraints to account for finite ion size, resulting in realistic ion concentrations even at high surface potential. The Poisson-Boltzmann equation is used to provide a limited check of the transient models for low surface potential and dilute bulk solutions. The effects of the surface potential and bulk molarity on the electric potential and ion concentrations as functions of space and time are studied. The ability of the models to predict realistic energy storage capacity is investigated. The predicted energy is much more sensitive to surface potential than to bulk solution molarity.
The effect of growth medium on B. anthracis Sterne spore carbohydrate content.
Colburn, Heather A; Wunschel, David S; Antolick, Kathryn C; Melville, Angela M; Valentine, Nancy B
2011-06-01
The expressed characteristics of biothreat agents may be impacted by variations in the culture environment, including growth medium formulation. The carbohydrate composition of B. anthracis spores has been well studied, particularly for the exosporium, which is the outermost spore structure. The carbohydrate composition of the exosporium has been demonstrated to be distinct from the vegetative form containing unique monosaccharides. We have investigated the carbohydrate composition of B. anthracis Sterne spores produced using four different medium types formulated with different sources of medium components. The amount of rhamnose, 3-O-methyl rhamnose and galactosamine was found to vary significantly between spores cultured using different medium formulations. The relative abundance of these monosaccharides compared to other monosaccharides such as mannosamine was also found to vary with medium type. Specific medium components were also found to impact the carbohydrate profile. Xylose has not been previously described in B. anthracis spores but was detected at low levels in two media. This may represent residual material from the brewery yeast extract used to formulate these two media. These results illustrate the utility of this method to capture the impact of growth medium on carbohydrate variation in spores. Detecting carbohydrate profiles in B. anthracis evidentiary material may provide useful forensic information on the growth medium used for sporulation. Copyright © 2011 Elsevier B.V. All rights reserved.
The economics of climate change - the Stern review
Energy Technology Data Exchange (ETDEWEB)
Stern, N. Sir
2007-01-15
This review was announced by the Chancellor of the Exchequer in July 2005. It was undertaken by Sir Nicholas Stern, Head of the Government Economic Service and Adviser to the Government on the economics of climatic change and development. Having analysed a wide range of evidence on the impact of climate change, the aim of the review was to assess the economics of a low-carbon global economy; the long-term perspective; timescale for action; the choice of policies and institutions and specific lessons for the UK, in the context of its existing climate change goals. Using the results from formal economic models, the review estimates that if we don't act, the overall costs and risks of climate change will be equivalent to losing at least 5% of global GDP each year. If a wider range of risks and impacts is taken into account the estimates of damage could rise to 20% of GDP or more. The first half of the review considers how the evidence on the economic impact of climate, costs and benefits of action to reduce greenhouse gas emissions relates to the conceptual framework described. It covers climate change, including chapters on the science of climate change economics, ethics and discusses how climate change affects people worldwide, the implication of climate change for development, the costs of climate change in developed countries and economic modelling of climate change impacts. Other areas covered in this review include projecting the growth of greenhouse gas emissions, the cost of mitigation and macroeconomic modelling of costs. Adaptation to climate change is of the utmost importance, and whilst it is no longer possible to prevent the climate change that will take place over the next two to three decades it is still possible to protect our societies and economies from its impacts in the future. Promoting international cooperation, the role of adaptation in sustainable development and creating a global price for carbon are also discussed in this review. An
International Nuclear Information System (INIS)
Hertenberger, R.; Eisermann, Y.; Metz, A.; Schiemenz, P.; Graw, G.
2001-01-01
The 14 year old Lamb-Shift hydrogen source of the Munich Tandem laboratory is presently replaced by a newly developed Stern-Gerlach type atomic beam source (ABS) with electron-cyclotron-resonance (ECR) ionization and subsequent double charge exchange in a supersonic cesium vapor jet target. The atomic beam source provides an intensity of 6.4*10 16 atoms/sec of polarized hydrogen and of about 5*10 16 atoms/sec of polarized deuterium. Beam intensities larger than 100 μA were observed for positive H-vector + and D-vector + ion beams after ECR ionization and intensities larger than 10 μA for negative D-vector - ion beams in three magnetic substates
Talking about terrorism: Q and A with Jessica Stern
International Nuclear Information System (INIS)
Stern, J.
2006-01-01
Nuclear terrorism remains a potent threat. We have known for some time that terrorist groups have been seeking weapons of mass destruction. There are various ways that terrorists could use nuclear and other radioactive materials: they could acquire a nuclear weapon from a nuclear State; they could acquire the necessary fissile material and produce a weapon on their own, creating an improvised nuclear device; they could attack a nuclear power plant; or they could create a radiation dispersal device, a so-called dirty bomb. The first possibility would be the most devastating, but it is also probably the least likely. Stealing a bomb would be difficult because of the generally high security of facilities where nuclear weapons are stored. And a State that gave nuclear weapons to terrorists would have to seriously consider the probability that the source of the bomb could be identified, so retaliation against the State would be likely. In this regard, the revelation that terrorist groups were carrying out reconnaissance missions at Russian nuclear-weapon storage sites in 2001 was troubling; but the terrorists' efforts quickly became known to security personnel. The second possibility-the risk that terrorists will acquire nuclear-weapons usable materials-must be taken extremely seriously, especially in light of revelations about meetings between Pakistani nuclear scientists and al Qaeda, and about a clandestine effort to export nuclear technology run by the Khan network. Terrorists' dispersal of radioactive materials - either by attacking a nuclear plant or disseminating those materials with a home-made device-is the most likely scenario. Still, it is important to keep the threat in perspective. Dirty bombs are far more frightening than lethal. The article provides responses of Jessica Stern on questions about how big a threat nuclear terrorism is, how to minimize the risks of nuclear terrorism, the behaviour of states to combat the roots and reach of nuclear terrorism
The price of change [The Stern Review looks at the economics of climate change
International Nuclear Information System (INIS)
Stern, N.
2007-01-01
The Stern Review on the Economics of Climate Change, commissioned by the UK Treasury, has assessed a wide range of evidence on the impacts of climate change and on the economic costs. And, in its review, has used a number of different techniques to assess costs and risks. From all of these perspectives, the evidence gathered by the Review leads to a simple conclusion: the benefits of strong and early action far outweigh the economic costs of not acting. Climate change will affect the basic elements of life for people around the world - access to water, food production, health, and the environment. Hundreds of millions of people could suffer hunger, water shortages and coastal flooding as the world warms. So prompt and strong action is clearly warranted. Because climate change is a global problem, the response to it must be international. It must be based on a shared vision of long term goals and agreement on frameworks that will accelerate action over the next decade, and it must build on mutually reinforcing approaches at national, regional and international level. The UN Framework Convention on Climate Change and the Kyoto Protocol provide a basis for international co-operation, along with a range of partnerships and other approaches. But more ambitious action is now required around the world
A Study on molecular characterization of Razi Bacillus anthracis Sterne 34F2 substrain in Iran
Directory of Open Access Journals (Sweden)
Tadayon, K.
2016-07-01
Full Text Available Anthrax, a zoonotic disease caused by Bacillus anthracis, has affected humans since ancient times. For genomic characterization of Razi B. anthracis Sterne 34F2 substrain, single nucleotide polymorphism (SNP genotyping method developed by Van Erth, variable-number tandem-repeat (VNTR-8 analysis proposed by Keim, and multiple-locus VNTR analysis (MLVA-3 introduced by Levy were employed. In the SNPs typing system, where the nucleotide content of the genome at 13 evolutionary canonical loci was collectively analyzed, the originally South African 34F2 substrain was categorized in the A.Br.001/002 subgroup. In the VNTR-8 analysis, fragments with lengths of 314, 229, 162, 580, 532, 158, and 137 bp were identified at the following loci: vrrA, vrrB1, vrrB2, vrrC1, vrrC2, CG3, and pxO1, respectively. In addition, application of Levy's MLVA-3 genotyping method revealed that the genome of this strain carried 941, 451, and 864 bp fragments at AA03, AJ03, and AA07 loci, respectively. The present findings are undoubtedly helpful in meeting the requirements set by the World Organization for Animal Health (OIE and World Health Organization (WHO for anthrax vaccine manufacturers including Razi Institute. However, further similar studies are required to promote the current epidemiological knowledge of anthrax in Iran.
Bizarreness and Emotion Identification in Grete Stern Photomontages: Gender and Age Disparities.
Rosales-Lagarde, Alejandra; Martínez-Alcalá, Claudia Isabel; Pliego-Pastrana, Patricia; Molina-Trinidad, Eva María; Díaz, José-Luis
2017-01-01
Although the International Affective Picture System (IAPS) is used to evaluate emotions (valence, arousal, and dominance evoked by a large set of photographs), bizarre images in works of art have not been assessed with the IAPS procedures. Understood here as strange, non-sense, and absurd mental contents or expressions accompanied by surprise and confusion emotions, bizarreness was assessed after healthy adult volunteers assigned this specified variable to 140 Grete Stern's photomontages overtly intended to illustrate strange, absurd, and non-sensical contents in dream reports. The images were presented to 21 Young Males (YM) and 30 Young Females (YF) who were instructed to use the IAPS Self-Assessment Manikin, along with an additional bizarre-to-normal scale, to evaluate their response to them. The valence and the bizarre-to-normal ratings showed a dissimilar pattern of distribution between genders. Ratings of scales were different, and a greater variation in scales occurred according to gender. When bizarreness was appraised, gender differences became more evident especially for YF, who rated half of the images as bizarre, and with a diminished feeling of control, while the neutral and normal images were deemed more pleased and controlled. Valence, bizarreness, and dominance formed a different component than arousal in both groups. Negative correlations between valence and dominance, and between valence and bizarreness were also found in both groups, plus a positive one for dominance and bizarreness in YF, along with curvilinear relationships among all scales. On a second experiment, 10 photomontages evaluated by YF as bizarre or as normal were administered to 18 Old Males (OM) and 28 Old Females (OF). OF's arousal showed less neutral evaluations than OM's. In OF the bizarre images evoked either more excitation or calmness than in OM. The distribution of the bizarre-to-normal scale was significantly different across the evaluations in YM, YF, OM, and OF. The use
Directory of Open Access Journals (Sweden)
Sarjito Jokosisworo
2012-04-01
Full Text Available Kapal KM. Kirana I adalah kapal tipe Ro - Ro Passanger Ship yang beroperasi di Pulau Jawa dengan rute pelayaran Pelabuhan Semarang - Sampit yang mampu mengangkut penumpang dan kendaraan dalam jumlah yang relatif banyak. Untuk memudahkan akses keluar masuk kendaraan yang akan diangkut, maka kapal ini dilengkapi dengan sebuah ramp door sistem steel wire rope yang terletak di bagian buritan kapal (stern ramp door. Ramp door akan menerima beban dinamis secara berulang-ulang sehingga mengakibatkan kelelahan material (fatigue. Analisa fatigue konstruksi rampdoor dilakukan dengan menggunakan metode elemen hingga diskrit segitiga plane stress dengan tujuan untuk mendapatkan hasil analisa yang lebih akurat. Pemodelan dilakukan dengan menggunakan program bantu berbasis CAD, sedangkan untuk analisa fatigue menggunakan program berbasis elemen hingga. Analisa yang digunakan adalah analisa beban dinamis dengan amplitudo berubah berdasarkan variasi 4 beban kendaran. Untuk mengetahui letak kondisi paling kritis rampdoor dibagi menjadi 3 bagian dengan mengambil lokasi pnode 180, 140, dan 100. Berdasarkan hasil analisa didapat umur ramp door selama 3186 siklus atau 2 tahun 9 bulan 4 hari dan mempunyai nilai intensitas tegangan patah sebenarnya sebesar 400,713 Mpa.
International Nuclear Information System (INIS)
Jueptner, G.; Kumpf, H.; Molz, G.; Neunert, B.; Seidl, O.
1976-01-01
This report goes into the reasons for selecting a 'STERN' (star) vessel configuration for accommodating a complete primary circuit including PWR, this involving the grouping of cylindrical pressure vessels of independent design into a star-shaped configuration with the central vessel housing the reactor core in the middle. This arrangement was made possible by application of the DYWIDAG-radial prestressing process generating controlled annular prestressing using existing presses and by an organic coupling of individual vessels. The liner, heat insulating and cooling system required for each vessel comprises a so-called support boiler, i.e. a hot liner not handicapped by the disadvantages of other systems. The support boiler is placed in the and PCV and has flat floor and cover surfaces. Temperature constraints are reduced to specific design requirements by means of radial gap permitting precise adjustment in conjunction with an axial expanding element comprising a multilayer diaphragm which is supported in operation. A detailed description is given of the PCPV, the support boiler and the cover used in the center vessel as well as of their design, the assembly and construction work is described and a summary presented of the quantities and estimated prices involved. Due to the absence of steam raising facilities adapted to meet the star-shaped configuration requirements, a study of satellite vessels was dispensed with, the design of which is in full accord with that of the center vessel. One part of the report is concerned with the calculation of the center vessel. (orig./HP) [de
STRATUL DUBLU ELECTRIC AL MONTMORILONITULUI. II. ANALIZE COMPARATIVE ALE MODELELOR
Directory of Open Access Journals (Sweden)
Vasile RUSU
2017-07-01
Full Text Available A fost analizată relaţia potenţial – distanţa de la suprafaţa solidului în volumul soluţiei în modelul Gouy-Chapman, modelul Stern şi modelul modificat Gouy-Chapman. Modelările efectuate conform modelului Stern pentru H-montmorilonit şi Al-montmorilonit intercalat cu oligomeri de aluminiu evidenţiază particularităţile stratului dublu electric în proximitatea suprafeţei bazale şi a suprafeţei laterale a montmorilonitului. Dinamica potenţialului în volumul soluţiei prin modelul modificat Gouy-Chapman devine identică modelului Stern, în condiţiile atribuirii caracteristicilor stratului compact din modelul Stern.EDL FOR MONTMORILLONITE. II. COMPARATIVE ANALYSIS OF MODELS The relationship potential - the distance from the surface of the solid towards the solution by the Gouy-Chapman model, the Stern model, and the modified Gouy-Chapman model were analyzed. Modeling performed according to the Stern model for H-montmorillonite and pillared Al-montmorillonite highlights the peculiarities of the double electric layer close to the basal and edge surfaces. The potential dynamics in the solution by the modified Gouy-Chapman model becomes identical to the Stern model if the main characteristics of Stern layer are attributed.
Distributed Multi-propulsion Units System
原田, 正志; HARADA, Masashi
2002-01-01
Reduction of the weight of the propulsion system is important in the design of a stratospheric airship. However, it also important to increaseefficiency of the system because available energy generated by solar cells on the hull is quite limited. One solution to increase efficiency of the propulsion system is to use a stern propeller, the propeller mounted on the stern of the hull as shown in Figure 1. Mounted on the stern of the hull, the stern propeller is merged with the boundary layer of ...
Tomasula, P M; Mukhopadhyay, S; Datta, N; Porto-Fett, A; Call, J E; Luchansky, J B; Renye, J; Tunick, M
2011-09-01
High-temperature, short-time pasteurization of milk is ineffective against spore-forming bacteria such as Bacillus anthracis (BA), but is lethal to its vegetative cells. Crossflow microfiltration (MF) using ceramic membranes with a pore size of 1.4 μm has been shown to reject most microorganisms from skim milk; and, in combination with pasteurization, has been shown to extend its shelf life. The objectives of this study were to evaluate MF for its efficiency in removing spores of the attenuated Sterne strain of BA from milk; to evaluate the combined efficiency of MF using a 0.8-μm ceramic membrane, followed by pasteurization (72°C, 18.6s); and to monitor any residual BA in the permeates when stored at temperatures of 4, 10, and 25°C for up to 28 d. In each trial, 95 L of raw skim milk was inoculated with about 6.5 log(10) BA spores/mL of milk. It was then microfiltered in total recycle mode at 50°C using ceramic membranes with pore sizes of either 0.8 μm or 1.4 μm, at crossflow velocity of 6.2 m/s and transmembrane pressure of 127.6 kPa, conditions selected to exploit the selectivity of the membrane. Microfiltration using the 0.8-μm membrane removed 5.91±0.05 log(10) BA spores/mL of milk and the 1.4-μm membrane removed 4.50±0.35 log(10) BA spores/mL of milk. The 0.8-μm membrane showed efficient removal of the native microflora and both membranes showed near complete transmission of the casein proteins. Spore germination was evident in the permeates obtained at 10, 30, and 120 min of MF time (0.8-μm membrane) but when stored at 4 or 10°C, spore levels were decreased to below detection levels (≤0.3 log(10) spores/mL) by d 7 or 3 of storage, respectively. Permeates stored at 25°C showed coagulation and were not evaluated further. Pasteurization of the permeate samples immediately after MF resulted in additional spore germination that was related to the length of MF time. Pasteurized permeates obtained at 10 min of MF and stored at 4 or 10°C showed no
Orna Me: Laurence Sterne’s Open Letter to Literary History
Directory of Open Access Journals (Sweden)
Celia B. Barnes
2016-12-01
Full Text Available This essay considers the curious way Laurence Sterne communicates with and reflects on his literary predecessors, most often Alexander Pope, by writing love letters to women. Focusing primarily on his correspondence with Elizabeth Draper, Barnes contends that, even as Sterne looks back to Pope to guarantee himself a place in literary history, he looks forward to women like Draper to ensure his name will survive. Thus, erotic correspondence becomes an important way of ensuring Sterne’s literary estate, or as he terms it, his “futurity.” “Orna Me”—a phrase that means, roughly, “ornament me” or “set me off,” and that Sterne got from Pope and Swift, who got it from Cicero—allows Sterne to plug in to a literary tradition that privileges collaboration: append something of yours to something of mine. It is this idea of letter-writing as correspondence, a collaborative process between friends or lovers, that unites Sterne to his female correspondent and to literary tradition all at once.
STRATUL DUBLU ELECTRIC AL MONTMORILONITULUI. I. INFLUENŢA INTERCALĂRII CU OLIGOMERI DE ALUMINIU
Directory of Open Access Journals (Sweden)
Vasile RUSU
2017-03-01
Full Text Available A fost dezvoltat criteriul pentru delimitarea caracteristicilor stratului dublu electric în proximitatea suprafeţei bazale şi suprafeţei laterale ale montmorilonitului intercalat cu oligomeri de aluminiu şi au fost determinate caracteristicile stratului dublu electric în modelul Stern. În funcţie de cazul analizat, pentru stratul dublu în proximitatea suprafeţei bazale sau în proximitatea suprafeţei laterale pot fi estimate caracteristicile stratului compact – potenţialul Stern Yd, energia de adsorbţie specifică chimică Ø, densitatea de sarcini sc.EDL FOR MONTMORILLONITE. I. THE INFLUENCE OF Al-PILLARING It was developed the criterion for delimiting of characteristics for electric double layer (EDL close to the basal surface and edge surface of pillared Al-montmorillonite, and the EDL characteristics in the Stern model were determined. Depending on the case, for EDL close to the basal surface or edge surface, the main characteristics of Stern layer can be estimated, i.e. the Stern potential Yd, chemical specific adsorption energy Ø and charge density sc.
The Impact of Climate Change on the Balanced-Growth-Equivalent: An Application of FUND
David Anthoff; Richard S. J. Tol
2008-01-01
The Stern Review added balanced growth equivalents (BGE) to the economic climate change research agenda. We first propose rigorous definitions of the BGE for multiple regions and under uncertainty. We show that the change in the BGE is independent of the assumed scenario of per capita income. For comparable welfare economic assumptions as the Stern Review, we calculate lower changes in BGE between a business as usual scenario and one without climate impacts with the model FUND than the Stern ...
DEFF Research Database (Denmark)
Schubart, Rikke
2013-01-01
Review of the movie Jobs (Joshua Michael Stern, 2013), a drama about Steve Jobs, the founder of Apple.......Review of the movie Jobs (Joshua Michael Stern, 2013), a drama about Steve Jobs, the founder of Apple....
Brown, Matthew A.; Abbas, Zareen; Kleibert, Armin; Green, Richard G.; Goel, Alok; May, Sylvio; Squires, Todd M.
2016-01-01
The structure of the electrical double layer has been debated for well over a century, since it mediates colloidal interactions, regulates surface structure, controls reactivity, sets capacitance, and represents the central element of electrochemical supercapacitors. The surface potential of such surfaces generally exceeds the electrokinetic potential, often substantially. Traditionally, a Stern layer of nonspecifically adsorbed ions has been invoked to rationalize the difference between these two potentials; however, the inability to directly measure the surface potential of dispersed systems has rendered quantitative measurements of the Stern layer potential, and other quantities associated with the outer Helmholtz plane, impossible. Here, we use x-ray photoelectron spectroscopy from a liquid microjet to measure the absolute surface potentials of silica nanoparticles dispersed in aqueous electrolytes. We quantitatively determine the impact of specific cations (Li+ , Na+ , K+ , and Cs+ ) in chloride electrolytes on the surface potential, the location of the shear plane, and the capacitance of the Stern layer. We find that the magnitude of the surface potential increases linearly with the hydrated-cation radius. Interpreting our data using the simplest assumptions and most straightforward understanding of Gouy-Chapman-Stern theory reveals a Stern layer whose thickness corresponds to a single layer of water molecules hydrating the silica surface, plus the radius of the hydrated cation. These results subject electrical double-layer theories to direct and falsifiable tests to reveal a physically intuitive and quantitatively verified picture of the Stern layer that is consistent across multiple electrolytes and solution conditions.
Directory of Open Access Journals (Sweden)
Gabriela Capurro
2011-07-01
Full Text Available This study aims to assess the impact of the Unique Minds Program (Stern, 1999 in schoolchildren diagnosed with learning disabilities (LD and their families, whom consulted the Santo Tomas University´s Psychological Service Center in Santiago - Chile, with regards to the following variables: self-esteem, depressive symptoms and family operation. The ages of the children – that are of the middle socio-economic level, fluctuated between eight and twelve years old. For the pre and post-tests, a pre-experimental design was used with one group. For data collection and analysis a mixed method was used, with the application of the following instruments: the Family Adaptability and Cohesion Scale (A-FACES III, the Child Depression Inventory (CDI, the Piers-Harris Children´s Self-Concept Scale, a Socio-demographic Survey and an assessment for each session. The results did not return any significant statistical differences regarding the variables. However, qualitative differences of the workshop’s central ideas are perceived. More specifically, there is a redefining of LD, developing new strategies for confrontation and internalizing the concept of shared responsibility for both the family and school.
Directory of Open Access Journals (Sweden)
Matthew A. Brown
2016-01-01
Full Text Available The structure of the electrical double layer has been debated for well over a century, since it mediates colloidal interactions, regulates surface structure, controls reactivity, sets capacitance, and represents the central element of electrochemical supercapacitors. The surface potential of such surfaces generally exceeds the electrokinetic potential, often substantially. Traditionally, a Stern layer of nonspecifically adsorbed ions has been invoked to rationalize the difference between these two potentials; however, the inability to directly measure the surface potential of dispersed systems has rendered quantitative measurements of the Stern layer potential, and other quantities associated with the outer Helmholtz plane, impossible. Here, we use x-ray photoelectron spectroscopy from a liquid microjet to measure the absolute surface potentials of silica nanoparticles dispersed in aqueous electrolytes. We quantitatively determine the impact of specific cations (Li^{+}, Na^{+}, K^{+}, and Cs^{+} in chloride electrolytes on the surface potential, the location of the shear plane, and the capacitance of the Stern layer. We find that the magnitude of the surface potential increases linearly with the hydrated-cation radius. Interpreting our data using the simplest assumptions and most straightforward understanding of Gouy-Chapman-Stern theory reveals a Stern layer whose thickness corresponds to a single layer of water molecules hydrating the silica surface, plus the radius of the hydrated cation. These results subject electrical double-layer theories to direct and falsifiable tests to reveal a physically intuitive and quantitatively verified picture of the Stern layer that is consistent across multiple electrolytes and solution conditions.
Autonomous Refueling of Unmanned Vehicles at Sea
2008-03-28
As seen in Figure 3, a floating sponson, similar to the outside flotation collar on a RIB, is towed off the stern of the parent ship with a tow...V. Minnick, Thomas G. Beukema, Wojciech Kauczynski, Andrew L. Silver , and Christopher Cleary, “Stern Boat Deployment Systems and Operability
2011-06-07
...., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202- 685-5040. SUPPLEMENTARY INFORMATION... Forward Masthead Side lights Stern light, anchor Anchor lights lights arc Side lights Stern light distance distance light, relationship of Vessel Number of arc of arc of inboard of forward of height above aft light...
2011-04-21
... Navy, 1322 Patterson Ave., SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone number: 202... * * * * * Side lights Forward distance anchor Masthead inboard of Stern light light, Anchor lights lights arc Side lights Stern light ship's distance height relationship of aft Vessel Number of arc of arc of sides...
2012-04-25
... Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202- 685-5040. SUPPLEMENTARY... lights Stern light, Forward anchor relation-ship of Masthead lights arc Side lights arc of Stern light arc of distance inboard distance forward light, height aft light to Vessel Number of visibility; rule...
2012-10-16
... Patterson Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY... Stern light, Forward anchor relationship Masthead Side light arc Stern light distance in distance light height of aft light Vessel Number Lights arc of of visibility; arc of board of forward of above hull in...
Yan, Lujie; Masliyah, Jacob H; Xu, Zhenghe
2013-08-15
Smooth basal plane and edge surfaces of two platy phyllosilicate minerals (muscovite and talc) were prepared successfully to allow accurate colloidal force measurement using an atomic force microscope (AFM), which allowed us to probe independently interactions of divalent cations with phyllosilicate basal planes and edge surfaces. The Stern potential of basal planes and edge surfaces was obtained by fitting the measured force profiles with the classical DLVO theory. The fitted Stern potential of the muscovite basal plane became less negative with increasing Ca(2+) or Mg(2+) concentration but did not reverse its sign even at Ca(2+) or Mg(2+) concentrations up to 5 mM. In contrast, the Stern potential of the muscovite edge surface reversed at Ca(2+) or Mg(2+) concentrations as low as 0.1 mM. The Stern potential of the talc basal plane became less negative with 0.1 mM Ca(2+) addition and nearly zero with 1 mM Ca(2+) addition. The Stern potential of talc edge surface became reversed with 0.1 mM Ca(2+) or 1 mM Mg(2+) addition, showing not only a different binding mechanism of talc basal planes and edge surfaces with Ca(2+) and Mg(2+), but also different binding mechanism between Ca(2+) and Mg(2+) ions with basal planes and edge surfaces. Copyright © 2013 Elsevier Inc. All rights reserved.
Dreaming woman: Image, place, and the aesthetics of exile.
Greenspan, Rachel
2017-08-01
Looking closely at an Argentine dream interpretation column published in a popular women's magazine from 1948 to 1951, this article examines the role of the dream image in shaping psychoanalytic discourse on femininity and national identity. The column, 'Psychoanalysis Will Help You,' emerged during Juan Domingo Perón's first presidency, featuring verbal interpretations written under the pen name 'Richard Rest,' as well as surreal photomontages by Grete Stern, a German-born, Bauhaus-trained photographer living in exile since 1936. While the column's Jungian text encourages readers' adaptation to the external reality of their social situation, Stern's droll images emphasize the disjuncture between subject and environment, exposing tensions between the experience of exile and the Peronist mission to consolidate an Argentine national identity. Experimenting formally with European avant-garde techniques, Stern presents femininity and nation as conflictive imaginary configurations. This theme resurfaces at the 2013 Venice Biennale, where Nicola Costantino's multimedia installation Eva - Argentina: A Contemporary Metaphor was exhibited alongside Carl Jung's Red Book. Formal contrasts between Stern's use of photomontage, Costantino's projection technique, and Jung's theory of mandala symbolism indicate the divergent ways in which their artwork posits the therapeutic function of the dream image, as well as the role of aesthetic production in psychoanalytic care. Copyright © 2017 Institute of Psychoanalysis.
2007-08-01
molecular weight forms of ADAMTS13 in plasma, suggesting its cleavage by proteases in addition to decreased synthesis in the liver.71 ADAMTS13... fulminate liver failure and death 101. In our experiments, PAI-1 is increased 2-fold in Sterne challenged mice (days 1-3) and 3-fold in ∆- Sterne...cells is affected by anthrax exposure is novel. AKT is also a regulator of glycogen synthesis via the phosphorylation of glycogen synthase kinase
Repository Evaluation of Software Reuse
Banker, Rajiv D.; Kauffman, Robert J.; Zweig, Dani
1993-01-01
The article of record as published may be found at: 10.1109/32.223805 Center for Digital Economy Research Stem School of Business Working Paper IS-93-28, Replaces: Working Paper IS-93-1 Working Paper Series STERN IS-93-28 Working Paper series: STERN IS-93-28 The traditional unit of analysis and control for software managers is the software project, and subsequently the resulting application system. Today, with the emerging ca- pabilities of computer-aided software engineering ...
Ghosts in the nursery: a case study of the maternal representations of a woman who killed her baby
Directory of Open Access Journals (Sweden)
A Gous
2005-11-01
Full Text Available The maternal representations as described by Stern (1995:171-190 are used in an extreme case to illustrate the link between depression and pathogenic maternal representations. Opsomming Die moedervoorstellings soos dit deur Stern (1995:171-190 beskryf word, word in ‘n ekstreme geval gebruik om die verband tussen depressie en patogene moedervoorstellings aan te toon. *Please note: This is a reduced version of the abstract. Please refer to PDF for full text.
Global Sulfur Emissions in the 1990s
David I. Stern
2003-01-01
This paper provides global and individual country estimates of sulfur emissions from 1991-2000. Raw estimates are obtained in two ways. For countries and years with published data I compile that data from the available sources. For the remaining countries and for missing years for countries with some published data, I use either the decomposition model estimated by Stern (2002), the first differences environmental Kuznets curve model estimated by Stern and Common (2001), or a simple extrapola...
DEFF Research Database (Denmark)
Bentzen, Martin Mose
2015-01-01
Nyt hotel i Nagasaki tilbyder robotbetjening. Robotter kan lære at tale med gæsterne om præcis det, de finder interessant. Men er vi lykkeligere lukket inde i bløde bure af selvvalgt information?......Nyt hotel i Nagasaki tilbyder robotbetjening. Robotter kan lære at tale med gæsterne om præcis det, de finder interessant. Men er vi lykkeligere lukket inde i bløde bure af selvvalgt information?...
Layering and Ordering in Electrochemical Double Layers
Energy Technology Data Exchange (ETDEWEB)
Liu, Yihua [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Kawaguchi, Tomoya [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States; Pierce, Michael S. [Rochester Institute of Technology, School of Physics and Astronomy, Rochester, New York 14623, United States; Komanicky, Vladimir [Faculty of Science, Safarik University, 041 54 Kosice, Slovakia; You, Hoydoo [Materials Science Division, Argonne National Laboratory, Argonne, Illinois 60439, United States
2018-02-26
Electrochemical double layers (EDL) form at electrified interfaces. While Gouy-Chapman model describes moderately charged EDL, formation of Stern layers was predicted for highly charged EDL. Our results provide structural evidence for a Stern layer of cations, at potentials close to hydrogen evolution in alkali fluoride and chloride electrolytes. Layering was observed by x-ray crystal truncation rods and atomic-scale recoil responses of Pt(111) surface layers. Ordering in the layer is confirmed by glancing-incidence in-plane diffraction measurements.
Intertemporal evaluation criteria for climate change policy: the basic ethical issues
Buchholz, Wolfgang; Schymura, Michael
2011-01-01
The evaluation of long-term effects of climate change in cost-benefit analysis has a long tradition in environmental economics. Since the publication of the Stern Review in 2006 the debate about the "appropriate" discounting of future welfare and utility levels was revived and the most renowned scholars of the profession participated in this debate. But it seems that some contributions dealing with the Stern Review and the Review itself mixed up normative and positive issues to defend the own...
ORF Sequence: NC_005945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Bacillus anthracis str. Sterne] MSNNNYSNGLNPDESLSASAFDPNLVGPTLPPIPPFTLPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGPTGP...TGDTGTTGPTGPTGPTGPTGPTGDTGTTGPTGPTGPTGPTGPTGPTGPTGATGLTGPTGPTGPS
Baby M: babies (and justice) for sale.
Annas, G J
1987-06-01
A professor of health law criticizes the decisions of New Jersey Superior Court Judge Harvey R. Sorkow which culminated in his awarding permanent custody of Baby M to her biological father, William Stern. Annas quotes from the In re Baby M decision and from the contract between Stern and his wife and surrogate mother Mary Beth Whitehead to support his contention that Sorkow "rendered a sermon filled with contradictions, double-standards, inapt analogies, and unsupported conclusions." He argues that legally Mrs. Whitehead could not have prospectively waived her right to rear a child she bore, that Sorkow was biased in favor of the "upper-middle-class Sterns," and that consideration should be given to returning Baby M to Mrs. Whitehead. He urges state legislatures to outlaw the sale of children, to affirm the legal status of the gestational mother, and to forbid a surrogate's relinquishment of parental rights until after her child's birth.
Improvements in and relating to a device for removing oil slicks
Energy Technology Data Exchange (ETDEWEB)
Ivanoff, A
1975-09-10
The invention relates to a means for removing oil floating as an oil slick on a body of water. The device is a water craft consisting of a hull including side walls and a stern wall joining the side walls. The bow end of the hull is open, the side walls channelling oil entering between them toward the stern wall as the craft moves. A means for removing oil accumulating between the side walls is provided. An antisurging means is mounted between the side walls. The antisurging means is disposed to reduce the amplitude of waves prior to reaching the stern wall so as to calm oil covered water between the side walls of the hull. The antisurging means consists of a plate mounted between the side walls, the plate extends horizontally and sternwardly from adjacent to the bow end of the hull and below the surface of calm water relative to the side walls of the hull, at least when the craft moves. (16 claims)
Sådan bygger man en kvantecomputer
DEFF Research Database (Denmark)
Mølmer, Klaus
2009-01-01
KRONIK: Professor Klaus Mølmer forklarer, hvordan man kan konstruere en kvantecomputer. Det kræver en brudebuket, der både er der og ikke er der, og som kan kastes til alle gæsterne ved et bryllup på samme tid.......KRONIK: Professor Klaus Mølmer forklarer, hvordan man kan konstruere en kvantecomputer. Det kræver en brudebuket, der både er der og ikke er der, og som kan kastes til alle gæsterne ved et bryllup på samme tid....
Fantastiske forbindelser relationer i undervisning og læringssamvær
DEFF Research Database (Denmark)
Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart......Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart...
Loomaskulptuuride näitus Kadriorus / Aleksander Stern
Stern, Aleksander, 1948-
2009-01-01
2009. a suvel toimus Kadriorus Kastellaanimaja Galeriis Tallinna Loomaaia juubeliürituste raames näitus. Eksponeeriti Tallinna Loomaaias viiel korral aset leidnud Läänemeremaade animalistliku skulptuuri festivalide raames teostatud töid
Fluorescence quenching of uric acid solubilized in bicontinuous microemulsion by nitrobenzene
Directory of Open Access Journals (Sweden)
Maurice O. Iwunze
2013-02-01
Full Text Available Abstract: Uric Acid is known to be practically insoluble in aqueous and alcoholic media. However, it exhibits a reasonable solubility in a Bicontinuous Microemulsion system – a 15-fold or more increase in solubility in this system compared to its solubility in water. The bicontinuous microemulsion is made up of three components –Dodecane-Surfactant-water. Uric acid solubilized in this system is quenched by nitrobenzene. The obtained fluorescence data do not obey the Stern-Volmer equation when plotted accordingly. Therefore, the modified Stern-Volmer equation was used to analyze the data. It was observed that only one third (1/3 of uric acid is accessible to quenching in this medium and the reaction is diffusion-limited. The Stern-Volmer quenching constant, KSV, was calculated to be 130 M-1 and the fluorescence lifetime, 0, the quantum yield,, and the bimolecular quenching rate constant, kq, were calculated as 10.6 nanoseconds, 0.06 and 1.231010 M-1s-1, respectively.
DEFF Research Database (Denmark)
Dupont, Søren
Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode.......Dette paper forsøger at trække nogle linjer til relationerne mellem fænomenologi og bevægelse, men også tid, rum og sted. Teoretikerne er Maurice Merleau-Ponty, Hannah Arendt og Daniel Stern. Til sidst diskuteres forholdet mellem fænomenologi og metode....
International Nuclear Information System (INIS)
Skewes, M.A; Arevalo, A; Holmgren, C.; Stern, C.R
2001-01-01
The giant Miocene and Pliocene Rio Blanco-Los Bronces (Warnaars et al., 1985; Serrano et al., 1996; Vargas et al., 1999) and El Teniente (Camus, 1975; Cuadra, 1986; Skewes and Arevalo, 2000) copper deposits of central Chile are among the largest copper deposits in the world. Hypogene copper ore is more significant than supergene ore in these deposits, and most of the hypogene copper occurs in the matrix of multiple clusters of breccias (Skewes and Stern, 1994; 1995). The origin of the large mineralized breccia pipes in these and other Andean copper deposits has been attributed to the explosive expansion of magmatic aqueous fluids derived from cooling plutons (Emmons, 1938; Kents, 1964; Warnaars et al., 1985; Sillitoe, 1985; Skewes and Stern, 1994, 1995). Warnaars et al. (1985) and Skewes and Stern (1996) suggested that mineral deposition in the matrix of these breccias took place by the rapid cooling of the same magmatic fluids that generated the brecciation. Highly saline, high-temperature magmatic fluid inclusions occur in quartz and tourmaline in the matrix of these breccias (Holmgren et al., 1988; Vargas et al., 1999; Skewes et al., 2001) (au)
Consideration of possible mass and velocity corrections to magnetic cluster experiments
International Nuclear Information System (INIS)
Liu, Z.Y.; Dowben, P.A.; Popov, A.P.; Pappas, David P.
2003-01-01
Gadolinium occurs, in natural abundance, as several isotopes. The possible combinations of different gadolinium isotopes dictates that even for a fixed number of atoms in the cluster, clusters of gadolinium atoms will exhibit a range of masses. This and the expected consequence of the translation energy distributions are explored as possible corrections to Stern-Gerlach cluster beam-deflection experiments. Upon closer inspection of the experimental data, we find that the translation energy plus the vibrational temperature distribution may be inhomogeneous. This could be the origin of a long tail to high deflections in the experimental deflection profiles, at low cluster temperatures, in the magnetic cluster Stern-Gerlach experiments
Bell's Spaceships: The Views from Bow and Stern
Lewis, Geraint F.; Barnes, Luke A.; Sticka, Martin J.
2018-01-01
Unravelling apparent paradoxes has proven to be a powerful tool for understanding the complexities of special relativity. In this paper, we focus upon one such paradox, namely Bell's spaceship paradox, examining the relative motion of two uniformly accelerating spaceships. We consider the view from either spaceship, with the exchange of photons between the two. This recovers the well-known result that the leading spaceship loses sight of the trailing spaceship as it is redshifted and disappears behind what is known as the `Rindler horizon'. An immediate impact of this is that if either spaceship tries to measure the separation through `radar ranging', bouncing photons off one another, they would both eventually fail to receive any of the photon `pings' that they emit. We find that the view from this trailing spaceship is, however, starkly different, initially, seeing the leading spaceship with an increasing blueshift, followed by a decreasing blueshift. We conclude that, while the leading spaceship loses sight of the trailing spaceship, for the trailing spaceship the view of the separation between the two spaceships, and the apparent angular size of the leading spaceship, approach asymptotic values. Intriguingly, for particular parameterisation of the journey of the two spaceships, these asymptotic values are identical to those properties seen before the spaceships began accelerating, and the view from the trailing spaceship becomes identical to when the two spaceships were initially at rest.
Polarization of antiprotons by the Stern-Gerlach effect
International Nuclear Information System (INIS)
Kewisch, J.; Rossmanith, R.; Onel, Y.; Penzo, A.; Kreiser, H.
1988-01-01
A method to obtain polarized antiprotons in the low energy storage ring LEAR via spatial separation of opposite spin states is described in earlier papers (Y. Onel et al., 1986). We will discuss here in more detail a) the integration of the special magnets (spin splitter) into the LEAR optics and b) some first tracking results of particle and spin motion in these optics. (orig./HSI)
Pushpam, S.; Yamini, D.; Ramakrishnan, V.
2014-07-01
The photophysical properties of 1,4-dihydroxy-2,3-dimethyl-9,10-anthroquinone (DHDMAQ) in the absence and presence of titanium dioxide (TiO2) nanoparticles have been studied using UV-visible absorption spectroscopy and steady-state fluorescence spectroscopy. The fluorescence intensity of the DHDMAQ decreases as the concentration of TiO2 nanoparticles increases. The quenching is characterized by a Stern-Volmer plot, which displays a positive deviation from linearity. This could be explained by static quenching models. The Stern-Volmer quenching constant, association constant, and binding constant have been calculated. The distance between DHDMAQ and TiO2 nanoparticles has also been evaluated using Forster's theory of non-radiative energy transfer.
Heilmann, Conrad
2017-10-01
Controversies about time discounting loom large in decisions about climate change. Prominently, a particularly controversial debate about time discounting in climate change decision-making has been conducted within climate economics, between the authors of Stern et al. (Stern review on the economics of climate change, 2006) and their critics (most prominently Dasgupta in Comments on the Stern review's economics of climate change, 2006; Tol in Energy Environ 17(6):977-981, 2006; Weitzman in J Econ Lit XLV:703-724, 2007; Nordhaus in J Econ Lit XLV:686-702, 2007). The article examines the role of values in this debate. Firstly, it is shown that time discounting is a case in which values are key because it is at heart an ethical problem. Secondly, it is argued that time discounting in climate economics is a case of economists making frequent and routine references to ethical values and indeed conduct ethical debates with each other. Thirdly, it is argued that there is evidence for deep and pervasive entanglement between facts and values in the prevalent methodologies for time discounting. Finally, it is argued that this means that economists have given up the 'value-free ideal' concerning time discounting, and discussed how the current methodology of time discounting in economics can be improved.
International Nuclear Information System (INIS)
Evale, Basavaraj G.; Hanagodimath, S.M.
2009-01-01
The fluorescence quenching of newly synthesized coumarin (chromen-2-one) derivative, 4-(5-methyl-3-furan-2-yl-benzofuran-2-yl)-7-methyl-chromen-2-one (MFBMC) by aniline in different solvent mixtures of benzene and acetonitrile was determined at room temperature (296 K) by steady-state fluorescence measurements. The quenching is found to be appreciable and positive deviation from linearity was observed in the Stern-Volmer (S-V) plots in all the solvent mixtures. This could be explained by static and dynamic quenching models. The positive deviation in the S-V plot is interpreted in terms of ground-state complex formation model and sphere of action static quenching model. Various rate parameters for the fluorescence quenching process have been determined by using the modified Stern-Volmer equation. The sphere of action static quenching model agrees very well with experimental results. The dependence of Stern-Volmer constant K SV , on dielectric constant ε of the solvent mixture suggests that the fluorescence quenching is diffusion-limited. Further with the use of finite sink approximation model, it is concluded that these bimolecular quenching reactions are diffusion-limited. Using lifetime (τ o ) data, the distance parameter R' and mutual diffusion coefficient D are estimated independently.
Monolithic Approach to Oxide Dispersion Strengthened Aluminum, Phase I
National Aeronautics and Space Administration — Nassau Stern Company is investigating an approach for manufacturing oxide dispersion strengthened (ODS) aluminum in bulk rather than powder form. The approach...
Biophysical influence of coumarin 35 on bovine serum albumin: Spectroscopic study
Bayraktutan, Tuğba; Onganer, Yavuz
2017-01-01
The binding mechanism and protein-fluorescence probe interactions between bovine serum albumin (BSA) and coumarin 35 (C35) was investigated by using UV-Vis absorption and fluorescence spectroscopies since they remain major research topics in biophysics. The spectroscopic data indicated that a fluorescence quenching process for BSA-C35 system was occurred. The fluorescence quenching processes were analyzed using Stern-Volmer method. In this regard, Stern-Volmer quenching constants (KSV) and binding constants were calculated at different temperatures. The distance r between BSA (donor) and C35 (acceptor) was determined by exploiting fluorescence resonance energy transfer (FRET) method. Synchronous fluorescence spectra were also studied to observe information about conformational changes. Moreover, thermodynamics parameters were calculated for better understanding of interactions and conformational changes of the system.
A report from America: Baby M.
Rachels, James
1987-10-01
Rachels reviews the social and legal facts of the celebrated "Baby M" case, in which surrogate Mary Beth Whitehead attempted to keep the daughter she had borne under contract to William Stern. The first phase of the legal battle between the parents ended in March 1988, when New Jersey Superior Court Judge Harvey R. Sorkow upheld the validity of the surrogacy contract, terminated Whitehead's parental rights, and awarded custody of the child to Stern. Rachels comments on public reaction to "Baby M," on Sorkow's decision, and on the impact the case may have on legislative attempts to regulate surrogacy. He also uses the example of "Baby M," as well as that of California heart transplant patient "Baby Jesse," to discuss how the media sensationalize controversial issues.
Technical training: places available
2014-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
76 FR 59416 - Senior Executive Service Performance Review Board
2011-09-26
..., William Danelo, Daniel J. Davis, Delia Davis, Robert de Vallance, Brian Dean, Nicole DeVita, Charles Di..., Roberta Stern, Warren Stewart, Sharon Stinnett, Melanie S. Strack, Barbara L. Stroud, Dennie Michael...
Technical training: places available
2013-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
Technical training - places available
2013-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tel: 74924)
Technical training: places available
2014-01-01
If you would like more information on a course, or have any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Marie Lahchimi, Technical Training Administration (Tel: 74924)
Chemistry of clitoral gland secretions of the laboratory rat ...
Indian Academy of Sciences (India)
Unknown
which have a unique function in maintaining social and reproductive status. 1. Introduction ... interaction (Leon 1983) and initiation of aggression. (Mugford and Nowell 1971). .... 1997) and humans (Stern and McClintock 1998). These.
Book Review: Review Manual for Massachusetts General Hospital ...
African Journals Online (AJOL)
Abstract. Book Title: Review Manual for Massachusetts General Hospital Handbook of. General Hospital Psychiatry. 5th ed. Book Author: Theodore A. Stern. Pp 121. Philadelphia: Elsevier Mosby. 2004. ISBN 0-323-02768-7.
Technical training: places available
2013-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch. Eva Stern and Elise Romero, Technical Training Administration (Tél : 74924)
A Case of Esophagopericardial Fistula as a Complication of Upper ...
African Journals Online (AJOL)
most common causes of OPF include; chronic esophagitis, esophageal ulcers .... Kaufman J, Thongsuwan N, Stern E, Karmy‑Jones R. Esophageal‑pericardial fistula with purulent ... Hepatogastroenterology 2001;48:1375‑8. 9. Greven WL ...
Directory of Open Access Journals (Sweden)
José Odálio dos Santos
2005-03-01
Full Text Available Este artigo trata do tema da criação de valor, da forma como é medida pelo EVA® (Valor Econômico Adicionado e pelo MVA® (Valor de Mercado Agregado, duas metodologias desenvolvidas no final dos anos 80 pela empresa americana de consultoria Stern Stewart & Co. O EVA® é definido como a diferença entre o lucro operacional líquido depois de impostos e o custo do capital investido na empresa, enquanto o MVA® é determinado pela diferença entre o valor de mercado da empresa e o capital total nela investido. Um estudo realizado por G. Bennett Stewart III, que idealizou essas metodologias juntamente com o seu sócio Joel M. Stern, encontrou uma forte correlação entre o EVA® e o MVA®. Visando averiguar se tal resultado se aplica também ao caso das empresas brasileiras, os autores deste artigo realizaram uma pesquisa semelhante, baseada numa amostra formada por empresas de capital aberto cujas ações foram negociadas na Bovespa (Bolsa de Valores de São Paulo durante o período de 1996 a 2001.This article deals with value creation as measured by Economic Value Added (EVA® and Market Value (MVA® which are methods developed by an American consultant, Stern Stewart & Co, in the late l980's. Economic Value Added is defined as the difference between net operating profit after taxes and the cost of capital invested in a company, while Market Value Added is the difference between market value and the total capital invested in a company. G. Bennett Stewart III, who conceived this approach together with his partner Joel M. Stern, found a strong correlation between Economic Value Added and Market Value Added. Our research investigated whether this also applies to a sample of publicly owned Brazilian companies traded on the São Paulo Stock Exchange between 1996 and 2001.
Groupwise information sharing promotes ingroup favoritism in indirect reciprocity.
Nakamura, Mitsuhiro; Masuda, Naoki
2012-11-05
Indirect reciprocity is a mechanism for cooperation in social dilemma situations. In indirect reciprocity, an individual is motivated to help another to acquire a good reputation and receive help from others afterwards. Another aspect of human cooperation is ingroup favoritism, whereby individuals help members in their own group more often than those in other groups. Ingroup favoritism is a puzzle for the theory of cooperation because it is not easily evolutionarily stable. In the context of indirect reciprocity, ingroup favoritism has been shown to be a consequence of employing a double standard when assigning reputations to ingroup and outgroup members. An example of such a double standard is the situation in which helping an ingroup member is regarded as good, whereas the same action toward an outgroup member is regarded as bad. We analyze a computational model of indirect reciprocity in which information sharing is conducted groupwise. In our model, individuals play social dilemma games within and across groups, and the information about their reputations is shared within each group. We show that evolutionarily stable ingroup favoritism emerges even if all the players use the same reputation assignment rule regardless of group (i.e., a single standard). Two reputation assignment rules called simple standing and stern judging yield ingroup favoritism; under these rules, cooperation with (defection against) good individuals is regarded as good (bad) and defection against bad individuals is regarded as good. Stern judging induces much stronger ingroup favoritism than does simple standing. Simple standing and stern judging are evolutionarily stable against each other when groups employing different assignment rules compete and the number of groups is sufficiently large. In addition, we analytically show as a limiting case that homogeneous populations of reciprocators that use reputations are unstable when individuals independently infer reputations of individuals
Groupwise information sharing promotes ingroup favoritism in indirect reciprocity
Directory of Open Access Journals (Sweden)
Nakamura Mitsuhiro
2012-11-01
Full Text Available Abstract Background Indirect reciprocity is a mechanism for cooperation in social dilemma situations. In indirect reciprocity, an individual is motivated to help another to acquire a good reputation and receive help from others afterwards. Another aspect of human cooperation is ingroup favoritism, whereby individuals help members in their own group more often than those in other groups. Ingroup favoritism is a puzzle for the theory of cooperation because it is not easily evolutionarily stable. In the context of indirect reciprocity, ingroup favoritism has been shown to be a consequence of employing a double standard when assigning reputations to ingroup and outgroup members. An example of such a double standard is the situation in which helping an ingroup member is regarded as good, whereas the same action toward an outgroup member is regarded as bad. Results We analyze a computational model of indirect reciprocity in which information sharing is conducted groupwise. In our model, individuals play social dilemma games within and across groups, and the information about their reputations is shared within each group. We show that evolutionarily stable ingroup favoritism emerges even if all the players use the same reputation assignment rule regardless of group (i.e., a single standard. Two reputation assignment rules called simple standing and stern judging yield ingroup favoritism; under these rules, cooperation with (defection against good individuals is regarded as good (bad and defection against bad individuals is regarded as good. Stern judging induces much stronger ingroup favoritism than does simple standing. Simple standing and stern judging are evolutionarily stable against each other when groups employing different assignment rules compete and the number of groups is sufficiently large. In addition, we analytically show as a limiting case that homogeneous populations of reciprocators that use reputations are unstable when individuals
Neli kontserti, mis liigutasid folgil kuulajaid / Maria Uuetoa
Uuetoa, Maria
2008-01-01
Kontsertidest Viljandi pärimusmuusikafestivali raames: setu noormeeste ansambel Klapp 24. juulil Kultrahoovis, Svjata Vatra 25. juulil Saku telgis, Vägilased Kirsimäel, Fernardo Stern ja Alejandro Soto 27. juulil Kaevumäel
A new facility for the determination of critical heat flux in nuclear fuel assemblies
Energy Technology Data Exchange (ETDEWEB)
Fortman, R A; Hadaller, G I; Hamilton, R C; Hayes, R C; Shin, K S; Stern, F [Stern Laboratories Inc., Hamilton, ON (Canada)
1993-11-01
A facility for the determination of critical heat flux in simulated reactor fuel assemblies has been constructed at Stern Laboratories for CANDU Owners` Group. This paper describes the facility and method of testing. 9 figs.
Navy Ship Propulsion Technologies: Options for Reducing Oil Use - Background for Congress
National Research Council Canada - National Science Library
O'Rourke, Ronald
2006-01-01
...%. The Navy has installed fuel-saving bulbous bows and stern flaps on many of its ships. Ship fuel use could be reduced by shifting to advanced turbine designs such as an intercooled recuperated (ICR) turbine...
2010-05-28
..., Thomas[email protected] . Kimberly D. Bose, Secretary. Agenda for AD10-12 Staff Technical Conference on... Gribik and Li Zhang, Midwest ISO Gary Stern, Southern California Edison 9:25 a.m Session G--Variable...
Sterne, Jonathan
2012-01-01
Jonathan Sterne shows that understanding the historical meaning of the MP3, the world's most common format for recorded audio, involves rethinking the place of digital technologies in the broader universe of twentieth-century communication history.
Richard Kelly: Pioneirismo na iluminação da arquitetura moderna
Directory of Open Access Journals (Sweden)
Fernanda Brito Bandeira
2018-04-01
Full Text Available Livros resenhado: NEUMANN, Dietrich; STERN, Robert A. M. The structure of light: Richard Kelly and the illumination of modern architecture. New York: Yale University Press, 2010, 214 p. ISBN: 978-0-300-16370-4
Iirlaste uskumatu edu kivilinnas New Yorgis / Tambet Kaugema
Kaugema, Tambet
1998-01-01
Ameerika Ühendriikide rahvusliku raamatuauhinna laureaadid: Alice McDermott (ilukirjanduse auhind, romaan 'Charming Billy'), Edward Ball (aimekirjanduse auhind, 'Slaves in the family'), Gerald Stern (luuleauhind, 'This time'), Louis Sachar (noorsookirjanduse auhind), John Updike (elutöö auhind)
International Nuclear Information System (INIS)
Zhang, Z.; Fenter, P.; Cheng, L.; Sturchio, N.; Bedzyk, M.; Machesky, M.; Anovitz, L.; Wesolowski, D.
2006-01-01
The X-ray standing wave technique was used to probe the sensitivity of Zn 2+ and Sr 2+ ion adsorption to changes in both the adsorbed ion coverage and the background electrolyte species and concentrations at the rutile (α-TiO 2 ) (110)-aqueous interface. Measurements were made with various background electrolytes (NaCl, NaTr, RbCl, NaBr) at concentrations as high as 1 m. The results demonstrate that Zn 2+ and Sr 2+ reside primarily in the condensed layer and that the ion heights above the Ti-O surface plane are insensitive to ionic strength and the choice of background electrolyte (with - , coupled with the insensitivity of Zn 2+ and Sr 2+ cation heights to changes in the background electrolyte, implies that anions do not play a significant role in the adsorption of these divalent metal ions to the rutile (110) surface. Absolute ion coverage measurements for Zn 2+ and Sr 2+ show a maximum Stern-layer coverage of ∼0.5 monolayer, with no significant variation in height as a function of Stern-layer coverage. These observations are discussed in the context of Gouy-Chapman-Stern models of the electrical double layer developed from macroscopic sorption and pH-titration studies of rutile powder suspensions. Direct comparison between these experimental observations and the MUltiSIte Complexation (MUSIC) model predictions of cation surface coverage as a function of ionic strength revealed good agreement between measured and predicted surface coverages with no adjustable parameters
“PERFORMANCE TREND” AND “PERFORMANCE CURRENT” RATINGS BY ECONOMIC VALUE ADDED (EVA
Directory of Open Access Journals (Sweden)
ALEXANDRU BOGEANU
2013-08-01
Full Text Available The Economic Value Added (EVA is an index of “durable development.” It was proposed by the Stern-Stewart Office and represents the true economic profit of companies. A company reports economic profit only if thereported accounting profit is higher than the opportunity cost of equity. The authors of the EVA model (Stern-Stewart have also proposed the ways of restating the financial statements to get a “fair image” of the results, thuseliminating the “accounting distortions.”Based on the performance indexes calculated based on EVA and second-generation indexes relating toEVA, we calculated two types of rating: Rating Performance Current and Rating Performance Trend. The rating iscalculated by means of the percentiles technique and the results are split into 22 rating classes.The used database is Russell 3000.
DEFF Research Database (Denmark)
Lupton, Tina Jane
2016-01-01
This article takes a critical approach to the possibility of applying Bruno Lator’s work to Tristram Shandy. Sterne is both reflexive about the impossibility of representing the material work and determined to do just that in relation to his book. But these are competing tendencies in Latour’s te......’s terms, difficult to judge in the context of a single work. Latour’s recent language for Fiction as a “mode” ultimately leaves us without a way to distinguish between texts that are self-conscious and those that aren’t......This article takes a critical approach to the possibility of applying Bruno Lator’s work to Tristram Shandy. Sterne is both reflexive about the impossibility of representing the material work and determined to do just that in relation to his book. But these are competing tendencies in Latour...
Quantum principles and particles
Wilcox, Walter
2012-01-01
QUANTUM PRINCIPLESPerspective and PrinciplesPrelude to Quantum MechanicsStern-Gerlach Experiment Idealized Stern-Gerlach ResultsClassical Model AttemptsWave Functions for Two Physical-Outcome CaseProcess Diagrams, Operators, and Completeness Further Properties of Operators/ModulationOperator ReformulationOperator RotationBra-Ket Notation/Basis StatesTransition AmplitudesThree-Magnet Setup Example-CoherenceHermitian ConjugationUnitary OperatorsA Very Special OperatorMatrix RepresentationsMatrix Wave Function RecoveryExpectation ValuesWrap Up ProblemsFree Particles in One DimensionPhotoelectric EffectCompton EffectUncertainty Relation for PhotonsStability of Ground StatesBohr ModelFourier Transform and Uncertainty RelationsSchrödinger EquationSchrödinger Equation ExampleDirac Delta FunctionsWave Functions and ProbabilityProbability CurrentTime Separable SolutionsCompleteness for Particle StatesParticle Operator PropertiesOperator RulesTime Evolution and Expectation ValuesWrap-UpProblemsSome One-Dimensional So...
Luminescence quenching by reversible ionization or exciplex formation/dissociation.
Ivanov, Anatoly I; Burshtein, Anatoly I
2008-11-20
The kinetics of fluorescence quenching by both charge transfer and exciplex formation is investigated, with an emphasis on the reversibility and nonstationarity of the reactions. The Weller elementary kinetic scheme of bimolecular geminate ionization and the Markovian rate theory are shown to lead to identical results, provided the rates of the forward and backward reactions account for the numerous recontacts during the reaction encounter. For excitation quenching by the reversible exciplex formation, the Stern-Volmer constant is specified in the framework of the integral encounter theory. The bulk recombination affecting the Stern-Volmer quenching constant makes it different for pulse excited and stationary luminescence. The theory approves that the free energy gap laws for ionization and exciplex formation are different and only the latter fits properly the available data (for lumiflavin quenching by aliphatic amines and aromatic donors) in the endergonic region.
A Review of Stroke Cases in a Military Hospital in Nigeria
African Journals Online (AJOL)
Stroke is defined as a syndrome of rapidly developing ... speech as common symptoms, unless the brain stern is involved. ... Sex differences in the stroke patients have not been consistent, but most .... Left stroke + Right hemiparesis. 7. 36.8. 7.
Department of Defense Energy Strategy: Teaching an Old Dog New Tricks
2007-04-01
on surface ships. The stern flaps create lift to the aft portion of the ship and reduces propeller cavitations . This results in reduced hydrodynamic ...Potential Oil Supply Disruptions.................................................................................26 Potential Electricity Supply...16 Figure 4 World Crude Oil Reserves, 1980-2006
Focus on the Learner: Pragmatic Perspectives for the Language Teacher.
Oller, John W., Jr., Ed.; Richards, Jack C., Ed.
This book of readings includes: "Language Didactics and Applied Linguistics" (William Mackey); "Psycholinguistics and Second Language Teaching" (H. H. Stern); "Linguistic Theory" (Noam Chomsky); "Some Psycholinguistic Controversies" (John Oller, Jr.); "The Cognitive Strategies of Language Learning" (John Macnamara); "Conditions for Language…
African Journals Online (AJOL)
DR. AMINU
2014-06-01
Jun 1, 2014 ... Diabetic nephropathy is a common phenomenon in patients with diabetes. Its prevalence risk ... ketoacidosis, or hyperosmolar coma (David, 2001). As ..... Haffner, S.M, Stern, M.p, Gruber, M.k, Hazuda, H.P,. Mitchel, M.D,and ...
Max Havelaar Dan Citra Antikolonial: Sebuah Tinjauan Poskolonial
Directory of Open Access Journals (Sweden)
Christina Dewi
2008-06-01
Full Text Available Max Havelaar is a literary work by Multatuli, a.k.a. E.E. Douwes Dekker. This novel is usually known as a novel with an anti-colonial image. While in the other hand, this novel never suggests to stop colonialism done by Dutch in Hindia Belanda. This research aims at revealing the relationship between colonialism's views with its innovation of narrative technique in this novel. The first analysis is trying to do a focalization on MH. The writer wants to do it because MH presents an argument about the essence of colonialism in Hindia Belanda through opinions and views from three focalizations. MH uniquely uses three focalizers and its uniqueness is shown by Stern as a narrator-fokalizer in the Lebak Episode. Although Stern is one of the characters in the novel, it gives the impression that Stern is in a neutral position. He takes place in the middle-position between the two other character-focalizers. However, since he is one of the characters in this novel, his focalization is not perfectly neutral in the manner of inviting the readers to support the attitude of Multatuli, Readers are confronted to make a choice between the war of anticolonial or procolonial interests and to support either one of the two character-fokulizers : Multatuli or Droogstoppcl. The orientalism theory has been applied to conduct focalization in the novel as the research object.. The novel characterizes Multatuli and Stern as opposing figures against the forced labor while Droogstoppcl, on the other hand, as a figure who is supporting forced labor of the coffee trade. MH strove for labors to earn proper wages so that the issue about the procedures of cultuur-stelsel has a special place in MH. Anti-colonial traits are shown by a rejection of low wages, oppression, robbery, injustice, mistreating, and discrimination. This novel is influencing the colonial hegemony of the competition of industrial products among colonized countries in Europe in the 19th century. That is
Expanding policy options for educating teenagers.
Stern, David
2009-01-01
David Stern argues that some basic features of the American high school must be modified if it is to serve all students successfully. He notes, for example, that only three-quarters of U.S. high school students graduate four years after beginning ninth grade and that the National Assessment of Educational Progress found no improvement in reading or mathematics for seventeen-year-olds between 1971 and 2004. The nation's system for educating teenagers, says Stern, seems to be stuck, despite the constant efforts of teachers and repeated waves of reform. Citing two widely accepted public purposes of educating teenagers-preparation for civic participation and for economic self-sufficiency-Stern proposes four new strategies to achieve those goals. He draws on empirical evidence suggesting that these are promising directions for research and policy, but acknowledges that existing studies provide only limited guidance. First, he says, schools should continue the current trend toward integrating educational options to provide young people with skills and experiences that pave the way to both college and careers. Second, states and districts should tie education funding not simply to the number of students attending school, but also to what young people learn, whether they graduate, and whether they find jobs or enroll in postsecondary education. Such a move, he argues, would encourage teaching and learning formats that use students' time more effectively. Third, more adults in addition to classroom teachers should be involved in educating teenagers. Other adults acting as academic advisers, learning coaches, student advocates, internship supervisors, mentors, and college counselors could help guide the education of teenagers inside and outside of school and provide some relief for the chronic shortage of teachers. Fourth, schools should expand the options for educating teenagers outside of geographically fixed schools. Combining improved Internet-based curriculum with
Talbot, David
2009-01-01
USA California Ülikooli töötajate Abram Stern'i ja Michael Dale'i poolt 2005. a. algatatud USA kongressis peetud kõnede videoremiksidest ja nende poolt loodud veebisaidist Metavid.org. Ka YouTube keskkonnast ja wikipedia katsetustest muuta oma keskkond multimeedialisemaks
Exploiting Electric and Magnetic Fields for Underwater Characterization
2011-03-01
geophysical surveys are primarily limited to passive magnetic systems towed from a surface vessel. These systems utilize fluxgate , Overhauser, or atomic... magnetometer sensors, often deployed in arrays towed from the stern of small to moderate-size vessels. Active source electromagnetic methods have been
Schaffer, Karl
2012-01-01
The use of traditional string figures by the Dr. Schaffer and Mr. Stern Dance Ensemble led to experimentation with polyhedral string constructions. This article presents a series of polyhedra made with six loops of three colors which sequence through all the Platonic Solids.
how to understand the parables of jesus. a paradigm shift in parable
African Journals Online (AJOL)
and parables with more than one reference are always discussed in terms of the oldest source while .... 1393a.2831), and Quintilian, in the 11th chapter of the fifth book of his. Institutio Oratoria (Quint ...... Harvard University Press. stern, f. 2006.
Eggermont, L.H.P.; Gavett, B.E.; Volkers, K.M.; Blankevoort, C.G.; Scherder, E.J.A.; Jefferson, A.L.; Steinberg, E.; Nair, A.; Green, R.C.; Stern, R.A.
2010-01-01
Eggermont LH, Gavett BE, Volkers KM, Blankevoort CG, Scherder EJ, Jefferson AL, Steinberg E, Nair A, Green RC, Stern RA. Lower-extremity function in cognitively healthy aging, mild cognitive impairment, and Alzheimer's disease. Objective: To examine differences in lower-extremity function in
Annals of African Surgery July 2011 07.12.2011.indd
African Journals Online (AJOL)
andrew
2011-07-30
Jul 30, 2011 ... Background: Dislocation is one of the most common complications after total hip arthroplasty. .... Stern, J. T., Pare, E. B. and Schwartz, J. M. New perspectives on muscle use ... Clin Orthop 2001; 393:163–167. 13. Stähelin T ...
Indian Academy of Sciences (India)
Madhu
” to the Brünn Natural. History Society in 1865 (Mendel 1866; for a translation of the paper, Stern and Sherwood 1966), but only .... not capable of fully explaining the difference between his clear-cut findings with peas and his less easi-.
The g-factor of the bound electron in hydrogenic ions
International Nuclear Information System (INIS)
Quint, Wolfgang
2001-01-01
We report on the measurement of the g-factor of the electron bound in an atomic ion. A single hydrogenic ion ( 12 C 5+ ) is stored in a Penning trap. The electronic spin state of the ion is monitored via the continuous Stern-Gerlach effect in a quantum non-demolition measurement. Quantum jumps between the two spin states (spin up and spin down) are induced by a microwave field at the spin precession frequency of the bound electron. The g-factor of the bound electron is obtained by varying the microwave frequency and counting the number of spin flips for a fixed time interval. Applications of the continuous Stern-Gerlach effect include high-accuracy tests of bound-state quantum electrodynamics (QED), the measurement of the atomic mass of the electron, the determination of the fine structure constant α, and the measurement of nuclear g-factors
The ecological production of cleans stock-breeding problems
International Nuclear Information System (INIS)
Meldebekov, A.M.
2002-01-01
KazSRTIS have made researches on study of maintenance in cows' milk developed in Almaty's region, determination of heavy metal salts and radionuclides. It has been noted that maintenance of mercury, lead, cupper and zinc increased in suburb's housekeeping cows' milk, which was disposed nearly international highway and industry activities. It is known that entering radionuclides human organism happens by food chain 'soil - vegetable cover - animals product stock-breeding -person'. Animals transformer stern's plants energy at the in conclusion it allows to take the compare with initial vegetable exponent more ecological tidy products limits stream toxic elements in food series of person. It lets to study agricultural animals, how 'biological filter' in production ecological clean and healthy product of food. Changing structure and set stern's rationals, method contents the limit of animals stream manufacturing pollution from soil vegetable cover agricultural used in milk and in mead from 2 till 5 times. Utilisation tidy stern's in final period fatten meat cattle give possibility to clean the organs and tissue of animals which representative food's value from admixture to level, corresponding medical - hygienic standards. It is necessary to make analysis on compound investigation on the effect of radionuclides in agricultural animals, namely to utilize them, that really barrier migrate toxic elements in captured chain of person. The ways of solutions in ecological stock-breeding problems are next: to show up ecological tidy and ecological unsuccessful places; to study rules of transition in basic pollutions of food chains; toxic elements limitation rules in stock-breeding production; utilization manufactory-polluted territories from technological elements for stock-breeding
Asymmetric systems described by a pair of local covariant wave equations
Energy Technology Data Exchange (ETDEWEB)
Mallik, S [Bern Univ. (Switzerland). Inst. fuer Theoretische Physik
1979-07-16
A class of asymmetric solutions of the integrability conditions for systems obeying the Leutwyler-Stern pair of covariant wave equations is obtained. The class of unequal-mass systems described by these solutions does not embed the particle-antiparticle system behaving as a relativistic harmonic oscillator.
Post enne modernismi / Mari Laaniste
Laaniste, Mari, 1977-
2007-01-01
Laurence Sterne'i romaani ainetel loodud komöödiafilm "Tristram Shandy - härrasmehe paljastused" ("A Cock and Bull Story") : stsenarist Frank Cottrell Boyce : režissöör Michael Winterbottom : peaosas Steve Coogan : Suurbritannia 2005. Lühiandmed ka Steve Coogani kohta
Eggermont, Laura H.; Gavett, Brandon E.; Volkers, Karin M.; Blankevoort, Christiaan G.; Scherder, Erik J.; Jefferson, Angela L.; Steinberg, Eric; Nair, Anil; Green, Robert C.; Stern, Robert A.
Eggermont LH, Gavett BE, Volkers KM, Blankevoort CG, Scherder EJ, Jefferson AL, Steinberg E, Nair A, Green RC, Stern RA. Lower-extremity function in cognitively healthy aging, mild cognitive impairment, and Alzheimer's disease. Arch Phys Med Rehabil 2010;91:584-8. Objective: To examine differences
Indian Academy of Sciences (India)
Admin
can apply an electric force density instead of a pressure ... on a flat surface) try to adopt ... which are bound to the surface (Stern layer), while the others are .... The system is like a parallel plate ... The boundary of the droplet is also shown.
Active and break spells of the Indian summer monsoon
Indian Academy of Sciences (India)
(2001) used the term 'break' to denote weak spells of the daily all-India ... (2001) used the daily all-India rainfall based on ..... erned by a common spatial mode of variability. According ..... Waliser D E, Lau K M and Stern W 2003 Potential pre-.
Kane, Peter E., Ed.
This issue of "Free Speech" contains the following articles: "Daniel Schoor Relieved of Reporting Duties" by Laurence Stern, "The Sellout at CBS" by Michael Harrington, "Defending Dan Schorr" by Tome Wicker, "Speech to the Washington Press Club, February 25, 1976" by Daniel Schorr, "Funds…
2011-05-16
... contained incorrect information concerning side lights arc of visibility; rule 21(b). This correcting... Yard, DC 20374-5066, telephone number: 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the... anchor light, relationship of lights arc Side lights Stern light inboard of distance height above aft...
Settlement of the USS Arizona, Pearl Harbor, Hawaii
Carkin, Brad A.; Kayen, Robert E.
2013-01-01
The U.S. Geological Survey, in collaboration with the National Park Service Submerged Resources Center, undertook investigations at the USS Arizona Memorial at Pearl Harbor, Hawaii, in 2002, 2003, and 2005 to characterize geological factors affecting the deterioration and movement of the hull of the USS Arizona. Since sinking on the morning of December 7, 1941, the hull of the USS Arizona has been slowly but steadily disappearing below the surface of Pearl Harbor. Continuous sediment coring at three of four locations around the hull of the Arizona was only partially successful, but it was sufficient to identify a varied sedimentary substrate beneath the hull. A boring near the stern reveals a thick, continuous sequence of soft, gray clay to the bottom of the boring. In contrast, borings near the bow and starboard side, below about 5 meters subbottom depth, indicate the presence of very stiff, brown clay and coral debris and an absence of soft clay. Multisensor core logger scanning of the recovered cores distinguishes the lower density of the soft, gray clay at the stern from the higher density of the stiff, brown clays and coral debris at the bow and starboard side. Uniaxial consolidation testing of the soft gray clay indicates a normally consolidated sequence, whereas the stiff, brown clay and coral debris are overconsolidated. Profiles of shear wave velocity vs. depth obtained through spectral analysis of interface wave testing around the perimeter of the hull in 2005 identified areas of higher velocity, stiffer sediment at the bow and starboard side, which correspond to the dense, stiff clay recovered near the bow and starboard borings. Low shear-wave velocities at the port midship and quarter of the hull correlate with the lower density, softer sediment recovered from the boring at the stern. Cross sections of the subbottom of the Memorial combine results from the sediment borings and geophysical surveys and depict a wedge of soft clay unconformably overlying
Drei neue gamma-Doradus-Sterne aus der ASAS-3 Datenbank
Bernhard, Klaus; Huemmerich, Stefan
2016-02-01
By analysis of data from the ASAS-3 archive, the stars HD 18011, NSV 16873 and NSV 3272 were identified as multiperiodic gamma Doradus variables. Essential information on these variables is presented, along with unwhitened frequency spectra and statistically significant frequencies, as derived with Period 04.
2007-05-01
Dixon and Stern, 2004), and gun violence prevention programs ( Tita et al., 2003). As DHS considers promulgating regulations and implementing new...communication 2/21/07. Tita , G., K. J. Riley, G. Ridgeway, C. A. Grammich, A. Abrahamse, and P. W. Greenwood (2003), Reducing Gun Violence: Results
Hakeem O. Ijaiya* Abstract The issue of transnational environmental ...
African Journals Online (AJOL)
State for pollution that affects neighbouring states can be traced to the Trail ... the growth of truly global proportions only since the onset of the industrial ... 3 See Thomas W. Merrill, Golden Rules for Transboundary Pollution, .... 20 NICHOLAS STERN, THE ECONOMICS OF CLIMATE CHANGE. ..... The Basel Convention.
Perspectives on the Viable Mobile Virtual Community for Telemedicine
van 't Klooster, J.W.J.R.; Pawar, P.; van Beijnum, Bernhard J.F.; Dulawan, Chariz; Hermens, Hermanus J.
2010-01-01
A virtual community is an electronically supported social network: it can be seen as a group of people who have regular social interaction, independent of time and space, because of a common interest such as a problem, task, or feeling exchange (Eysenbach, Powell, Englesakis, Rizo, & Stern, 2004;
Nitrates from Agriculture in Europe : The EC Nitrates Directive and Its Implementation in England
Grossman, M.R.
2000-01-01
The United Nations recently issued a stern warning regarding the excessive use of nitrogen in agriculture: “[W]e are fertilizing the Earth on a global scale and in a largely uncontrolled experiment.” Nitrogen is an essential nutrient for crop production. Excess nitrogen, however, pollutes both
Effect of simulated pulpal pressure on composite bond strength to ...
African Journals Online (AJOL)
STORAGESEVER
2009-10-19
Oct 19, 2009 ... Key words: Bond strength, laser treatment, pulpal pressure, resin composite. INTRODUCTION ... bilities for operative and esthetic dentistry (Kato and. Nakabayashi ... E-mail: kimyais@tbzmed.ac.ir. Tel: 0098411- ... pulse repetition rate of 20 pulses per second (20 Hz). ..... Stern RH, Sognnaes RF (1965).
2012-03-08
... Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the authority... the sidelights; and Rule 21(c), pertaining to the location and arc of visibility of the sternlight... light, anchor Anchor lights lights arc Side lights Stern light distance distance light, relation-ship of...
2013-05-15
... Ave. SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY... lights lights arc Side lights Stern light distance distance light, relationship of Vessel Number of arc of arc of inboard of forward of height above aft light to visibility; visibility; visibility; ship's...
Spin-orbit induced electronic spin separation in semiconductor nanostructures.
Kohda, Makoto; Nakamura, Shuji; Nishihara, Yoshitaka; Kobayashi, Kensuke; Ono, Teruo; Ohe, Jun-ichiro; Tokura, Yasuhiro; Mineno, Taiki; Nitta, Junsaku
2012-01-01
The demonstration of quantized spin splitting by Stern and Gerlach is one of the most important experiments in modern physics. Their discovery was the precursor of recent developments in spin-based technologies. Although electrical spin separation of charged particles is fundamental in spintronics, in non-uniform magnetic fields it has been difficult to separate the spin states of charged particles due to the Lorentz force, as well as to the insufficient and uncontrollable field gradients. Here we demonstrate electronic spin separation in a semiconductor nanostructure. To avoid the Lorentz force, which is inevitably induced when an external magnetic field is applied, we utilized the effective non-uniform magnetic field which originates from the Rashba spin-orbit interaction in an InGaAs-based heterostructure. Using a Stern-Gerlach-inspired mechanism, together with a quantum point contact, we obtained field gradients of 10(8) T m(-1) resulting in a highly polarized spin current.
The labyrinth of memories in Tristram Shandy and the surrealist procedures
Directory of Open Access Journals (Sweden)
Aline Candido Trigo
2015-12-01
Full Text Available The life and opinions of Tristram Shandy, gentleman, by Laurence Sterne, is a rupture novel that launched narrative devices that were to be consolidated as moderns, in distinct areas. Therefore, the present work proposes a connection between shandyan writing and the ideals of surrealism, in ways shown by André Breton about artists of previous periods who were as much surrealists as the movement founders. Their ideals of the totality of thought to achieve free writing, automatic writing, as well as the reaching of an absolute reality, were spread to many countries and surpassed barriers of temporality, projecting themselves into the contemporaneity. In this way, the present paper, starting from concepts by Walter Benjamin, analyzes the resistance of this form of memory use that characterizes authors such as Aragon and others surrealists, but that had its beginning with the digressive novel by Laurence Sterne.
Toward predicate approaches to modality
Stern, Johannes
2016-01-01
In this volume, the author investigates and argues for, a particular answer to the question: What is the right way to logically analyze modalities from natural language within formal languages? The answer is: by formalizing modal expressions in terms of predicates. But, as in the case of truth, the most intuitive modal principles lead to paradox once the modal notions are conceived as predicates. The book discusses the philosophical interpretation of these modal paradoxes and argues that any satisfactory approach to modality will have to face the paradoxes independently of the grammatical category of the modal notion. By systematizing modal principles with respect to their joint consistency and inconsistency, Stern provides an overview of the options and limitations of the predicate approach to modality that may serve as a useful starting point for future work on predicate approaches to modality. Stern also develops a general strategy for constructing philosophically attractive theories of modal notions conce...
Anthracene Fluorescence Quenching by a Tetrakis (Ketocarboxamide Cavitand
Directory of Open Access Journals (Sweden)
Tibor Zoltan Janosi
2014-01-01
Full Text Available Quenching of both fluorescence lifetime and fluorescence intensity of anthracene was investigated in the presence of a newly derived tetrakis (ketocarboxamide cavitand at various concentrations. Time-correlated single photon counting method was applied for the lifetime measurements. A clear correlation between the fluorescence lifetime of anthracene as a function of cavitand concentration in dimethylformamide solution was observed. The bimolecular collisional quenching constant was derived from the decrease of lifetime. Fluorescence intensity was measured in the emission wavelength region around 400 nm as a result of excitation at 280 nm. Effective quenching was observed in the presence of the cavitand. The obtained Stern-Volmer plot displayed upward curvature. The results did not follow even extended Stern-Volmer behavior, often used to describe deviations from static bimolecular quenching. To explain our results we adopted the Smoluchowski model and obtained a reasonable estimate for the molecular radius of the cavitand in solution.
Model of learning for practitioners in dementia care with music therapy as the joint focal point
DEFF Research Database (Denmark)
Ottesen, Aase Marie
Method and the theoretical frame of reference for the project; for example Daniel Stern's theory of senses of self, forms of vitality, the present moment, Barry Reisbergs research on retrogenesis and the recent research on mirror neurons. Methodically the project is organized as a case study of a music...
African Journals Online (AJOL)
R.B. Ruthven
konstitutive Dimension sichtbar wird?“ (S. 1). Die empirische Grundlage der. Untersuchung bilden 136 Parlamentsreden (von 1963 bis 2000), 216 Artikel aus dem Magazin Stern (1968 bis 2000) sowie die Online-Korpora des Instituts für. Deutsche Sprache in Mannheim und das Leipziger Online-Wortschatzlexikon. Im 1.
14 CFR 25.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 25... AIRCRAFT AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Structure Water Loads § 25.529 Hull and main.... (b) Unsymmetrical landing for hull and single float seaplanes. Unsymmetrical step, bow, and stern...
African Journals Online (AJOL)
2007-03-30
Mar 30, 2007 ... two component density functional theory to calculated positron annihilation rates for positrons trapped in vacancies in Al, Cd, Mg,. Hg, Li, and Na. The results they got were generally lower than experimental values. Sterne and Kaiser (1991) calculated positron lifetimes (inverse of annihilation rates) in.
A Assess and c sing th change he farm e: A ca mers pe ase stu ...
African Journals Online (AJOL)
sunny
drought, and increased frequency of extreme events could make rainfed agriculture more risky and aggravate food insecurity in Ethiopia (Seleshi and Zanke, 2004;. Stern, 2007; Conway and Schipper, 2011). Preliminary projections suggested that climate change can have a sizeable impact that ranges in the order of 7-8% ...
Assessment of diagnostic technology in health care: rationale, methods, problems, and directions
National Research Council Canada - National Science Library
Sox, Harold C
1989-01-01
... Rationale, Methods, Problems, and Directions Harold Sox, Susan Stern, Douglas Owens, and Herbert L. Abrams Institute of Medicine NATIONAL ACADEMY PRESS WASHINGTON, D.C. 1989 Copyrightthe cannot be not from book, paper however, version for formatting, original authoritative the typesetting-specific the as from created publication files XML from...
2003-11-08
Bacillus anthracis BA0068 Ames Sterne SPS 97.13.213 Bacillus cereus Bacillus coagulans Bacillus licheniformis Bacillus macerans Bacillus ...megaterium Bacillus polymyxa Bacillus sphaericus Bacillus stearothermophilus Bacillus subtilis subsp. niger Bacillus thuringiensis Bacillus popilliae...varicella- zoster virus, and Bacillus anthracis DNA by LightCycler polymerase chain reaction after autoclaving:
Law, Democracy & Development - Vol 3, No 1 (1999)
African Journals Online (AJOL)
Governing rules and principles of the WTO: Its scope and future development in the context of globalisation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Brigitte Stern, 1-14. Globalisation, the World Trade Organisation and the implications for developing countries ...
The Trap of History : The States Party and the Revolt of the Netherlands, 1650–1660
Steen, van der J.A.
2013-01-01
Historians of the First Stadholderless Period (1650-1672) have shown that supporters of the house of Orange evoked memories of Prince William i of Orange's role in the Revolt of the Netherlands in support of their political agendas. Jill Stern has recently argued that the supporters of True Freedom
Indian Academy of Sciences (India)
and nucleophile bound to the micelle have been calculated. The above results suggest that reaction occurs between the substrate solubilised into the micelle and the nucleophile residing at the Stern layer rather than at the micelle-water interface. The equilibrium constant, and critical micelle concentration, evaluated using ...
Age and size effects on seed productivity of northern black spruce
J. N. Viglas; C. D. Brown; J. F. Johnstone
2013-01-01
Slow-growing conifers of the northern boreal forest may require several decades to reach reproductive maturity, making them vulnerable to increases in disturbance frequency. Here, we examine the relationship between stand age and seed productivity of black spruce (Picea mariana (Mill.) Britton, Sterns & Poggenb.) in Yukon Territory and Alaska....
The impact of climate change on the balanced growth equivalent: An application of FUND
Anthoff, D.; Tol, R.S.J.
2009-01-01
The Stern Review added balanced growth equivalents (BGE) to the economic climate change research agenda. We first propose rigorous definitions of the BGE for multiple regions and under uncertainty. We show that the change in the BGE is independent of the assumed scenario of per capita income. For
Kas meile tuntud Lääne ühiskonna lõpp? / Urmas Kiil
Kiil, Urmas
2007-01-01
Tuntud briti majandusteadlase Nicholas Sterni juhitud komisjoni koostatud raport prognoosib, et kliimamuutused ähvardavad endaga kaasa tuua majandusajaloo suurima tagasilöögi, lähitulevikus tuleks globaalsest SKT-st eraldada igal aastal vähemalt 1% selleks, et pehmendada kliimasoojenemisest põhjustatud tagajärgi. Lisa: Nicholas Stern
33 CFR 165.515 - Safety Zone: Cape Fear River, Wilmington, North Carolina.
2010-07-01
... Cape Fear River to the stern of the Battleship USS NORTH CAROLINA. (b) Definitions. The designated..., Wilmington, North Carolina. 165.515 Section 165.515 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... § 165.515 Safety Zone: Cape Fear River, Wilmington, North Carolina. (a) Location. The following area is...
2010-04-30
... Yard, DC 20374-5066, telephone 202-685-5040. SUPPLEMENTARY INFORMATION: Pursuant to the authority...), pertaining to the location of the sidelights; and Rule 21(c), pertaining to the location and arc of..., Stern light distance distance Forward anchor Anchor lights Masthead lights arc of Side lights arc of arc...
Energy Technology Data Exchange (ETDEWEB)
Pandey, Ashish; Yadav, Anita; Bhawna; Pandey, Siddharth, E-mail: sipandey@chemistry.iitd.ac.in
2017-03-15
Two common and popular deep eutectic solvents (DESs) composed of the salt choline chloride and H-bond donors glycerol and urea in 1:2 mol ratio named glyceline and reline, respectively, are investigated for the analysis of polycyclic aromatic hydrocarbons (PAHs) using quenching of both steady-state and time-resolved fluorescence of ten different PAHs by nitromethane at 30 °C. Based on their quenching efficiencies, the PAHs are divided into two groups – group 1 is constituted of the five PAHs whose fluorescence are quenched less effectively by nitromethane whereas the other five exhibiting high quenching efficiency are associated to group 2. Quenching of steady-state fluorescence of group 1 PAHs by nitromethane, albeit not very significant, follow a simple Stern-Volmer behavior. The excited-state emission intensity decay of these PAHs, in both absence and presence of nitromethane, fit best to a single exponential model with small but monotonic decrease in lifetimes. The decrease in lifetime also follows Stern-Volmer behavior, however, the quenching constants (K{sub D}) are lower than those obtained from steady-state fluorescence (K{sub SV}). This is ascribed to the possible formation of charge-transfer complex between the PAH and the nitromethane. Steady-state fluorescence quenching of group 2 PAHs exhibit distinct upward curvature from linear Stern-Volmer behavior implying highly efficient quenching. The intensity decay fits best to a double exponential decay model with longer of the decay times following simple Stern-Volmer behavior. Formation of a complex or the presence of nitromethane within the quenching sphere of action of the PAH having short decay time is proposed. Quenching behavior was found to be similar irrespective of the identity of the DES. A representative group 2 PAH, pyrene, is employed to investigate diffusion dynamics within aqueous mixtures of the two DESs. The bimolecular quenching rate constant (k{sub q}) is found to increase linearly with
Morphological study of the uncommon rectus sterni muscle in ...
African Journals Online (AJOL)
Objective: The present investigation has been designed to study the incidence of the rectus stern muscle in German human cadavers dissected in the Kingdom of Saudi Arabia, trying to find a postulation for the development of such muscle when present. Design: Gross dissection of 130 cadavers, of both sexes, was ...
Austria between Utopia and Dystopia in Austrian, German, and American Post-Exile Writings
DEFF Research Database (Denmark)
Ortner, Jessica
2015-01-01
Exile, in the sense of a literal forced transgression of borders due to persecution during the time of the Nazi regime, has fostered a broad range of “post-exile writings” in which the present generation “fictionally recreat[es] the experiences of their elders” (Stern, 1994). These writings can...
14 CFR 23.529 - Hull and main float landing conditions.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Hull and main float landing conditions. 23... Water Loads § 23.529 Hull and main float landing conditions. (a) Symmetrical step, bow, and stern... directed perpendicularly to the keel line. (b) Unsymmetrical landing for hull and single float seaplanes...
The Sibley Hospital Case: Trustees and Their Loyalty to the Institution.
Harpool, David
1996-01-01
Examines the case of Stern v. Sibley Memorial Hospital, in which hospital patients alleged trustees conspired to enrich themselves and financial institutions with which they were affiliated by favoring them in hospital financial dealings. Discusses two statutory approaches, those of the Revised Model Nonprofit Corporation Act and the Revised Model…
Lev Semjonovitsj Vygotskij og den kulturhistoriske psykologi
DEFF Research Database (Denmark)
Klitmøller, Jacob; Hviid, Pernille
2017-01-01
. Forfatterne legger vekt på å formidle de forskjellige retningenes forståelse av normale utviklingsforløp i vår tid, men ser det også i lys av en mer bekymringsskapende utvikling. Vi møter klassisk psykoanalyse, nyere psykoanalytiske perspektiver, tilknytningsteori, Daniel Sterns, Piagets og Vygotskijs...
Kellow, J. Thomas; Frey, Georgia C.; Sandt, Dawn Rosser
2007-01-01
This study is a conceptual replication of previous work by Storey, Stern, & Parker (1990) that examined the influence of participation in integrated vs. segregated recreation/sports activities on evaluations of a person with mental retardation by persons without a disability. The Storey et al., (1990) study observed that people with mental…
Cassandra Y. Johnson; J. Michael Bowker; H. Ken Cordell
2004-01-01
We use national-level data to test a modified version of Stern, Dietz, & Guagnano's causal model of environmental belief and behavior. We focus on ethnic variation for four environmental behaviors: environmental reading, household recycling, environmental group joining, and participation in nature-based outdoor recreation. Blacks and foreign-born Latinos were...
76 FR 35941 - Offer for Public Sale of Two High Speed Vessels
2011-06-20
... and Marine Engineering, Maritime Administration, 1200 New Jersey Avenue, SE., Washington, DC 20590.... ALAKAI Hull: Length 321.2'. Beam 78.1'. Height to Upper Deck..... 30.8'. Design Draft at Transit.. 11.67...'. Height to Upper Deck..... 30.8'. Design Draft at Transit.. 11.67'. Passengers 836'. Ramp Stern Starboard...
A classic paper on the integrated control concept appeared in the later part of the 1950’s, led by Vernon Stern, Ray Smith, Robert van den Bosch, and Kenneth Hagen. Numerous concepts and definitions were formulated at that time. In this presentation, a short philosophical summary will be presented...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
The mechanism of interaction of vincristine sulphate (VS) and rifampicin (RF) with bovine serum albumin (BSA) has been studied by quenching of BSA fluorescence by RF/VS. The Stern-Volmer plot indicates the presence of a static component in the quenching mechanism. Results also show that both the tryptophan ...
46 CFR 61.20-23 - Tailshaft clearance; bearing weardown.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Tailshaft clearance; bearing weardown. 61.20-23 Section...; bearing weardown. (a) Water lubricated bearings, other than rubber, must be rebushed as follows: (1) Where the propelling machinery is located amidship, the after stern tube bearing must be rebushed when it is...
Cordano, Mark; Welcomer, Stephanie; Scherer, Robert; Pradenas, Lorena; Parada, Victor
2010-01-01
We surveyed business students in the U. S. (n = 256) and Chile (n = 310). The survey included measures drawn from studies of pro-environmental behavior using Schwartz's norm activation theory (Schwartz, 1977), the theory of reasoned action (Ajzen & Fishbein, 1980), and a values-beliefs-norms model created by Stern, Dietz, Abel, Guagnano, and…
Cordano, Mark; Welcomer, Stephanie; Scherer, Robert F.; Pradenas, Lorena; Parada, Victor
2011-01-01
We surveyed business students in the United States (n = 256) and Chile (n = 310) to compare three theories of pro-environmental behavior.We examined Ajzen and Fishbein's theory of reasoned action, Schawartz's norm activation theory, and the values-beliefs-norms theory created by Stern, Dietz, Abel, Guagnano, and Kalof. We produced reliable…
Three Dimensional Shallow Water Adaptive Hydraulics (ADH-SW3): Waterborne Vessels
2015-10-01
Type Value Description 1 char CBOW Card type 2 int > 0 Vessel number 3 real # Ratio of vessel bow to vessel draft CSTR FRACTION OF DRAFT...APPLIED TO PSTR Field Type Value Description 1 char CSTR Card type 2 int > 0 Vessel number 3 real # Ratio of vessel stern to vessel draft PROP
The Battle of Hampton Roads: A Revolution in Military Affairs
2003-06-06
when the USS Weehawken sank while anchored in calm water, because she was overweight in the bow with ammunition. The bilge pumps in the stern were...the French Fleet, to the North America/West Indies Squadron to counter the United States Navy, to the Pacific Squadron to counter Chile and Peru , and to
2012-08-31
...,104 Center, Inc. Center. AZ Casa Sierra Vista, Casa Sierra Vista.... 600-A E 25th St...... Yuma 30 190........... 246 176,271 Senior Citizens Avenue. Housing, LTD. NM New Mexico-American La Resolana 1025 Chelwood... Corporation. OH CRS, Ltd (Stern Hendy Clifton Place........ 900 Rue De La Paix... Cincinnati 183 375,387...
46 CFR 61.20-5 - Drydock examination.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Drydock examination. 61.20-5 Section 61.20-5 Shipping... INSPECTIONS Periodic Tests of Machinery and Equipment § 61.20-5 Drydock examination. (a) When any vessel is drydocked, examination shall be made of the propeller, stern bushing, sea connection, and fastenings if...
John E. Major; Kurt H. Johnsen; Debby C. Barsi; Moira Campbell
2012-01-01
Fine and coarse root biomass, C, and N mass parameters were assessed by root size and soil depths from soil cores in plots of 32-year-old black spruce (Picea mariana (Mill.) Britton, Sterns & Poggenb.) from four full-sib families studied previously for drought tolerance and differential productivity on a dry and wet...
International Nuclear Information System (INIS)
Stern, F.
1997-01-01
The CEO of Stern Laboratories delivered a speech on the problems and challenges facing the nuclear industry. The CANDU system is looked at as the practical choice for the future of our energy source. The people of the industry must be utilized and respected to deliver to the best of their ability
Inducing Corporate Proactive Compliance: liability controls & corporate monitors
S. Oded (Sharon)
2012-01-01
textabstract“The steamship 'President Coolidge' arrived in the harbor of Honolulu August 26, 1937, and tied up at pier 8. At about the hour of 10 a.m. of that day, one Norman R. Arthur, a harbor patrol boatman under the United States District Engineer, was passing under the stern of the
African Journals Online (AJOL)
ebutamanya
3 juil. 2015 ... 7. Teitel AD, MacKenzie CR, Stern R, Paget SA. Laryngeal involvement in systemic lupus erythematosus. Semin Arthritis. Rheum. 1992; 22(3):203-14. PubMed | Google Scholar. 8. Azzabi S, Znagui Z, Ben Hassine L, Cherif E, Kooli C, Kaouech. Z, Khalfallah N. Laryngeal involvements in systemic lupus.
Energy Technology Data Exchange (ETDEWEB)
Stern, F. [Stern Laboratories (Canada)
1997-07-01
The CEO of Stern Laboratories delivered a speech on the problems and challenges facing the nuclear industry. The CANDU system is looked at as the practical choice for the future of our energy source. The people of the industry must be utilized and respected to deliver to the best of their ability.
2010-09-24
... Navy, 1322 Patterson Ave., SE., Suite 3000, Washington Navy Yard, DC 20374-5066, telephone number: 202...: Rule 21(a) pertaining to the arc of visibility of a masthead light. The DAJAG (Admiralty and Maritime... lights arc Side lights Stern light inboard of distance light, relation-ship of aft Vessel No. of arc of...
Energy Technology Data Exchange (ETDEWEB)
Ridley, Mora K. [Texas Tech University, Lubbock; Hiemstra, T [Oak Ridge National Laboratory (ORNL); Van Riemsdijk, Willem H. [Wageningen University and Research Centre, The Netherlands; Machesky, Michael L. [Illinois State Water Survey, Champaign, IL
2009-01-01
Acid base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multicomponent mineral aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488 508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca2+ and Sr2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 110 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Pr edota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Be ne zeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile water interface: linking molecular and macroscopic
Ridley, Moira K.; Hiemstra, Tjisse; van Riemsdijk, Willem H.; Machesky, Michael L.
2009-04-01
Acid-base reactivity and ion-interaction between mineral surfaces and aqueous solutions is most frequently investigated at the macroscopic scale as a function of pH. Experimental data are then rationalized by a variety of surface complexation models. These models are thermodynamically based which in principle does not require a molecular picture. The models are typically calibrated to relatively simple solid-electrolyte solution pairs and may provide poor descriptions of complex multi-component mineral-aqueous solutions, including those found in natural environments. Surface complexation models may be improved by incorporating molecular-scale surface structural information to constrain the modeling efforts. Here, we apply a concise, molecularly-constrained surface complexation model to a diverse suite of surface titration data for rutile and thereby begin to address the complexity of multi-component systems. Primary surface charging curves in NaCl, KCl, and RbCl electrolyte media were fit simultaneously using a charge distribution (CD) and multisite complexation (MUSIC) model [Hiemstra T. and Van Riemsdijk W. H. (1996) A surface structural approach to ion adsorption: the charge distribution (CD) model. J. Colloid Interf. Sci. 179, 488-508], coupled with a Basic Stern layer description of the electric double layer. In addition, data for the specific interaction of Ca 2+ and Sr 2+ with rutile, in NaCl and RbCl media, were modeled. In recent developments, spectroscopy, quantum calculations, and molecular simulations have shown that electrolyte and divalent cations are principally adsorbed in various inner-sphere configurations on the rutile 1 1 0 surface [Zhang Z., Fenter P., Cheng L., Sturchio N. C., Bedzyk M. J., Předota M., Bandura A., Kubicki J., Lvov S. N., Cummings P. T., Chialvo A. A., Ridley M. K., Bénézeth P., Anovitz L., Palmer D. A., Machesky M. L. and Wesolowski D. J. (2004) Ion adsorption at the rutile-water interface: linking molecular and macroscopic
The role of SO{sub 4}{sup 2−} surface distribution in arsenic removal by iron oxy-hydroxides
Energy Technology Data Exchange (ETDEWEB)
Tresintsi, S. [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Simeonidis, K., E-mail: ksime@physics.auth.gr [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Department of Mechanical Engineering, University of Thessaly, 38334 Volos (Greece); Pliatsikas, N.; Vourlias, G.; Patsalas, P. [Laboratory of Applied Physics, Department of Physics, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece); Mitrakas, M. [Analytical Chemistry Laboratory, Department of Chemical Engineering, Aristotle University of Thessaloniki, 54124 Thessaloniki (Greece)
2014-05-01
This study investigates the contribution of chemisorbed SO{sub 4}{sup 2−} in improving arsenic removal properties of iron oxy-hydroxides through an ion-exchange mechanism. An analytical methodology was developed for the accurate quantification of sulfate ion (SO{sub 4}{sup 2−}) distribution onto the surface and structural compartments of iron oxy-hydroxides synthesized by FeSO{sub 4} precipitation. The procedure is based on the sequential determination of SO{sub 4}{sup 2−} presence in the diffuse and Stern layers, and the structure of these materials as defined by the sulfate-rich environments during the reaction and the variation in acidity (pH 3–12). Physically sorbed SO{sub 4}{sup 2−}, extracted in distilled water, and physically/chemically adsorbed ions on the oxy-hydroxide's surface leached by a 5 mM NaOH solution, were determined using ion chromatography. Total sulfate content was gravimetrically measured by precipitation as BaSO{sub 4}. To validate the suggested method, results were verified by X-ray photoelectron and Fourier-transformed infrared spectroscopy. Results showed that low precipitation pH-values favor the incorporation of sulfate ions into the structure and the inner double layer, while under alkaline conditions ions shift to the diffuse layer. - Graphical abstract: An analytical methodology for the accurate quantification of sulfate ions (SO{sub 4}{sup 2−}) distribution onto the diffuse layer, the Stern layer and the structure of iron oxy-hydroxides used as arsenic removal agents. - Highlights: • Quantification of sulfate ions presence in FeOOH surface compartments. • Preparation pH defines the distribution of sulfates. • XPS and FTIR verify the presence of SO{sub 4}{sup 2−} in the structure, the Stern layer the diffuse layer of FeOOH. • Chemically adsorbed sulfates control the arsenic removal efficiency of iron oxyhydroxides.
Applications of Universal Grammar (UG) in the ESL/EFL Classroom
Kirkwold, Lorne O.
2007-01-01
The article proposes Stern's (1983) framework for classifying issues related to instruction in order to ascertain the relevance of Universal Grammar (UG) in the ESL/EFL classroom. Discussed in this article, particularly as UG pertains to them, are issues related to: (a) L1 transfer; (b) teaching rules and giving error correction versus presenting…
Ng, Daniel; Supaporn, Potibut
A study investigated the trend of current U.S. television commercial informativeness by comparing the results with Alan Resnik and Bruce Stern's previous benchmark study conducted in 1977. A systematic random sampling procedure was used to select viewing dates and times of commercials from the three national networks. Ultimately, a total of 550…
Reduced Order Modeling Methods for Turbomachinery Design
2009-03-01
and Ma- terials Conference, May 2006. [45] A. Gelman , J. B. Carlin, H. S. Stern, and D. B. Rubin, Bayesian Data Analysis. New York, NY: Chapman I& Hall...Macian- Juan , and R. Chawla, “A statistical methodology for quantif ca- tion of uncertainty in best estimate code physical models,” Annals of Nuclear En
DEFF Research Database (Denmark)
Roesgaard, Marie Højlund
2017-01-01
Chiro og Heksene, mange ved at manga er japanske tegneserier, Nationalmuseet laver udstilling om cosplay og opstiller en purikura-maskine, der kan lave billeder af gæsterne i nuttede, storøjede udgaver – så jo, Japan er synlig i Danmark. Mindre kendt er det, at Japan og Danmark allerede under Christian...
A Comparative Analysis of Word Problems in Selected United States and Russian First Grade Textbooks
Grishchenko, Svetlana
2009-01-01
The purpose of this study was to explore word problems as a subject matter in mathematics textbook curricula. The motivation for the study derived from the following evidence: (a) American students find some word problems are more difficult than others (Garcia, Jimenez, & Hess, 2006; Riley & Green, 1988; Stern, 2001), and (b) one of the…
Robinson, Alan G.; And Others
1995-01-01
Robinson and Stern describe the Management Training Program introduced by the U.S. Air Force in postwar Japan and its effect on Japanese industry. Roberts compares it with U.S. Training within Industries. Umetani comments that the discussion would have been more convincing had its relationship with other Japanese training programs been addressed.…
Directory of Open Access Journals (Sweden)
Junfang Xu
2018-05-01
Full Text Available ‘The Life and Opinions of Tristram Shandy, Gentleman’ (hereafter shortened to “Tristram Shandy” is a unique novel written by British author Laurence Sterne in the eighteenth century. While Sterne’s contemporary readers may have conflicting viewpoints about the artistic value of “Tristram Shandy” because of its surface artlessness and chaos, readers today in the contexts of such twentieth-century critical theories as postmodernism, existentialism, and deconstruction, find it congenial and more intriguing. I argue that despite the apparent chaos of this novel, the author-narrator Tristram is a central consciousness that holds the whole work together. And I believe Sterne narrates his story in such a peculiar way in conformity to his own perception of the outside world. Specifically, this paper aims to explore the inventive narrative strategies employed in Sterne’s “Tristram Shandy” in the three aspects of narrative structure, time-shifting technique and self-conscious narrator. Amazingly, “Tristram Shandy” presents a wholly new notion of creative writing, one that goes beyond its time, and has unbreakable connection with twentieth-century literature.
Water Pressure Distribution on a Twin-Float Seaplane
Thompson, F L
1930-01-01
This is the second of a series of investigations to determine water pressure distribution on various types of seaplane floats and hulls, and was conducted on a twin-float seaplane. It consisted of measuring water pressures and accelerations on a TS-1 seaplane during numerous landing and taxiing maneuvers at various speeds and angles. The results show that water pressures as great as 10 lbs. per sq. in.may occur at the step in various maneuvers and that pressures of approximately the same magnitude occur at the stern and near the bow in hard pancake landings with the stern way down. At the other parts of the float the pressures are less and are usually zero or slightly negative for some distance abaft the step. A maximum negative pressure of 0.87 lb. Per square inch was measured immediately abaft the step. The maximum positive pressures have a duration of approximately one-twentieth to one-hundredth second at any given location and are distributed over a very limited area at any particular instant.
Energy Technology Data Exchange (ETDEWEB)
Bhattar, S.L.; Kolekar, G.B. [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur-416 004, Maharashtra (India); Patil, S.R., E-mail: srp_fsl@rediffmail.co [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur-416 004, Maharashtra (India)
2010-03-15
The interaction between salicylic acid (SA) and riboflavin (RF) was studied by Fluorescence Resonance Energy Transfer (FRET) in micellar solution. The riboflavin strongly quenches the intrinsic fluorescence of SA by radiative energy transfer. The extent of energy transfer in sodium dodecyl sulphate (SDS) micellar solution of different concentration is quantified from the energy transfer efficiency data. It is seen that the energy transfer is more efficient in the micellar solution. The critical energy transfer distance (R{sub 0}) was determined from which the mean distance between SA and RF molecules was calculated. The quenching was found to fit into Stern-Volmer relation. The results on variation of Stern-Volmer constant (K{sub sv}) with quencher concentration obtained at different temperatures suggested the formation of complex between SA and RF. The association constant of complex formation was estimated and found to decrease with temperature. The values of thermodynamic parameters DELTAH, DELTAG and DELTAS at different temperatures were estimated and the results indicated that the molecular interaction between SA and RF is electrostatic in nature.
Energy Technology Data Exchange (ETDEWEB)
Tamazian, Artur [School of Economics and Business Administration, University of Santiago de Compostela (Spain); Bhaskara Rao, B. [School of Economics and Finance, University of Western Sydney, Sydney (Australia)
2010-01-15
Several studies have examined the relationship between environmental degradation and economic growth. However, most of them did not take into account financial developments and institutional quality. Moreover, Stern [Stern, D., 2004. The rise and fall of the environmental Kuznets curve. World Development 32(8): 1419-1439.] noted that there are important econometric weaknesses in the earlier studies, such as endogeneity, heteroscedasticity, omitted variables, etc. The purpose of this paper is to fill this gap in the literature by investigating the linkage between not only economic development and environmental quality but also financial development and institutional quality. We employ the standard reduced-form modelling approach to control for country-specific unobserved heterogeneity and GMM estimation to control for endogeneity. Our study considers 24 transition economies and panel data for 1993-2004. Our results support the EKC hypothesis while confirming the importance of both institutional quality and financial development for environmental performance. We also found that financial liberalization may be harmful for environmental quality if it is not accomplished in a strong institutional framework. (author)
Design and Testing of the MIT-Bates Stern-Gerlach Polarimeter Cavity
Cameron, P; Luccio, A U; MacKay, W W
2005-01-01
Historically, beam polarization measurement has been accomplished by scattering experiments, with the attendant complexity of target and detector installation and operation, and smallness and uncertainty of analyzing powers. The purpose of the present effort is to accomplish fast and accurate polarization measurement not as a scattering experiment, but rather as conventional beam instrumentation, with a resonant cavity pickup. This requires that the coupling of the beam magnetic moment to the pickup be enhanced to bring the signal above the noise floor, and that coupling of the beam charge to the pickup be diminished to reduce the dynamic range problem. We discuss details of cavity design that have been implemented to accomplish these ends. Presently, it is planned to install the cavity in the Bates Ring in early May of this year. Beyond polarimetry, successful polarization measurement will verify the underlying principles, and by pickup/kicker reciprocity will open the serious consideration of the possibilit...
Erzherzog Ferdinand II., Astrologie und das Lustschloss Hvězda (Stern)
Czech Academy of Sciences Publication Activity Database
Purš, Ivo
-, č. 14 (2014), s. 15-29 ISSN 1213-5372 Institutional support: RVO:68378033 Keywords : astrology * iconography * archduke Ferdinand of Tirol * Star (Hvězda) villa Subject RIV: AL - Art, Architecture, Cultural Heritage
Hetero-interaction between Gouy-Stern double layers : charge and potential regulation
Lyklema, J.; Duval, J.F.L.
2005-01-01
This issue of Advances is devoted to the memory of Hans-Joachim Schulze who, before his untimely death, made substantial contributions in the domains of flotation, wetting and particle interaction, often under adverse working conditions. Many of his publications involve hetero-interaction between
Energy Technology Data Exchange (ETDEWEB)
D' Ariano, G M [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy); Maccone, L [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy); Paini, M [Quantum Optics and Information Group, INFM Udr Pavia, Dipartimento di Fisica ' Alessandro Volta' and INFM, Via Bassi 6, 27100 Pavia (Italy)
2003-02-01
We propose a tomographic reconstruction scheme for spin states. The experimental set-up, which is a modification of the Stern-Gerlach scheme, can be easily performed with currently available technology. The method is generalized to multiparticle states, analysing the spin-1/2 case for indistinguishable particles. Some Monte Carlo numerical simulations are given to illustrate the technique.
International Nuclear Information System (INIS)
D'Ariano, G M; Maccone, L; Paini, M
2003-01-01
We propose a tomographic reconstruction scheme for spin states. The experimental set-up, which is a modification of the Stern-Gerlach scheme, can be easily performed with currently available technology. The method is generalized to multiparticle states, analysing the spin-1/2 case for indistinguishable particles. Some Monte Carlo numerical simulations are given to illustrate the technique
Changes in plasma membrane structure upon irradiation on thymocytes
International Nuclear Information System (INIS)
Dreval', V.I.
1993-01-01
Thymocytes were irradiated with doses of 4 to 10 4 Gy. The binding of 1-anilinonaphtalene-8-sulphonate and Ca 2+ to plasma membranes; viscosity and lipid peroxidation; Stern-Folmer constant; and the number of Sh-groups of membrane proteins were determined. The structural changes in plasma membranes after irradiation of thymocytes were found to be cooperative
Literary Origins of the Term "School Psychologist" Revisited
Fagan, Thomas K.
2005-01-01
Previous research on the literary origins of the term "school psychologist" is revisited, and conclusions are revised in light of new evidence. It appears that the origin of the term in the American literature occurred as early as 1898 in an article by Hugo Munsterberg, predating the usage by Wilhelm Stern in 1911. The early references to the…
Response to crop-tree release by 7-year-old stems of yellow-poplar and black cherry
G.R. Jr. Trimble; G.R. Jr. Trimble
1973-01-01
Five years after crop-tree release of yellow-poplar and black cherry sterns in a 7-year-old stand of Appalachian hardwoods, measurements indicated that released trees were but slightly superior to control trees in height, diameter, and crown position. Sprout regrowth of cut tree stems and grapevines had largely nullified the effects of release. Indications are that for...
Postnatal growth, age estimation and development of foraging ...
Indian Academy of Sciences (India)
Unknown
growth after the first year (Kunz and Stern 1995). The values of the lengths of forearm and epiphyseal gap dur- ing their linear phases of growth increased during the preflight period and decreased during the postflight period, and were reliable for deriving equations to esti- mate the age of young bats (e.g. Kunz and Robson ...
50 CFR 665.815 - Pelagic longline seabird mitigation measures.
2010-10-01
... stern of the vessel; (ii) The mainline and branch lines must be set from the port or the starboard side... (v) Feathers are dry. (9) Any seabird that is released in accordance with paragraph (b)(8) of this... immediately upon the vessel's return to port. Do not give the bird food or water; and (11) Complete the short...
Improved Robustness and Efficiency for Automatic Visual Site Monitoring
2009-09-01
detection from a moving vehicle. In ECCV, pages 37–49, 2000. 36, 91, 158 [37] Andrew Gelman , John B. Carlin, Hal S. Stern, and Donald B. Rubin. Bayesian Data...luggage items in a public space. In PETS Workshop, pages 75–82. IEEE, 2006. 180, 192 [98] Juan Soulie. C++ language tutorial: Arrays. World Wide Web
Lexicography, Terminography and Copyright
African Journals Online (AJOL)
stern from the very nature of a dictionary as a specific kind of intellectual pro- perty type, because of ... --The most important convention that binds us today, is still the Berne Con- ention, as ..... These units or data element categories are described ... terminologist to use these terms as well as their definitions to a large extent.
Mabilia, Diana
2015-01-01
The present research proposes the analysis of specific aspects of psychosocial functioning and development with a focus on issues related to internalizing symptoms, attachment styles and interpersonal dimensions of interpersonal functioning. Developmental theories emphasized the importance of transitions, as periods of biologically and socially characterized changes (Arnett, 1997; Gurevitz Stern, 2004; Schulenberg, Magges, Hurrelmann, 1997; Schulenberg & Zarrett, 2006). The development...
International Nuclear Information System (INIS)
Sidhu, M.S.; Bhatia, P.V.K.
1994-01-01
The presence of heterocyclic compounds triggers off a competition between photophysical and photochemical annihilation of excited uranyl ion during its photochemical reduction with triphenylphosphine. This competition is used to measure Stern-Volmer constant using UV visible spectrophotometer for quenching the uranyl ion luminescence with a number of heterocyclic molecules viz., pyridine, thiophene bipyridyl, tetrahydrofuran and piperidine. (author). 7 refs., 2 figs., 1 tab
Sources of polarized ions and atoms
International Nuclear Information System (INIS)
Cornelius, W.D.
1988-01-01
In this presentation we discuss methods of producing large quantities of polarized atoms and ions (Stern-Gerlach separation, optical pumping, and spin-exchange) as well as experimental methods of measuring the degree of polarization of atomic systems. The usefulness of polarized atoms in probing the microscopic magnetic surface properties of materials will also be discussed. 39 refs., 5 figs., 2 tabs
Directory of Open Access Journals (Sweden)
John Wilkes
1997-11-01
Full Text Available Few ancient Greek place names are so embedded in Western consciousness as Sparta, evoking as it does courage, harsh training, stern duty and endurance. By the 2nd century AD it had become a "heritage centre " admired by visiting Romans, and it flourished again in the Byzantine period. The Institute has been involved in new excavations at Sparta since 1989.
Invited Lectures from a Spatial Orientation Symposium in Honor of Frederick Guedry, Day 2
2015-11-10
physically in the right spot, and then as you load it, the Achilles tendon and patella tendon shift and cause the knee and the ankle to support your body...Princeton, he kicked the back of the stern anchor off and he got caught in the cable, and so he was severely injured and we got him back on board. And
International Nuclear Information System (INIS)
Moll, H.; Geipel, G.; Bernhard, G.; Fanghaenel, Th.; Grenthe, I.
2002-01-01
We observed a very strong quenching of the U(VI) fluorescence in these systems that can be quantitatively described by the Stern-Volmer equation. The following stability constants were determined: a) for the glycolate system log β 1:1 = 2.52±0.20, b) for the α-hydroxyisobutyrate system log β 1:1 = 3.40±0.21. (orig.)
Can outstanding research be done under less than ideal conditions?
Directory of Open Access Journals (Sweden)
Igić Rajko
2004-01-01
Full Text Available Great scientific discoveries rarely originate from small and poor countries. However, the lives and achievements of three Yugoslav scientists who were active in the biomedical sciences, Laza K. Lazarević (1851-1891, Ivan Djaja (1884-1957, and Pavao Stern (1913-1976, serve as an example of success in this environment. These scientists, as well as the majority of other successful investigators in small and poor countries, were trained in foreign and developed countries and, upon return, were given the freedom to start a self dependent research program. They overcame many obstacles, including wars and civil unrests, to contribute significantly to certain medical fields. It is interesting that although a Jew, Stern was allowed to work during the World War II in Zagreb, which became capital of the so-called Independent State of Croatia, a puppet state under German control. Perhaps his good name among pharmacologists helped him to keep position during this tough period. Nowadays, new technologies requiring for biomedical research are rather expensive, and poor countries cannot afford to finance many scientists. Thus, selection of the most productive researchers is the challenge for those who finance scientific work.
Atomistic Molecular Dynamics Simulations of the Electrical Double
Li, Zifeng; Milner, Scott; Fichthorn, Kristen
2015-03-01
The electrical double layer (EDL) near the polymer/water interface plays a key role in the colloidal stability of latex paint. To elucidate the structure of the EDL at the molecular level, we conducted an all-atom molecular dynamics simulations. We studied two representative surface charge groups in latex, the ionic surfactant sodium dodecyl sulfate (SDS) and the grafted short polyelectrolyte charged by dissociated methyl methacrylic acid (MAA) monomers. Our results confirm that the Poisson-Boltzmann theory works well outside the Stern layer. Our calculated electrostatic potential at the Outer Helmholtz Plane (OHP) is close to the zeta potential measured experimentally, which suggests that the potential at the OHP is a good estimate of the zeta potential. We found that the position of the OHP for the MAA polyelectrolyte system extends much further into the aqueous phase than that in the SDS system, resulting in a Stern layer that is twice as thick. This model will allow for future investigations of the interactions of the surface with different surfactants and rheology modifiers, which may serve as a guide to tune the rheology of latex formulations. We thank Dow Chemical Company for financial support.
Mi, Ran; Hu, Yan-Jun; Fan, Xiao-Yang; Ouyang, Yu; Bai, Ai-Min
2014-01-03
This paper exploring the site-selective binding of jatrorrhizine to human serum albumin (HSA) under physiological conditions (pH=7.4). The investigation was carried out using fluorescence spectroscopy, UV-vis spectroscopy, and molecular modeling. The results of fluorescence quenching and UV-vis absorption spectra experiments indicated the formation of the complex of HSA-jatrorrhizine. Binding parameters calculating from Stern-Volmer method and Scatchard method were calculated at 298, 304 and 310 K, with the corresponding thermodynamic parameters ΔG, ΔH and ΔS as well. Binding parameters calculating from Stern-Volmer method and Scatchard method showed that jatrorrhizine bind to HSA with the binding affinities of the order 10(4) L mol(-1). The thermodynamic parameters studies revealed that the binding was characterized by negative enthalpy and positive entropy changes and the electrostatic interactions play a major role for jatrorrhizine-HSA association. Site marker competitive displacement experiments and molecular modeling calculation demonstrating that jatrorrhizine is mainly located within the hydrophobic pocket of the subdomain IIIA of HSA. Furthermore, the synchronous fluorescence spectra suggested that the association between jatrorrhizine and HSA changed molecular conformation of HSA. Copyright © 2013. Published by Elsevier B.V.
2010-01-01
UAV Autonomy program which includes intelligent reasoning for autonomy, technologies to enhance see and avoid capabilities, object identification ...along the ship’s base recovery course (BRC). The pilot then flies toward the stern of the ship, aligning his approach path with the ship’s lineup line...quiescent point identification . CONCLUSIONS The primary goal for conducting dynamic interface analysis is to expand existing operating envelopes and
Report of Freshwater Mollusks Workshop 19-20 May 1981.
1982-05-01
RELOCATION OF LAMPSILIS HIGGINSI IN THE UPPER MISSISSIPPI RIVER ....... ....................... 104 David Nelson HIGGINS ’ EYE MUSSEL RECOVERY PLAN...0830 The Higgins ’ Eye Mussel Recovery Team - Dr. Edward Stern, University of Wisconsin Dealing with Endangered Mollusks at Corps of Engineers District...typically dark yellowish-brown to brown in color. Quadrula stapes appears to be most closely related to Q. intermedia which is endemic to the Tennessee
DEFF Research Database (Denmark)
Jensen, J. P.; Søndergaard, M.; Jeppesen, E.
små cladoceer og hjuldyr, og især er maksimumsforekom-sterne af calanoide vandlopper og de små og store cladoceer og daf-nier gået tilbage. Den gennemsnitlige biomasse af dafnier er derimod øget især p.g.a. stigning i de 25 % af søerne med størst forekomster. Dyreplanktons græsning Betragtet under et...
International Nuclear Information System (INIS)
Schymura, Michael
2013-01-01
The evaluation of long-term effects of climate change in cost-benefit analysis has a long tradition in environmental economics. Since the publication of the ''Stern Review'' in 2006, the debate about the impacts of climate change on the economy and how to compare cost and benefits with each other was revived. The assessment of climate change mitigation policies mainly depends on three not mutually exclusive decisions: First, the discount rate chosen, since costs are incurred today and long-term benefits occur in the future. Second, the uncertainties related to the problem of climate change. This debate was spurred by the literature surrounding Martin Weitzman's ''dismal theorem'', stating that the unknown unknowns could be too large for cost-benefit analysis of long-term climate policy measures. And third, the treatment of technological change in economic models of climate policy. This dissertation contributes to all three mentioned aspects and consists of two interrelated parts. First, I discuss norms, economic welfare criteria, and catastrophic risks in the context of climate change. This first part is closely bound to a discussion of the Stern Review. The second part of the dissertation deals with technological change in its various dimensions and addresses several questions: How is technological change taken into consideration in large-scale environment-economy models? How do certain inputs substitute each other? And how does technology affect energy intensity, a key parameter for meeting targets set by climate policy? Alongside these questions, I also discuss how the production of knowledge takes place in an environmental and resource economics framework and how knowledge production patterns have changed during previous decades. While the first part is of theoretical nature, the second part is mainly empirical. Summing up, I suggest approaches towards long-term evaluation of climate policies and how some methodological drawbacks of the ''Stern Review'' could
Das, Siddhartha; Chakraborty, Suman
2010-07-06
In this article, we investigate the implications of ionic conductivity variations within the electrical double layer (EDL) on the streaming potential estimation in pressure-driven fluidic transport through narrow confinements. Unlike the traditional considerations, we do not affix the ionic conductivities apriori by employing preset values of dimensionless parameters (such as the Dukhin number) to estimate the streaming potential. Rather, utilizing the Gouy-Chapman-Grahame model for estimating the electric potential and charge density distribution within the Stern layer, we first quantify the Stern layer electrical conductivity as a function of the zeta potential and other pertinent parameters quantifying the interaction of the ionic species with the charged surface. Next, by invoking the Boltzmann model for cationic and anionic distribution within the diffuse layer, we obtain the diffuse layer electrical conductivity. On the basis of these two different conductivities pertaining to the two different portions of the EDL as well as the bulk conductivity, we define two separate Dukhin numbers that turn out to be functions of the dimensionless zeta potential and the channel height to Debye length ratio. We derive analytical expressions for the streaming potential as a function of the fundamental governing parameters, considering the above. The results reveal interesting and significant deviations between the streaming potential predictions from the present considerations against the corresponding predictions from the classical considerations in which electrochemically consistent estimates of variable EDL conductivity are not traditionally accounted for. In particular, it is revealed that the variations of streaming potential with zeta potential are primarily determined by the competing effects of EDL electromigration and ionic advection. Over low and high zeta potential regimes, the Stern layer and diffuse layer conductivities predominantly dictate the streaming
International Nuclear Information System (INIS)
Duffa, Céline; Bailly du Bois, Pascal; Caillaud, Matthieu; Charmasson, Sabine; Couvez, Céline; Didier, Damien; Dumas, Franck; Fievet, Bruno; Morillon, Mehdi; Renaud, Philippe
2016-01-01
The Fukushima nuclear accident resulted in the largest ever accidental release of artificial radionuclides in coastal waters. This accident has shown the importance of marine assessment capabilities for emergency response and the need to develop tools for adequately predicting the evolution and potential impact of radioactive releases to the marine environment. The French Institute for Radiological Protection and Nuclear Safety (IRSN) equips its emergency response centre with operational tools to assist experts and decision makers in the event of accidental atmospheric releases and contamination of the terrestrial environment. The on-going project aims to develop tools for the management of marine contamination events in French coastal areas. This should allow us to evaluate and anticipate post-accident conditions, including potential contamination sites, contamination levels and potential consequences. In order to achieve this goal, two complementary tools are developed: site-specific marine data sheets and a dedicated simulation tool (STERNE, Simulation du Transport et du transfert d’Eléments Radioactifs dans l'environNEment marin). Marine data sheets are used to summarize the marine environment characteristics of the various sites considered, and to identify vulnerable areas requiring implementation of population protection measures, such as aquaculture areas, beaches or industrial water intakes, as well as areas of major ecological interest. Local climatological data (dominant sea currents as a function of meteorological or tidal conditions) serving as the basis for an initial environmental sampling strategy is provided whenever possible, along with a list of possible local contacts for operational management purposes. The STERNE simulation tool is designed to predict radionuclide dispersion and contamination in seawater and marine species by incorporating spatio-temporal data. 3D hydrodynamic forecasts are used as input data. Direct discharge points or
Structural incorporation of Neptunyl(V) into Calcite: Interfacial Reactions and Kinetics
Heberling, Frank
2010-01-01
In this experimental work the calcite-water interface is characterized by means of zetapotential and surface diffraction measurements. Based on the experimental results a new Basic Stern Surface Complexation model for calcite is developed. Neptunyl(V) adsorption at the calcite surface and incorporation into the calcite structure is studied by batch type adsorption- and mixed flow reactor experiments. Adsorption and incorporation species of Neptunyl are investigated by EXAFS spectroscopy.
2017-01-01
Working Group on Infrastructure Finance Stern School of Business, New York University Pankaj Ghemawat, Professor of Management Joel Hasbrouck, Professor of Finance Peter Henry, Professor of Economics Michael Posner, Professor of Business and Society Paul Romer, Professor of Economics Michael Spence, Professor of Economics Paul Tice, Executive in Residence Stijn Van Nieuwerburgh, Professor of Finance Ingo Walter, Professor Emeritus of Finance Tensie Whelan, Professor of Business and Society La...
2014-06-01
625 (an Inconel ) sleeve. These sleeves exhibit exceptional corrosion performance, and are used as the wear surfaces in contact with the lubricated...it exits the stern tube bearing. There is an alloy 625 ( Inconel ) sleeve, used as a wear surface for the bearing interaction, as seen in the drawing...Industry Day at MIT, October 13, 2011. Alloy 625 sleeve Mild steel shaft Typical Corrosion Area Epoxy Filler Glass Reinforced Plastic Cover
Origin of constraints in relativistic classical Hamiltonian dynamics
International Nuclear Information System (INIS)
Mallik, S.; Hugentobler, E.
1979-01-01
We investigate the null-plane or the front form of relativistic classical Hamiltonian dynamics as proposed by Dirac and developed by Leutwyler and Stern. For systems of two spinless particles we show that the algebra of Poincare generators is equivalent to describing dynamics in terms of two covariant constraint equations, the Poisson bracket of the two constraints being weakly zero. The latter condition is solved for certain simple forms of constraints
Murdin, P.
2000-11-01
(the Ship) a large southern constellation representing the ship Argo of Jason and the Argonauts in Greek mythology whose brightest stars were cataloged by Ptolemy (c. AD 100-175) in the Almagest. It was divided up by the French astronomer Nicolas L de Lacaille (1713-62), who charted the southern sky in 1751-2, into the constellations Carina (the Keel), Vela (the Sails), Puppis (the Poop or Stern)...
Monetary ecosystem services valuation in natural environment management
Álvarez, David
2017-01-01
As it happened with Stern Report, which made international community change their attitude related to climate change, TEEB (The Economics of Ecosystem Services and Biodiversity) was a turning point in valuing biodiversity and ecosystem services. This change of attitude happened, partially, thanks to include monetary ecosystem valuation of ecosystem services and how much their conservation and avoid their loss worth to the entire society. Integrate monetary valuation in green infrastructur...
A Group Theoretic Approach to Metaheuristic Local Search for Partitioning Problems
2005-05-01
Tabu Search. Mathematical and Computer Modeling 39: 599-616. 107 Daskin , M.S., E. Stern. 1981. A Hierarchical Objective Set Covering Model for EMS... A Group Theoretic Approach to Metaheuristic Local Search for Partitioning Problems by Gary W. Kinney Jr., B.G.S., M.S. Dissertation Presented to the...DISTRIBUTION STATEMENT A Approved for Public Release Distribution Unlimited The University of Texas at Austin May, 2005 20050504 002 REPORT
International Nuclear Information System (INIS)
Radjabov, U.R.; Yusupov, Z.N.; Sharipov, I.Kh.
2001-01-01
C H lm=0.1 mol/l, C F e(II)=1·10 - 4 m ol/l and iron sterns: 0.10, 0.25, 0.50 and 1.00 mol/l. It is established that in the investigated systems form at different on composition mono-, polynuclear, homo-- and heterovalent coordination compounds. In aids of the oxidation function accurate the composition, defined the constants formation and domination sphere of complex forms
Murdin, P.
2000-11-01
(the Poop or Stern; abbrev. Pup, gen. Puppis; area 673 sq. deg.) A southern constellation which lies between Canis Major and Vela, and culminates at midnight in early January. It was introduced by the French astronomer Nicolas L de Lacaille (1713-62), who charted the southern sky in 1751-2, from stars that formed part of the ancient constellation of Argo Navis (the Ship), which had been included ...
Collateral Damage to Satellites from an EMP Attack
2010-08-01
field into regions of weak magnetic field [Stern. 1989, and references therein]. Birkeland’s work captured the interest of auroral researcher Stormer ...dipole magnetic field [ Stormer , 1907]. Although mathematically elegant, Stormer theory did not prove the existence of radiation belts; it set the stage...Based on work by Stormer , Alfven, and others, and on his experience with the Astron thermonuclear device, N. Christofolis in October 1957 suggested
The Sensitivity Analysis of Axial Pressure Tube Creep Profile for Dryout Power in PHWR
Energy Technology Data Exchange (ETDEWEB)
Ryu, Euiseung; Kim, Youngae [KHNP CRI, Daejeon (Korea, Republic of)
2016-10-15
The Stern Laboratory performed the CHF tests with only one axial pressure tube creep profile per 3.3%, 5.1% peak crept channel and made CHF correlation including creep factor from the CHF test results. Wolsong nuclear power plants also have utilized the same CHF correlation derived by CNL. Pressure tube diameter creep rate is function of fast neutron, coolant temperature, and coolant pressure in a channel. It means that various axial pressure tube creep profiles exist in PHWR due to the history of operating conditions. Usually, CHF correlation is used during ROP(Regional Overpower Protection) Trip Setpoint Analysis or Safety Analysis in PHWR. The sensitivity analysis for CHF effects using various creep profiles is needed. This paper summarizes the comparison results of dryout power between CHF test creep profile and estimated creep profiles of Wolsong units. The effect of axial pressure tube creep profile for dryout power in fuel channel is evaluated by using Stern Lab. CHF test creep profile and 380 channel creep profiles of Wolsong. The dryout powers at 3.3% and 5.1% test conditions are slightly smaller when using 380 Wolsong channels creep profiles. These also show that the simulated dryout powers maintain consistency regardless of flow conditions.
Urea-induced binding between diclofenac sodium and bovine serum albumin: a spectroscopic insight.
Dohare, Neeraj; Khan, Abbul Bashar; Athar, Fareeda; Thakur, Sonu Chand; Patel, Rajan
2016-06-01
We investigated the interaction of diclofenac sodium (Dic.Na) with bovine serum albumin (BSA) in the absence and presence of urea using different spectroscopic techniques. A fluorescence quenching study revealed that the Stern-Volmer quenching constant decreases in the presence of urea, decreasing further at higher urea concentrations. The binding constant and number of binding sites were also evaluated for the BSA-Dic.Na interaction system in the absence and presence of urea using a modified Stern-Volmer equation. The binding constant is greater at high urea concentrations, as shown by the fluorescence results. In addition, for the BSA-Dic.Na interaction system, a static quenching mechanism was observed, which was further confirmed using time-resolved fluorescence spectroscopy. UV-vis spectroscopy provided information about the formation of a complex between BSA and Dic.Na. Circular dichroism was carried out to explain the conformational changes in BSA induced by Dic.Na in the absence and presence of urea. The presence of urea reduced the α-helical content of BSA as the Dic.Na concentration varied. The distance r between the donor (BSA) and acceptor (Dic.Na) was also obtained in the absence and presence of urea, using fluorescence resonance energy transfer. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.
Heavy atom induced room temperature fluorescence quenching of PAH from a glucose glass
Energy Technology Data Exchange (ETDEWEB)
Marlow, Matt, E-mail: matthew.marlow@nicholls.edu
2017-06-15
Sugar glasses are a relatively new matrix for solid-matrix luminescence. Molecular interactions within the sugar glass are not well understood. Fluorescence quenching was used to investigate molecular interactions within the sugar glass matrix. The room temperature fluorescence quenching of pyrene and naphthalene was observed from a glucose glass. The heavy atom salt NaI was the quencher. Two solvent compositions 50/50 and 60/40 MeOH/water, used for glass preparation, were examined for their effect on glass rigidity and molecular interactions. A complex static mechanism was observed for glasses prepared with 50/50 MeOH/water. This data was fit to the sphere of action model and associations constants determined. A Stern-Volmer static mechanism of quenching was observed for glasses prepared with 60/40 MeOH/water. This data fit the Stern-Volmer equation and association constants were determined. A larger association constant was observed for pyrene compared to naphthalene for both solvent systems used. Pyrene had a larger association constant with a sugar glass prepared with 60/40 MeOH/water compared to 50/50 MeOH/water implying a greater association between pyrene and iodide. The greater association is a reflection of a more rigid internal environment for the sugar glass prepared with 60/40 MeOH/water.
Directory of Open Access Journals (Sweden)
Tone Pernille Østern
2014-12-01
Full Text Available I denne artikkelen har forfatterne fokus på hvordan ulikhet mellom mennesker kan fungere som en impuls som bidrar til meningsskaping, nye oppdagelser og transformasjon i improvisasjon i dans. Artikkelen tar utgangspunkt i Østerns avhandling ”Meaning-making in the Dance Laboratory. Exploring dance improvisation with differently bodied dancers” (2009. I artikkelen vever forfatterne sammen sine ulike stemmer. Tone Pernille Østerns perspektiv er som initiativtaker og tidligere koreograf-dansepedagog i Danselaboratoriet, mens Elen Øyens perspektiv er som danser i den samme gruppen. Øyen er danser og rullestolbruker. Hovedkonklusjonen i artikkelen er at gjennom å forstå ulikhet som en verdi og impuls til å møtes og skape i improvisasjon i dans, så kan deltakerne i gruppen gjennomgå kraftfulle transformative endringsprosesser når det gjelder synet på ”den andre”. Dette har en betydning som går langt ut over det konkrete, kunstneriske undervisningsrommet. ”Den andre” forstås i artikkelen som en konstruksjon som både muliggjør adskillelse og utestenging fra et fellesskap, men også som en mulighet til å forstå at ”den andre” ikke nødvendigvis er, eller skal være, som meg.
Understanding colloidal charge renormalization from surface chemistry: Experiment and theory
Gisler, T.; Schulz, S. F.; Borkovec, M.; Sticher, H.; Schurtenberger, P.; D'Aguanno, B.; Klein, R.
1994-12-01
In this paper we report on the charging behavior of latex particles in aqueous suspensions. We use static light scattering and acid-base titrations as complementary techniques to observe both effective and bare particle charges. Acid-base titrations at various ionic strengths provide the pH dependent charging curves. The surface chemical parameters (dissociation constant of the acidic carboxylic groups, total density of ionizable sites and Stern capacitance) are determined from fits of a Stern layer model to the titration data. We find strong evidence that the dissociation of protons is the only specific adsorption process. Effective particle charges are determined by fits of integral equation calculations of the polydisperse static structure factor to the static light scattering data. A generalization of the Poisson-Boltzmann cell model including the dissociation of the acidic surface groups and the autodissociation of water is used to predict effective particle charges from the surface chemical parameters determined by the titration experiments. We find that the light scattering data are best described by a model where a small fraction of the ionizable surface sites are sulfate groups which are completely dissociated at moderate pH. These effective charges are comparable to the predictions by a basic cell model where charge regulation is absent.
Influence of surface conductivity on the apparent zeta potential of calcite.
Li, Shuai; Leroy, Philippe; Heberling, Frank; Devau, Nicolas; Jougnot, Damien; Chiaberge, Christophe
2016-04-15
Zeta potential is a physicochemical parameter of particular importance in describing the surface electrical properties of charged porous media. However, the zeta potential of calcite is still poorly known because of the difficulty to interpret streaming potential experiments. The Helmholtz-Smoluchowski (HS) equation is widely used to estimate the apparent zeta potential from these experiments. However, this equation neglects the influence of surface conductivity on streaming potential. We present streaming potential and electrical conductivity measurements on a calcite powder in contact with an aqueous NaCl electrolyte. Our streaming potential model corrects the apparent zeta potential of calcite by accounting for the influence of surface conductivity and flow regime. We show that the HS equation seriously underestimates the zeta potential of calcite, particularly when the electrolyte is diluted (ionic strength ⩽ 0.01 M) because of calcite surface conductivity. The basic Stern model successfully predicted the corrected zeta potential by assuming that the zeta potential is located at the outer Helmholtz plane, i.e. without considering a stagnant diffuse layer at the calcite-water interface. The surface conductivity of calcite crystals was inferred from electrical conductivity measurements and computed using our basic Stern model. Surface conductivity was also successfully predicted by our surface complexation model. Copyright © 2016 Elsevier Inc. All rights reserved.
Saha, Dipika; Negi, Devendra P. S.
2018-01-01
The purpose of the present work was to develop a method for the sensing of thioacetamide by using spectroscopic techniques. Thioacetamide is a carcinogen and it is important to detect its presence in food-stuffs. Semiconductor quantum dots are frequently employed as sensing probes since their absorption and fluorescence properties are highly sensitive to the interaction with substrates present in the solution. In the present work, the interaction between thioacetamide and ZnO quantum dots has been investigated by using UV-visible, fluorescence and infrared spectroscopy. Besides, dynamic light scattering (DLS) has also been utilized for the interaction studies. UV-visible absorption studies indicated the bonding of the lone pair of sulphur atom of thioacetamide with the surface of the semiconductor. The fluorescence band of the ZnO quantum dots was found to be quenched in the presence of micromolar concentrations of thioacetamide. The quenching was found to follow the Stern-Volmer relationship. The Stern-Volmer constant was evaluated to be 1.20 × 105 M- 1. Infrared spectroscopic measurements indicated the participation of the sbnd NH2 group and the sulphur atom of thioacetamide in bonding with the surface of the ZnO quantum dots. DLS measurements indicated that the surface charge of the semiconductor was shielded by the thioacetamide molecules.
Directory of Open Access Journals (Sweden)
Susana Amézqueta
2018-03-01
Full Text Available Serum albumin is the main drug transporter of the bloodstream and contains two main binding sites: Sudlow I or acidic drug binding site, and Sudlow II or benzodiazepine binding site. Warfarin, a well-known anticoagulant drug commonly used in the prevention of thrombosis and thromboembolism, binds to Sudlow I site, whereas non-steroidal antiinflammatory drugs (NSAIDs such as diflunisal bind preferentially to Sudlow II site. Albumin is a fluorophore that modifies its fluorescence (quenching or enhancement effect when it is bound to a drug. The application of the double logarithm Stern-Volmer equation allows the calculation of the stoichiometry and the binding constant of the process. This procedure does not consider the possible interferences coming from the fluorescence of the drug though. Another strategy to evaluate the binding constants is to consider the whole spectrum, taking into account all the possible species in equilibrium; in this case we have used an extended version of the STAR program, which can deal with 300 spectra, each containing up to 300 data points. The aim of this work is to compare both approaches to evaluate the interaction between warfarin (Sudlow I and diflunisal (Sudlow II and HSA: the double logarithm Stern-Volmer equation and the STAR program.
Fluorescence quenching of fluorescein by Merocyanine 540 in liposomes
International Nuclear Information System (INIS)
Toprak, Mahmut; Meryem Aydin, Burcu; Arik, Mustafa; Onganer, Yavuz
2011-01-01
The fluorescence quenching of fluorescein (FL) by merociyanine 540 (MC540) was examined in L-egg lecithin phosphatidycholine (PC) liposomes using spectroscopic methods. The type of quenching mechanism (dynamic or static) was evaluated using the Stern-Volmer plots. Findings were also supported by the temperature studies and florescence decay measurements. The Stern-Volmer equation was utilized to calculate bimolecular quenching constants (K q ). Furthermore, the bimolecular quenching constant of the quencher in the liposomes (K SV ), partition coefficient (K p ), binding constant (K), and corresponding thermodynamic parameters ΔH, ΔS, and ΔG were calculated. The quenching property was also used in determining quantitatively (K p ) the partition coefficient of Merociyanini 540 in PC liposome.The obtained data indicated that static quenching occurred in the system and the K SV values decreased with increasing lipid concentration. In addition, thermodynamic analysis suggested that van der Waals interactions and hydrogen bonding were the main acting forces between fluorescein and merociyanine 540 molecules in the medium. - Highlights: → Fluorescence quenching of FL by MC540 in liposome system was analyzed. → Fluorescence quenching mechanism of FL by MC540 was consistent with the static model. → Binding FL to MC540 was spontaneous and carried out by hydrogen bond and van der Waals forces.
Investigation of longitudinal control system for a small hydrofoil boat
Phillips, W. H.; Shaughnessy, J. D.
1976-01-01
An analysis of a hydromechanical system for longitudinal control of a small hydrofoil boat is presented. The system incorporates height and acceleration sensors operating flaps on the foils through a mechanical linkage. Effects of some of the system parameters on the stability and response to waves are shown. The results indicate that the system is capable of providing adequate stability, but the response to stern waves at low frequencies is larger than desired.
Photochemical assessment of UO2+2 complexation in Triton X-100 micellar system
International Nuclear Information System (INIS)
Das, S.K.; Ganguly, B.N.
1994-01-01
This is a report on the spectral characteristics of UO 2 +2 in the excited state in the Triton X-100 micellar medium. The downward curving of the Stern-Volmer plot explains the two kinds of populations of UO 2 +2 upon micellization. A blue shift of the quenched emission is ascribed due to the collisional encounter of UO 2 +2 with the head groups of Triton X-100. (author). 5 refs., 2 figs
Report: Fourth International Conference on Gas Hydrates, held at Yokohama, Japan, 19-23 May 2002
Digital Repository Service at National Institute of Oceanography (India)
Karisiddaiah, S.M.
formations, while Dr. L. Stern presented ne insights into the phenomena of anomalous or self- preservation of gas hydrates. JOUR.GEOL.SOC.INDIA, VOL.61, JAN. 2001 Posters on hydrate formation and prevention in pipelines and hydrate based...-1 REPORT ON THE 4TH INTERNATIONAL CONFERENCE ON GAS HYDRATES The fourth International Conference on Gas Hydrates was recently held at Yokohama, Japan, between 19-23 May 2002 following the earlier conferences held in USA (1993...
1-Cyclohexyl-6,7-dimethoxy-1,4-dihydronaphthalene
Directory of Open Access Journals (Sweden)
Shao-Yuan Chen
2014-06-01
Full Text Available The title compound, C18H24O2, was isolated from the leaves extract of Ficus carica L. The cyclohexane ring displays a chair conformation whereas the cyclohexa-1,4-diene ring adopts a flattened boat conformation with methyl C atoms at the prow and stern. In the crystal, molecules are linked by weak C—H...O hydrogen bonds into supramolecular chains propagated along the b-axis direction.
Behavioural responses to climate change: Asymmetry of intentions and impacts
Whitmarsh, Lorraine E.
2009-01-01
In seeking to determine whether climate change mitigation strategies are effective, researchers and policy-makers typically use energy consumption as an indicator. UK government data show that energy use amongst the public is rising, despite measures to encourage energy conservation. Yet, research to date has not explicitly asked which actions the public are taking with the express intention of mitigating climate change. Using Stern's classification of impact-oriented and intent-oriented beha...
Tools for Managing Repository Objects
Banker, Rajiv D.; Isakowitz, Tomas; Kauffman, Robert J.; Kumar, Rachna; Zweig, Dani
1993-01-01
working Paper Series: STERN IS-93-46 The past few years have seen the introduction of repository-based computer aided software engineering (CASE) tools which may finally enable us to develop software which is reliable and affordable. With the new tools come new challenges for management: Repository-based CASE changes software development to such an extent that traditional approaches to estimation, performance, and productivity assessment may no longer suffice - if they ever...
Recent developments in laser-driven polarized sources
International Nuclear Information System (INIS)
Young, L.; Coulter, K.P.; Holt, R.J.; Kinney, E.R.; Kowalczyk, R.S.; Potterveld, D.H.; Zghiche, A.
1990-01-01
Recent progress in the performance of laser-driven sources of polarized hydrogen and deuterium is described. The current status of the prototype source, I = 2.5 x 10 17 s -1 , polarization = 0.29 (including atomic fraction), is comparable to classical Stern-Gerlach sources. A scheme to improve source performance by approximately an order of magnitude, using a combination of optical-pumping spin-exchange and RF transitions, is outlined. 8 refs., 2 figs., 1 tab
The Conflicts in Yemen and U.S. National Security
2011-01-01
independence.99 In the same statement, the al-Qaeda leader sternly warned southerners that Marxism was a failed ideology, and that it could not provide any...itself internationally by voting with Cuba against UNSC Resolution 678, which authorized the U.S.-led coalition to use “all necessary means” to...that is probably more significant for Washington than Sana’a involves the Guantanamo Bay, Cuba , detainees. In mid-2010, the United States held over
Poincare invariant algebra from instant to light-front quantization
International Nuclear Information System (INIS)
Ji, Chueng-Ryong; Mitchell, Chad
2001-01-01
We present the Poincare algebra interpolating between instant and light-front time quantizations. The angular momentum operators satisfying SU(2) algebra are constructed in an arbitrary interpolation angle and shown to be identical to the ordinary angular momentum and Leutwyler-Stern angular momentum in the instant and light-front quantization limits, respectively. The exchange of the dynamical role between the transverse angular mometum and the boost operators is manifest in our newly constructed algebra
Enzyme Triggered Drug Delivery for Graft Targeted Immunosupression and Neuroregeneration after VCA
2016-05-11
Banz,6 Mihal A. Constant lnescu,1•2 Jeffrey M. Karp,4 t Praveen Kumar Vemula1 3 t Robert Rieben, 2t Esthe r Vogelin 1’ 2 Curre ntly, syst·emic... Praveen Vemula NAMRU, San Antonio Ms Carrie Crane Ms Candice Angueira i11Stern I) UPMC Lmer.i t ~ uf 1 1,Jmr~h .\\l r<l1c.1l < c111er ’
Documentation of CATHENA input files for the APOLLO computer
International Nuclear Information System (INIS)
1988-06-01
Input files created for the VAX version of the CATHENA two-fluid code have been modified and documented for simulation on the AECB's APOLLO computer system. The input files describe the RD-14 thermalhydraulic loop, the RD-14 steam generator, the RD-12 steam generator blowdown test facility, the Stern Laboratories Cold Water Injection Facility (CWIT), and a CANDU 600 reactor. Sample CATHENA predictions are given and compared with experimental results where applicable. 24 refs
Fadda, Roberta; Lucarelli, Loredana
2017-01-01
Mother-infant interactions during feeding and play are pivotal experiences in the development of infants' early social abilities (Stern, 1985, 1995; Biringen, 2000). Stern indicated distinctive characteristics of mother-infant interactions, respectively, during feeding and play, suggesting to evaluate both to better describe the complexity of such early affective and social experiences (Stern, 1996). Moreover, during the first years of life, infants acquire cognitive and social skills that allow them to interact with new social partners in extra-dyadic interactions. However, the relations between mother-child interactions and infants' social skills in extra-dyadic interactions are still unknown. We investigated longitudinally the relations between mother-child interactions during feeding and play and child's pre-verbal communicative abilities in extra-dyadic interactions during play. 20 dyads were evaluated at T 1 (infants aged between 9-22 months) and 6 months later, at T 2 . The interdyadic differences in mother-infant interactions during feeding and play were evaluated, respectively, with the "Feeding Scale" (Chatoor et al., 1997) and with the "Play Scale" (Chatoor, 2006) and the socio-communicative abilities of children with a new social partner during play were evaluated with the "Early Social Communication Scales" (Mundy et al., 2003). We distinguished the dyads into two categories: dyads with functional interactions (high dyadic reciprocity, low dyadic conflict) and dyads with dysfunctional interactions (lower dyadic reciprocity, higher dyadic conflict). At T 1 , infants belonging to dyads with dysfunctional interactions were significantly lower in "Initiating Joint Attention" and in "Responding to Joint Attention" in interaction with a new social partner compared to the infants belonging to dyads with functional interactions. At T 2 , infants belonging to dyads with dysfunctional interactions were significantly lower in "Initiating Social Interactions" with
International Nuclear Information System (INIS)
Jung, Yun Sik; Lee, Jae Young; Kim, Man Woong
2004-01-01
The moderator cooling system to the Calandria tank of CANDU nuclear power plant provides an alternative pass of heat sink during the hypothetical loss of coolant accident. Also, the neutron population in the CANDU plant can be affected by the moderator temperature change which strongly depends on the circulating flow pattern in the Calandria tank. It has been known that there are three distinguished flow patterns: the buoyancy dominated flow, the momentum dominated flow, and the mixed type flow. The Canadian Nuclear Safety Commission (CNSC) recommended that a series of experimental works should be performed to verify the three dimensional codes. Two existing facilities, SPEL (1982) and STERN (1990), have produced experimental data for these purposes. The present work is also motivated to build up a new scaled experimental facility named HGU for the same purposes. CANDU-6 was selected as the target plant to be scaled down. In the design for the scaled facility, the knowledge on the flow regime transitions in the circulating flow was imperative. In the present study, to pave the way for the scaling, the flow pattern maps of circulating flow were constructed based on the Reynolds number and Archimedes number. The CFX code was employed with real meshes to represent all calandria tubes in the tank. The flow pattern maps were constructed for SPEL, STERN, HGU, and CANDU6. As the key transition criterion useful for scaling law, a new Archimedes number considering the jet impingement of the feed water in the Calandria tank was found. The transition of flow patterns was made with the same Archimedes number for CANDU6, STERN and HGU. However, SPEL which has third of the modified Archimedes number showed different maps in the wider region of mixed flow pattern was observed. It was found that the Archimedes number considering the inlet nozzle velocity plays the key role in patterns classification. Also, it can be suggested that the moderator cooling system needs to be designed
Wunschel, D S; Hutchison, J R; Deatherage Kaiser, B L; Merkley, E D; Hess, B M; Lin, A; Warner, M G
2017-12-18
The process of sporulation is vital for the stability and infectious cycle of Bacillus anthracis. The spore is the infectious form of the organism and therefore relevant to biodefense. While the morphological and molecular events occurring during sporulation have been well studied, the influence of growth medium and temperature on the proteins expressed in sporulated cultures is not well understood. Understanding the features of B. anthracis sporulation specific to natural vs. laboratory production will address an important question in microbial forensics. In an effort to bridge this knowledge gap, a system for sporulation on two types of agar-immobilized soils was used for comparison to cultures sporulated on two common types of solid laboratory media, and one liquid sporulation medium. The total number of proteins identified as well as their identity differed between samples generated in each medium and growth temperature, demonstrating that sporulation environment significantly impacts the protein content of the spore. In addition, a subset of proteins common in all of the soil-cultivated samples was distinct from the expression profiles in laboratory medium (and vice versa). These differences included proteins involved in thiamine and phosphate metabolism in the sporulated cultures produced on soils with a notable increase in expression of ATP binding cassette (ABC) transporters annotated to be for phosphate and antimicrobial peptides. A distinct set of ABC transporters for amino acids, sugars and oligopeptides were found in cultures produced on laboratory media as well as increases in carbon and amino acid metabolism-related proteins. These protein expression changes indicate that the sporulation environment impacts the protein profiles in specific ways that are reflected in the metabolic and membrane transporter proteins present in sporulated cultures.
The Nature of the Micellar Stern Region As Studied by Reaction Kinetics. 2
Buurma, Niklaas J.; Serena, Paola; Blandamer, Michael J.; Engberts, Jan B.F.N.
2004-01-01
The nature of rate-retarding effects of cationic micelles on the water-catalyzed hydrolyses of a series of para-substituted 1-benzoyl-1,2,4-triazoles (1a-f) and 1-benzoyl-3-phenyl-1,2,4-triazole (2) has been studied using kinetic methods. A comparison is drawn between medium effects in the micellar
Critical Exchange: Peculiar Bedfellows--Gender, Sexuality, Religion and Schooling: A Reply to Stern
Rasmussen, Mary L.
2017-01-01
Mary L. Rasmussen is a sociologist of education with expertise in studies of gender and sexuality. This angle of scrutiny (Harwood 2006) is her point of departure in conversations about schooling and religion. From this angle, Rasmussen believes that schooling and religion can be incredibly powerful in creating community. She is also clear that…
re ipit tion re onstru tion using ringEwidth hronology of rim lyn ed r ...
Indian Academy of Sciences (India)
r nges from IHHEEIUS mF hue to he vy r inf ll it does not grow in the e stern rim l y eyond q rhw lF he ringEwidth hronology of rim l y n ed r @eh. IIUIEEIWVVAD prep red from tree ores olle ted from two disjun t m ture forests in western rim l y . @figure IAD h s een used in the present studyF het ils of the methodology ...
Religious Extremism in Pakistan
2014-12-01
Jessica Stern, “Pakistan’s Jihad Culture ,” Foreign Affairs 79, no. 6 (November–December 2000): 115‒126, http://www.jstor.org/stable/20049971; see also...Pakistan’s Jihad Culture ,” Foreign Affairs 79, no. 6 (November‒December 2000): 115‒126, http://www.jstor.org/stable/20049971; Religions and Development...after the JUD was implicated in the Mumbai attack in 2008, protesting that the organization was a charity that helped them by providing food and water
Ionic Liquids in Electro-active Devices (ILED)
2013-12-12
near a charged wall can be modeled by Poisson- Nernst -Planck (PNP) equations , Poisson-Boltzmann (PB) equations , and Gouy-Chapman-Stern (GCS) model...actuators can be calculated from the bending curvature к and the Young’s moduli of the ionic polymer layer Yi and the Au layer Ym by the equation below...Arrhenius equation exp a E p p RT (1) wherein p and aE are the conducting ion concentration as T and the activation energy for conducting
1984-08-01
entrepreneurship -’team made up of J. Stanley programs for people (incentives, and innovation; stern disciplinarians; Baumgartner, Calvin Brown, training, hoopla...they let them know that they were Autonomy and Entrepreneurship important to the success of the pro- Simultaneous Loose-Tight ". ,. Every PM we talked to...account hand, managing a fast-food franchise $40,000 which is now his tax base. "-" (IRA) concept. These refreshing de- is a job that can easily be
Molecular beam epitaxy a short history
Orton, J W
2015-01-01
This volume describes the development of molecular beam epitaxy from its origins in the 1960s through to the present day. It begins with a short historical account of other methods of crystal growth, both bulk and epitaxial, to set the subject in context, emphasising the wide range of semiconductor materials employed. This is followed by an introduction to molecular beams and their use in the Stern-Gerlach experiment and the development of the microwave MASER.
Perspectives on the Viable Mobile Virtual Community for Telemedicine
van 't Klooster, J.W.J.R.; Pawar, P.; van Beijnum, Bernhard J.F.; Dulawan, Chariz; Hermens, Hermanus J.
2010-01-01
A virtual community is an electronically supported social network: it can be seen as a group of people who have regular social interaction, independent of time and space, because of a common interest such as a problem, task, or feeling exchange (Eysenbach, Powell, Englesakis, Rizo, & Stern, 2004; Rheingold, 1993). When independence of time and space is achieved through the use of mobile devices and wireless communication technologies, such a virtual community is called a Mobile Virtual Commun...
Bribery: What do Australian managers know and what do they do?
Michael Segon; Chris Booth
2014-01-01
The recent conviction and gaoling of former Rio Tinto executive Stern Hu and as well as a further 18 Australian citizens facing charges in relation to "fraud and other economic crimes raises a number of questions regarding ethical business practice. A key issue that should be considered is whether Australian businesses are as ethical and transparent as the current high ranking in the Transparency International corruption index tends to suggest.This paper reviews literature pertaining to the n...
Validation of the COBRA code for dry out power calculation in CANDU type advanced fuels
International Nuclear Information System (INIS)
Daverio, Hernando J.
2003-01-01
Stern Laboratories perform a full scale CHF testing of the CANFLEX bundle under AECL request. This experiment is modeled with the COBRA IV HW code to verify it's capacity for the dry out power calculation . Good results were obtained: errors below 10 % with respect to all data measured and 1 % for standard operating conditions in CANDU reactors range . This calculations were repeated for the CNEA advanced fuel CARA obtaining the same performance as the CANFLEX fuel. (author)
ORF Alignment: NC_005945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005945 gi|49185498 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_003995 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003995 gi|21400565 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_003997 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003997 gi|30262655 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
ORF Alignment: NC_007530 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_007530 gi|47527965 >1kwfA 3 362 53 435 1e-84 ... ref|YP_019314.1| chitosanase [Bac...illus anthracis str. 'Ames Ancestor'] ... ref|NP_845032.1| chitosanase [Bacillus anthracis str. ... ... ... Ames] ref|YP_028750.1| chitosanase [Bacillus anthracis ... str. Sterne] ref|NP_656550.1| Glyco_... ... gb|AAP26518.1| chitosanase [Bacillus anthracis str. ... Ames] gb|AAT31789.1| chitosanase [...Bacillus anthracis ... str. 'Ames Ancestor'] gb|AAT54801.1| chitosanase ... [Bacillus anthraci
Raymond, Ogbuka Obinna
2017-01-01
In analyzing survey data, most researchers and analysts make use of statistical methods with straight forward statistical approaches. More common, is the use of one‐way, two‐way or multi‐way tables, and graphical displays such as bar charts, line charts, etc. A brief overview of these approaches and a good discussion on aspects needing attention during the data analysis process can be found in Wilson & Stern (2001). In most cases however, analysis procedures that go beyond simp...
External heavy atom effect on intersystem crossing reactions of aromatic hydrocarbons
International Nuclear Information System (INIS)
Wojnarovits, L.; Foeldiak, G.
1988-01-01
The external heavy atom effect by xenon on the S 1 → T n and T 1 → S o transitions of naphthalene and pyrene was investigated in hydrocarbon solvents by fluorescence or absorption spectroscopy. The quencher forms a short-lived encounter complex (that may be called exciplex as well) with the excited molecules in equilibrium process. This exciplex formation in solutions with naphthalene leads to some deviation from the Stern-Volmer type concentration dependence of the quenching. (author)
Rational and Emotional Communication in Advertising in Women's Magazines in Brazil
Edward Robinson Marin; Nadia Kassouf Pizzinatto; Antonio Carlos Giuliani
2014-01-01
This article investigated the incidence of rational and emotional arguments in messages from 5.536 advertisements of six women's magazines in Brazil (Claudia, Nova, Estilo, Marie Claire, Elle and Gloss), published between May / 2008 and August / 2009. The methodology was based on an exploratory study, supported on a scale of 14 items, by Resnik and Stern (1977), which recommend matching appeals to attitude toward the product, that is, use informative advertising, based on rational appeals for...
Saha, Dipika; Negi, Devendra P S
2018-01-15
The purpose of the present work was to develop a method for the sensing of thioacetamide by using spectroscopic techniques. Thioacetamide is a carcinogen and it is important to detect its presence in food-stuffs. Semiconductor quantum dots are frequently employed as sensing probes since their absorption and fluorescence properties are highly sensitive to the interaction with substrates present in the solution. In the present work, the interaction between thioacetamide and ZnO quantum dots has been investigated by using UV-visible, fluorescence and infrared spectroscopy. Besides, dynamic light scattering (DLS) has also been utilized for the interaction studies. UV-visible absorption studies indicated the bonding of the lone pair of sulphur atom of thioacetamide with the surface of the semiconductor. The fluorescence band of the ZnO quantum dots was found to be quenched in the presence of micromolar concentrations of thioacetamide. The quenching was found to follow the Stern-Volmer relationship. The Stern-Volmer constant was evaluated to be 1.20×10 5 M -1 . Infrared spectroscopic measurements indicated the participation of the NH 2 group and the sulphur atom of thioacetamide in bonding with the surface of the ZnO quantum dots. DLS measurements indicated that the surface charge of the semiconductor was shielded by the thioacetamide molecules. Copyright © 2017 Elsevier B.V. All rights reserved.
Dong, Conglin; Yuan, Chengqing; Wang, Lei; Liu, Wei; Bai, Xiuqin; Yan, Xinping
2016-01-01
Frictional vibration and noise caused by water-lubricated rubber stern tube bearings, which are generated under extreme conditions, severely threaten underwater vehicles’ survivability and concealment performance. This study investigates the effect of flaky and spherical MoS2 nanoparticles on tribological properties and damping capacity of water-lubricated rubber materials, with the aim of decreasing frictional noise. A CBZ-1 tribo-tester was used to conduct the sliding tests between rubber ring-discs and ZCuSn10Zn2 ring-discs with water lubrication. These materials’ typical mechanical properties were analysed and compared. Coefficients of friction (COFs), wear rates, and surface morphologies were evaluated. Frictional noise and critical velocities of generating friction vibration were examined to corroborate above analysis. Results showed that spherical MoS2 nanoparticles enhanced rubber material’s mechanical and tribological properties and, in turn, reduced the friction noise and critical velocity. Flaky MoS2 nanoparticles reduced COF but did not enhance their mechanical properties, i.e., the damping capacity, wear resistance property; thus, these nanoparticles did not reduce the critical velocity obviously, even though increased the frictional noise at high load. The knowledge gained in the present work will be useful for optimizing friction pairs under extreme conditions to decrease frictional noise of water-lubricated rubber stern tube bearings. PMID:27713573
luxury marketing: internationalization strategies for brazilian jewelry companies
Directory of Open Access Journals (Sweden)
Chaline Gasperini
2010-04-01
Full Text Available This article seeks to make an analysis of the luxury market and of Brazilian jewelry companies. The main objective is to analyze the attraction of external marketing to luxury brands internationalization, emphasizing Brazilian jewelry companies. First, the national environment of luxury market an jewelry in Brazil is presented. In sequence, it will address the possible goals, risks and opportunities that internationalized jewelry companies face in the expansion process and its difficulties in foreign markets. Finally, some forms of internationalization will be presented based on the case of the Brazilian jewelry companies H Stern and Talento Jóias. The methodology used in this article is exploratory, with documental analysis and in depth interview. As theoretical foundations for the article, the themes luxury, exportations, company internationalization and global market were addressed. The main author(s researched were: Allérès (2006, Almeida (2007, Czinkota (2001, Grande (2007, Lipovetsky e Roux (2005. Among the main conclusions, Brazilian jewelry companies have great advantages compared to other countries, having the possibility to use Brazilian nature resources, like precious stones and gems, thus, it become more interesting and viable to innovate and conquer external market. Besides, jewelry market attractions make several entrepreneurs interested in opening business in this field, and lately internationalize them, such as H Stern case.
International Nuclear Information System (INIS)
Yuan Jipei; Guo Weiwei; Wang Erkang
2008-01-01
The unique surface-sensitive properties make quantum dots (QDs) great potential in the development of sensors for various analytes. However, quantum dots are not only sensitive to a certain analyte, but also to the surrounding conditions. The controlled response to analyte may be the first step in the designing of functional quantum dots sensors. In this study, taking the quenching effect of benzoquinone (BQ) on CdTe QDs as model, several critical parameters of buffer solution conditions with potential effect on the sensors were investigated. The pH value and the concentration of sodium citrate in the buffer solution critically influenced the quenching effects of BQ. Dozens folds elevation of the quenching extents were observed with the increase of concentrations of H + and sodium citrate, and the quenching mechanisms were also fundamentally different with the changes of the surrounding buffer solutions. The quenching models were proposed and analyzed at different buffer conditions. Taking pH values for example, QDs quenching obeyed the sphere of effective quenching model with the sphere radii of 8.29 nm at pH 8.0, the linear Stern-Volmer equation with Stern-Volmer constant of 2.0 x 10 3 mol -1 L at pH 7.0, and the two binding site static quenching model at basic conditions. The elucidation of parameters for assay performance was important in the development of QDs-based optical sensors
Photophysics of tryptophan in H2O, D2O, and in nonaqueous solvents
International Nuclear Information System (INIS)
Gudgin, E.; Lopez-Delgado, R.; Ware, W.R.
1983-01-01
The fluorescence properties of tryptophan in water and deuterated water have been examined. Tryptophan molecules exhibit three distinct fluorescence lifetimes in water which become longer in deuterated water; the two shorter lifetimes are present below the pK of the amino group and the long lifetime appears as the pH is raised through this pK. The steady-state quenching of tryptophan fluorescence by hydrogen ion in the region of pH less than 3 shows a definite wavelength effect, consistent with less-pronounced quenching of the subnanosecond component whose emission maximum is at 330 nm. The Stern-Volmer plots show a marked curvature in the direction of decreasing Stern-Volmer constant as [H 3 O + ] increases. Deuterium ion also quenches tryptophan fluorescence at low pD. A kinetic scheme is proposed which reproduces both the steady-state and lifetime quenching results. Tryptophan in methanol or ethanol exhibits three fluorescence lifetimes; the relative percentage of the long component vs. the intermediate component can be varied by the addition of triethylamine or acid. In dimethyl sulfoxide, tryptophan and tryptophan deuterated at the amino and ring nirogen positions show identical behavior, both having the same decay parameters. These results are discussed in light of the theories which have recently been proposed to account for the several components in tryptophan fluorescence decay. Solvent interaction is suggested to play a critical role
ORF Alignment: NC_007530 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_007530 gi|47530092 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain protein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom
2014-01-01
M.A. (Geography and Environmental Management) Water can be regarded as a scarce commodity in South Africa and one cannot rely solely on the discovery of new water resources to meet the ever increasing demands. Water is arguably the most precious resource in South Africa and its proper management in all spheres of activity is imperative ( Middleton and Stern,1987 ). This is no different in the mining industry where a primary consumptive use of water is in the tailings dams and associated re...
Observation of Spin Flips with a Single Trapped Proton
Ulmer, S.; Blaum, K.; Kracke, H.; Mooser, A.; Quint, W.; Walz, J.
2011-01-01
Spin transitions of an isolated trapped proton are observed for the first time. The spin quantum jumps are detected via the continuous Stern-Gerlach effect which is used in an experiment with a single proton stored in a cryogenic Penning trap. This opens the way for a direct high-precision measurement of the magnetic moment of the proton and a new test of the matter-antimatter symmetry in the baryon sector. This method can also be applied to other light atomic nuclei.
1975-07-07
ship because of increese of propeller efficiency and saving on the high cost of difficult to obtain materials (bronze, brass, stainless steel). The...indAjate that. x :axmuin stresses in the blade cross section are the cor-,prc-.,; ivFe norm-al strcs3es at point G. The maximom tensile stres-ses cis a...and stern part of the ship. Because of purely technical difficulties and also because of the relatively high cost of preparations for such tests, only
The United States Navy and Israeli Navy: Background, Current Issues, Scenarios, and Prospects
2012-02-01
second missile flew a sea- skimming profile, and hit the ship’s crane on the stern, near the ship’s helicopter pad.67 Hanit is a stealthy design, with a...IN had a long-standing mission of protecting the sea lines of communication to Israel, as well as preventing terrorists from penetrating its...economic conditions—there is currently a glut of gas on the world market —Israel could become a net exporter of gas.75 The prospect of offshore gas
Deep Drilling Results in the Atlantic Ocean: Ocean Crust
1979-01-01
the volcano Agua de Pau. //i ( ,.which nas eruted 5 tir-es in tile past 4.600 / ye,.rs, the last in 1563. Xumerous not springs S/ o3220 an’ soradic...complex. In a study layered structure and physical properties to of ophiolite complexes in southern Chile , de Wit ce those of oceanic crust...Spooner et al, 1977) and and Govett, 1973). A large lens, for example that S. Chile (Stern et al, 1976). Zeolite to amphib- at Skouriotissa, had a
Bättig, Michèle B.; Bernauer, Thomas
2017-01-01
This article examines whether democracies contribute more to the provision of global public goods. It thus contributes to the debate on the effects of domestic institutions on international cooperation. The focus is on human-induced climate change, in Stern's words "the biggest market failure the world has ever seen.” Using new data on climate change cooperation we study a cross-section of 185 countries in 1990-2004. The results show that the effect of democracy on levels of political commitm...
A Goal Programming Model for the Siting of Multilevel EMS Systems.
1980-03-01
Management," unpublished Ph.D. thesis, University of Texas, Austin, Texas, 1971. -23- (11) Daskin , M. and E. Stern, " A Multiobjective Set Covering...GOAL PROGRAM4MING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTE-ETC(U) UNM1AR 80 A CHARNES, J E STORBECK N000iA-75-C-569 WICLASSIFIED CCS-366 N...366 A GOAL PROGRAMMING MODEL FOR THE SITING OF MULTILEVEL EMS SYSTEMS by A . Charnes J. Storbeck March 1980 This project was partially supported by
Unambiguous assignment of the ground state of a nearly degenerate cluster
International Nuclear Information System (INIS)
Gutsev, G. L.; Khanna, S. N.; Jena, P.
2000-01-01
A synergistic approach that combines first-principles theory and electron photodetachment experiment is shown to be able to uniquely identify the ground state of a nearly degenerate cluster in the gas phase. Additionally, this approach can complement the Stern-Gerlach technique in determining the magnetic moment of small clusters unambiguously. The method, applied to a Fe 3 cluster, reveals its ground state to have a magnetic moment of 10μ B --in contrast with earlier predictions. (c) 2000 The American Physical Society
ORF Alignment: NC_003995 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003995 gi|21402596 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom
ORF Alignment: NC_005945 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_005945 gi|49187443 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom
ORF Alignment: NC_003997 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_003997 gi|30264621 >1m65A 4 232 339 570 1e-51 ... ref|YP_021441.1| php domain prot...ein [Bacillus anthracis str. 'Ames Ancestor'] ... ref|NP_846998.1| PHP domain protein [Bacillus anthr...acis ... str. Ames] ref|YP_030695.1| PHP domain protein [Bacillus ... anthracis str. Sterne] r.... A2012] ... gb|AAP28484.1| PHP domain protein [Bacillus anthracis ... str. Ames] gb|AAT33916.1| PHP... domain protein [Bacillus ... anthracis str. 'Ames Ancestor'] gb|AAT56746.1| PHP ... dom
Zhao, H.; Baker, D. N.; Califf, S.; Li, X.; Jaynes, A. N.; Leonard, T.; Kanekal, S. G.; Blake, J. B.; Fennell, J. F.; Claudepierre, S. G.; Turner, D. L.; Reeves, G. D.; Spence, H. E.
2017-12-01
Using measurements from the Van Allen Probes, a penetration event of tens to hundreds of keV electrons and tens of keV protons into the low L shells (L electric field represented by the Volland-Stern model or a uniform dawn-dusk electric field model based on the electric field measurements. It suggests that the underlying physical mechanism responsible for energetic electron deep penetration, which is very important for fully understanding energetic electron dynamics in the low L shells, should be MLT localized.
THE EFFECT OF LEVERAGE AND ECONOMIC VALUE ADDED ON MARKET VALUE ADDED
Kristína Jančovičová BOGNÁROVÁ
2018-01-01
Economic value added (EVA) is a performance measure developed by Stern Stewart & Co.) that attempts to measure the true economic profit produced by a company. Such a metric is useful for investors who wish to determine how well a company has produced value for its investors, and it can be compared against the company's peers for a quick analysis of how well the company is operating in its industry. Market value added (MVA), on the other hand, is simply the difference between the c...
Self-polarization of stored (anti-)protons: Status of the Spin-Splitter experiment at IUCF
International Nuclear Information System (INIS)
Rossmanith, R.
1990-01-01
Several years ago a selfpolarization effect for stored (anti-)protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at IUCF is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low energy range and at SSC and LHC energies
Laughing Out Loud with Jonathan Coe: A Conversation
Guignery, Vanessa
2016-01-01
This conversation with Jonathan Coe took place at the École Normale Supérieure de Lyon on 15 October 2015. Part of the discussion focuses on Coe’s fictional production and part of it draws from essays included in Marginal Notes, Doubtful Statements. Non-Fiction, 1990-2013, a collection which contains pieces about such comic or satirical writers as Henry Fielding, Jonathan Swift, Laurence Sterne, B.S. Johnson, Alasdair Gray and David Nobbs, as well as musicians and film directors. The book com...
Molecular beams entwined with quantum theory: a bouquet for Max Planck
International Nuclear Information System (INIS)
Herschbach, D.
2001-01-01
In an era when the fledgling quantum theory was ''uncertain and even gave contradictory answers,'' Otto Stern undertook to employ molecular beams to test directly fundamental aspects of the theory. During 1921-1935, this led to five decisive experiments reviewed here, resulting in the discovery or demonstration of space quantization, de Broglie matter waves, anomalous magnetic moments of the proton and neutron, recoil of an atom on emission of a photon, and the limitation of scattering cross-sections for molecular collisions imposed by the uncertainty principle. (orig.)
Caltech Center for Structural and Amorphous Metals
2005-05-10
Flores, D. Suh, R. Howell, P. Asoka -Kumar, P.A. Sterne, and R. H. Dauskardt, "Flow and Fracture of Bulk Metallic Glass Alloys and Their Composites...Behavior of Zr-Ti-Cu-Ni-Be Bulk Metallic Glass Alloys," Materials Transactions, JIM, 42 [4], 638-641, 2001. K. M. Flores, D. Suh, P. Asoka -Kumar, P.A...Materials Research, 17[5], 1153-1161, 2002. D. Suh, P. Asoka -Kumar and R. H. Dauskardt, "The Effects of Hydrogen on Viscoelastic Relaxation in Zr-Ti-Ni-Cu
Action Research Evaluation of Bystander Intervention Training Created by Munche, Stern, and O'Brien
Shiflet, Jacqueline H.
2013-01-01
This qualitative, appreciative inquiry study was an examination of bystander intervention as related to sexual assault in the military. The purpose of the study was to examine how military personnel and Department of Defense civilian employees reflecting diverse backgrounds perceived the effectiveness of bystander intervention training and sexual…
Measurements of DNA Damage and Repair in Bacillus anthracis Sterne Spores by UV Radiation
2014-09-18
tightly into chromosomal structure, which serves to protect the DNA. The DNA is coiled several times and wrapped tightly around proteins. The wrapping...helps the DNA keep its chromatin structure. When DNA is to be replicated, enzymes unwind the chromosomal DNA. Therefore, DNA is not specifically used...2 See Appendix for Plasmid Information sheet. 30 the ice crystals disappeared . The tube was gently mixed by hand
Revil, A.
2013-12-01
The first part of the presentation will be dedicated to the spectral induced polarization signature of bacteria in porous media. We developed a quantitative model to investigate frequency-domain induced polarization response of suspensions of bacteria and bacteria growth in porous media. Induced polarization of bacteria (alpha-polarization) is related to the properties of the electrical double layer of the bacteria. Surface conductivity and alpha-polarization are due to the Stern layer of counterions occurring in a brush of polymers coating the surface of the bacteria. These phenomena can be related to the cation exchange capacity of the bacteria. The mobility of the counterions in this Stern layer is found to be very small (4.7×10-10 m2s-1 V-1 at 25°C). This implies a very low relaxation frequency for the alpha-polarization of the bacteria cells (typically around 0.1 to 5 Hertz) in agreement with experimental observations. This new model can be coupled to reactive transport modeling codes in which the evolution of bacterial populations are usually described by Monod kinetics. We show that the growth rate and endogenous decay coefficients of bacteria in a porous sand can be inferred non-intrusively from time lapse frequency-domain induced polarization data. The second part of the presentation will concern the biogeobattery mechanism showing new data, the concept of transient biogeobattery and the influence of the concentration of the electron acceptors in the process.
International Nuclear Information System (INIS)
Kay, Suzanne Mahlburg; Kurtz, A.C
2001-01-01
The origin of isotopic variations in Central Andean arc lavas is a long-standing problem that involves identifying mantle and crustal source regions. Advances have come from analyzing temporal and spatial variations in constrained tectonic settings. The purpose here is to highlight the similarities of temporal variations in an east-west transect of Neogene magmatic units near 34 O S latitude with those from a south-north transect along the modern Southern Volcanic Zone (SVZ, e.g. Hildreth and Moorbath 1988, Tormey et al. 1991). The comparison shows the importance of crustal thickening processes associated with compressional shortening and of lithospheric scale adjustments associated with eastward migration of the arc front on magma sources. Sr, Nd and Pb isotopic analyses of 27 Neogene volcanic and plutonic samples from the El Teniente area are presented in Table 1 and plotted along with some analyses from Skewes and Stern (1994) and Stern and Skewes (1995) in Figure 2. The data show a clear progression from older samples with more 'depleted' isotopic signatures (lower 87 Sr/ 86 Sr and Pb isotopic ratios, higher εNd) to younger samples with more 'enriched' signatures (higher 87 Sr/ 86 Sr and Pb isotopic ratios, lower εNd). In detail, four temporal and spatial groups marked by discontinuities in isotopic trends can be defined. Within each group, εNd tends to decrease and 87 Sr/ 86 Sr ratios to increase with SiO2 concentration (au)
Directory of Open Access Journals (Sweden)
Satoshi Uchida
2018-02-01
Full Text Available Indirect reciprocity is one of the basic mechanisms to sustain mutual cooperation, by which beneficial acts are returned, not by the recipient, but by third parties. This mechanism relies on the ability of individuals to know the past actions of others, and to assess those actions. There are many different systems of assessing others, which can be interpreted as rudimentary social norms (i.e., views on what is “good” or “bad”. In this paper, impacts of different adaptive architectures, i.e., ways for individuals to adapt to environments, on indirect reciprocity are investigated. We examine two representative architectures: one based on replicator dynamics and the other on genetic algorithm. Different from the replicator dynamics, the genetic algorithm requires describing the mixture of all possible norms in the norm space under consideration. Therefore, we also propose an analytic method to study norm ecosystems in which all possible second order social norms potentially exist and compete. The analysis reveals that the different adaptive architectures show different paths to the evolution of cooperation. Especially we find that so called Stern-Judging, one of the best studied norms in the literature, exhibits distinct behaviors in both architectures. On one hand, in the replicator dynamics, Stern-Judging remains alive and gets a majority steadily when the population reaches a cooperative state. On the other hand, in the genetic algorithm, it gets a majority only temporarily and becomes extinct in the end.
Uchida, Satoshi; Yamamoto, Hitoshi; Okada, Isamu; Sasaki, Tatsuya
2018-02-01
Indirect reciprocity is one of the basic mechanisms to sustain mutual cooperation, by which beneficial acts are returned, not by the recipient, but by third parties. This mechanism relies on the ability of individuals to know the past actions of others, and to assess those actions. There are many different systems of assessing others, which can be interpreted as rudimentary social norms (i.e., views on what is “good” or “bad”). In this paper, impacts of different adaptive architectures, i.e., ways for individuals to adapt to environments, on indirect reciprocity are investigated. We examine two representative architectures: one based on replicator dynamics and the other on genetic algorithm. Different from the replicator dynamics, the genetic algorithm requires describing the mixture of all possible norms in the norm space under consideration. Therefore, we also propose an analytic method to study norm ecosystems in which all possible second order social norms potentially exist and compete. The analysis reveals that the different adaptive architectures show different paths to the evolution of cooperation. Especially we find that so called Stern-Judging, one of the best studied norms in the literature, exhibits distinct behaviors in both architectures. On one hand, in the replicator dynamics, Stern-Judging remains alive and gets a majority steadily when the population reaches a cooperative state. On the other hand, in the genetic algorithm, it gets a majority only temporarily and becomes extinct in the end.
A study of traditional boats of Goa
Digital Repository Service at National Institute of Oceanography (India)
Shaikh, Z.A.; Tripati, S.; Shinde, V.
are joined and sewed with coir or nylon rope. It has been observed that the centre portion of the dugout is ‘U’ shaped and bow and stern is ‘V’ in shape. Except some minor differences in joining of planks such as ‘V’ and ‘L’ groove no major changes has.... and G. V. Rajamanickam 1993. An Analysis of Different Types of Traditional Coastal Vessels along the Kerala Coast, Journal of Marine Archaeology 4: 36-50. Hornell, J. 1920. The Origin and Ethnological Significance of Indian Boat Designs, Memoirs...
Quantum reality theory and philosophy
Allday, Jonathan
2009-01-01
PrefaceIntroductionAuthorPart I Our First Quantum Object: Light Some Opening Thoughts A Little Light Reading Lasers and Video Cameras Photons An Interference Experiment with Photons Interference as a Wave Effect Mach-Zehnder with Photons Delayed Choice Summary Endnotes Interlude 1: Another Interference Experiment Particles Electrons The Electron Gun The Stern-Gerlach Experiment Turning Things Round Things Get More Puzzling So, Where Did It Go? What Does It All Mean? Some Indications with Other Particles The Long and the Short of It Summary Endnotes Quantum States Where Are We Now? Describing C
Tang, Jing; Yang, Chao; Zhou, Lin; Ma, Fei; Liu, Shuchao; Wei, Shaohua; Zhou, Jiahong; Zhou, Yanhuai
2012-10-01
In this article, the interaction mechanism of prodigiosin (PG) with bovine hemoglobin (BHb) is studied in detail using various spectroscopic technologies. UV-vis absorption and fluorescence spectra demonstrate the interaction process. The Stern-Volmer plot and the time-resolved fluorescence study suggest the quenching mechanism of fluorescence of BHb by PG is a static quenching procedure, and the hydrophobic interactions play a major role in binding of PG to BHb. Furthermore, synchronous fluorescence studies, Fourier transform infrared (FTIR) and circular dichroism (CD) spectra reveal that the conformation of BHb is changed after conjugation with PG.
Conductivity maximum in a charged colloidal suspension
Energy Technology Data Exchange (ETDEWEB)
Bastea, S
2009-01-27
Molecular dynamics simulations of a charged colloidal suspension in the salt-free regime show that the system exhibits an electrical conductivity maximum as a function of colloid charge. We attribute this behavior to two main competing effects: colloid effective charge saturation due to counterion 'condensation' and diffusion slowdown due to the relaxation effect. In agreement with previous observations, we also find that the effective transported charge is larger than the one determined by the Stern layer and suggest that it corresponds to the boundary fluid layer at the surface of the colloidal particles.
DEFF Research Database (Denmark)
Schulze, Holger
2012-01-01
How are those sounds you hear right now technically generated and post-produced, how are they aesthetically conceptualized and how culturally dependant are they really? How is your ability to hear intertwined with all the other senses and their cultural, biographical and technological constructio...... over time? And how is listening and sounding a deeply social activity – constructing our way of living together in cities as well as in apartment houses? A radio feature with Jonathan Sterne, AGF a.k.a Antye Greie, Jens Gerrit Papenburg & Holger Schulze....
Simulación del fenómeno electrosísmico en una dimensión usando diferencias finitas
Nemocón Romero, Ana Milena
2014-01-01
La electrosísmica es una reciente técnica de prospección geofísica que, a diferencia de otras, puede llegar a distinguir entre varios fluidos como agua e hidrocarburos. La técnica consiste en la generación de una onda mecánica a partir de un pulso electromagnético aplicado en la superfiie terrestre, al atravesar el material, actúa de manera diferente sobre la superfiie cargada de los granos (capa Stern) y sobre la capa inducida en el fluido que satura el suelo (capa difusa)...
Galeano, Belinda; Korff, Emily; Nicholson, Wayne L.
2003-01-01
Stainless steel surfaces coated with paints containing a silver- and zinc-containing zeolite (AgION antimicrobial) were assayed in comparison to uncoated stainless steel for antimicrobial activity against vegetative cells and spores of three Bacillus species, namely, B. anthracis Sterne, B. cereus T, and B. subtilis 168. Under the test conditions (25°C and 80% relative humidity), the zeolite coating produced approximately 3 log10 inactivation of vegetative cells within a 5- to 24-h period, but viability of spores of the three species was not significantly affected. PMID:12839825
Usable Human Authentication: A Quantitative Treatment
2014-06-30
Some examples: I have two kids : Jack and Jill. I like to eat Dave & Andy’s ice cream. No, the capital of Wisconsin isn’t Cheeseopolis! 2. Now take the...random mapping that the user will memorize. We will sometimes abuse notation and think of σ ∈ Znd as a string which encodes the mapping, and we will use σ... Verbal Learning and Verbal Behavior, 18(6):687–704, 1979. 6.1.1 [156] M. Weir, S. Aggarwal, M. Collins, and H. Stern. Testing metrics for password creation
The 'factor 4' goal: what are we talking about?
International Nuclear Information System (INIS)
2013-01-01
Since the demonstration by scientists of the role of human activity in global warming, completed by the Stern report condemning the cost of inaction, France has set itself the goal of dividing by four its greenhouse gas emissions by 2050 with respect to its 1990 emissions volume. This goal, even if higher than the international goals, is justified by the common but differentiated liability principle enshrined in the UN Framework Convention on Climate Change. Some countries have to show the way, considering their volume of past emissions and their high level of development
DEFF Research Database (Denmark)
Gottfried, Tali
Abstract Collaborative Parent Counseling in Music Therapy (PCiMT) for parents of children with Autism Spectrum Disorder is a clinical approach, in which the music therapist conducts both the individual MT sessions for the child as well as the counseling sessions for the parents. This practice...... is now being tested in my PhD research. Description Early parent-child relationship, represented commonly by reciprocal musical-wise interaction (Stern, 1985), is interrupted by organic impairments, sourced at the core of the Autism Spectrum Disorder (ASD). Parenting a child with ASD involves great...
Must we act? The necessity of the emergency
International Nuclear Information System (INIS)
Hourcade, J.Ch.; Halle-Gatte, St.; Ambrosi, Ph.
2007-01-01
In this analysis, the authors aims to answer the three following questions. Is the world economy really threatened by the climatic change? Must we invest massively to avoid the worst? Or shall we just manage the damages? If some economist as Nicholas Stern concludes to the emergency of the actions, other as the scientist Bjorn Lomborg prefers to devote an important part of the money to help the today inhabitants of developing countries instead of the future generations. This document takes stock on these opposite points of view. (A.L.B.)
International Nuclear Information System (INIS)
Shoukri, M.; Abdul-Razzak, A.
1990-04-01
Analysis of existing data on fuel channel refilling is presented. The analysis focuses on the data obtained using the Stern Laboratories Cold Water Injection Test (CWIT) Facility. The two-fluid model thermal-hydraulics computer code CATHENA is also used to simulate experimental results on fuel channel refilling from both the CWIT and RD-14 facilities. Conclusions related to single and double break tests, including the effect of non-condensible gases, are presented. A set of recommendations is given for further analysis and separate effect experiments. (67 figs., 5 tabs., 24 refs.)
SURVEYING, MODELING AND 3D REPRESENTATION OF A WRECK FOR DIVING PURPOSES: CARGO SHIP “VERA”
Ktistis, A.; Tokmakidis, P.; Papadimitriou, K.
2017-01-01
This paper presents the results from an underwater recording of the stern part of a contemporary cargo-ship wreck. The aim of this survey was to create 3D representations of this wreck mainly for recreational diving purposes. The key points of this paper are: a) the implementation of the underwater recording at a diving site; b) the reconstruction of a 3d model from data that have been captured by recreational divers; and c) the development of a set of products to be used by the general publi...
Stern, Alan
2001-03-01
The Universe in which we live is unimaginably vast and ancient, with countless star systems, galaxies, and extraordinary phenomena such as black holes, dark matter, and gamma ray bursts. What phenomena remain mysteries, even to seasoned scientists? Our Universe is a fascinating collection of essays by some of the world's foremost astrophysicists. Some are theorists, some computational modelers, some observers, but all offer their insights into the most cutting-edge, difficult, and curious aspects of astrophysics. Compiled, the essays describe more than the latest techniques and findings. Each of the ten contributors offers a more personal perspective on their work, revealing what motivates them and how their careers and lives have been shaped by their desire to understand our universe. S. Alan Stern is Director of the Department of Space Studies at Southwest Research Institute in Boulder, Colorado. He is a planetary scientist and astrophysicist with both observational and theoretical interests. Stern is an avid pilot and a principal investigator in NASA's planetary research program, and he was selected to be a NASA space shuttle mission specialist finalist. He is the author of more than 100 papers and popular articles. His most recent book is Pluto & Charon (Wiley, 1997). Contributors: Dr. John Huchra, Harvard University Dr. Esther Hu, University of Hawaii, Honolulu Dr. John Mather, NASA Goddard Space Flight Center Dr. Nick Gnedin, University of Colorado, Boulder Dr. Doug Richstone, University of Michigan, Ann Arbor Dr. Bohdan Paczynski, Princeton University, NJ Dr. Megan Donahue, Space Telescope Science Institute, Baltimore, MD Dr. Jerry Ostriker, Princeton University, New Jersey G. Bothun, University of Oregon, Eugene
Interaction of ZnS nanoparticles with flavins and glucose oxidase: A fluorimetric investigation
Energy Technology Data Exchange (ETDEWEB)
Chatterjee, Anindita; Priyam, Amiya; Ghosh, Debasmita; Mondal, Somrita [UGC-DAE Consortium for Scientific Research, Kolkata Centre, III/LB-8, Bidhannagar, Kolkata 700098 (India); Bhattacharya, Subhash C. [Department of Chemistry, Jadavpur University, Kolkata 700032 (India); Saha, Abhijit, E-mail: abhijit@alpha.iuc.res.in [UGC-DAE Consortium for Scientific Research, Kolkata Centre, III/LB-8, Bidhannagar, Kolkata 700098 (India)
2012-03-15
Interactions of luminescence, water soluble ZnS nanoparticles (NPs) with flavins and glucose oxidase have been thoroughly investigated through optical spectroscopy. The photoluminescence of ZnS nanoparticles was quenched severely ({approx}60%) by riboflavin while other flavins such as flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) show quenching to different extents under analogous conditions. However, interestingly no effect in luminescence intensity of ZnS NPs was observed with protein bound flavins such as in glucose oxidase. Fluorescence lifetime measurement confirmed the quenching to be static in nature. Scavenging of photo-generated electron of ZnS nanoparticles by the flavin molecules may be attributed to the decrease in luminescence intensity. Quenching of ZnS nanoparticles with flavins follows the linear Stern-Volmer plot. The Stern-Volmer constants decreased in the following order: K{sub S-V} (Riboflavin)> K{sub S-V} (FAD)> K{sub S-V} (FMN). This interaction study could generate useful protocol for the fluorimetric determination of riboflavin (vitamin B{sub 2}) content and also riboflavin status in biological systems. - Highlights: Black-Right-Pointing-Pointer Unique interaction specificity of ZnS nanoparticles with flavins has been explored. Black-Right-Pointing-Pointer Unlike protein-bound flavin, fluorescence of free flavins was quenched by ZnS nanoparticles. Black-Right-Pointing-Pointer FMN and FAD show quenching to different extents under analogous conditions. Black-Right-Pointing-Pointer Fluorescence lifetime measurement confirmed the quenching to be static in nature. Black-Right-Pointing-Pointer This study is useful for probing riboflavin in biological systems.
VizieR Online Data Catalog: NuSTAR serendipitous survey: the 40-month catalog (Lansbury+, 2017)
Lansbury, G. B.; Stern, D.; Aird, J.; Alexander, D. M.; Fuentes, C.; Harrison, F. A.; Treister, E.; Bauer, F. E.; Tomsick, J. A.; Balokovic, M.; Del Moro, A.; Gandhi, P.; Ajello, M.; Annuar, A.; Ballantyne, D. R.; Boggs, S. E.; Brandt, W. N.; Brightman, M.; Chen, C.-T. J.; Christensen, F. E.; Civano, F.; Comastri, A.; Craig, W. W.; Forster, K.; Grefenstette, B. W.; Hailey, C. J.; Hickox, R. C.; Jiang, B.; Jun, H. D.; Koss, M.; Marchesi, S.; Melo, A. D.; Mullaney, J. R.; Noirot, G.; Schulze, S.; Walton, D. J.; Zappacosta, L.; Zhang, W. W.
2017-09-01
Over the period from 2012 July to 2015 November, which is the focus of the current study, there are 510 individual NuSTAR exposures that have been incorporated into the serendipitous survey. These exposures were performed over 331 unique fields (i.e., 331 individual sky regions, each with contiguous coverage composed of one or more NuSTAR exposures), yielding a total sky area coverage of 13deg2. Table 1 lists the fields chronologically. The fields have a cumulative exposure time of 20.4Ms. We have undertaken a campaign of dedicated spectroscopic follow-up in the optical-IR bands, obtaining spectroscopic identifications for a large fraction (56%) of the total sample. Since NuSTAR performs science pointings across the whole sky, a successful ground-based follow-up campaign requires the use of observatories at a range of geographic latitudes, and preferably across a range of dates throughout the sidereal year. This has been achieved through observing programs with, primarily, the following telescopes over a multiyear period (2012 Oct 10 to 2016 Jul 10): the Hale Telescope at Palomar Observatory (5.1m; PIs F. A. Harrison and D. Stern); Keck I and II at the W. M. Keck Observatory (10m; PIs F. A. Harrison and D. Stern); the New Technology Telescope (NTT) at La Silla Observatory (3.6m; PI G. B. Lansbury); the Magellan I (Baade) and Magellan II (Clay) Telescopes at Las Campanas Observatory (6.5m; PIs E. Treister and F. E. Bauer); and the Gemini-South observatory (8.1m; PI E. Treister). (5 data files).
Energy Technology Data Exchange (ETDEWEB)
Borissevitch, I.E., E-mail: iourib@ffclrp.usp.br [Departamento de Fisica, Faculdade de Filosofia Ciencia e Letras de Ribeirao Preto, Universidade de Sao Paulo, Av. Bandeirantes 3900, Ribeirao Preto, SP (Brazil); Parra, G.G. [Departamento de Fisica, Faculdade de Filosofia Ciencia e Letras de Ribeirao Preto, Universidade de Sao Paulo, Av. Bandeirantes 3900, Ribeirao Preto, SP (Brazil); Zagidullin, V.E.; Lukashev, E.P.; Knox, P.P.; Paschenko, V.Z.; Rubin, A.B. [Department of Biophysics, Faculty of Biology, M.V. Lomonosov Moscow State University, Vorobyovy Gory, 119991 Moscow (Russian Federation)
2013-02-15
In this work we report on the study of the interaction of CdSe/ZnS-PEGOH 570 Quantum Dot (QD) with negatively charged meso-tetrakis(p-sulfonato-phenyl)porphyrin (TPPS{sub 4}) using optical absorption and fluorescence spectroscopies accompanied with time resolved 'single photon counting' and dynamic and resonance light scattering techniques. In the steady-state experiments the QD luminescence quenching by TPPS{sub 4} was well approximated by a square law. In the time-resolved experiments we observed a typical multi-exponential luminescence decay curve, successfully fitted by a bi-exponential approximation. At QD interaction with porphyrin the time quenching of both components was described by a linear Stern-Volmer dependence. The discrepancy between Stern-Volmer dependences in the steady-state and time resolved experiments may be due to formation of mixed m(TPPS{sub 4})+n(QD) complexes, in which one TPPS{sub 4} molecule can quench several excited QDs. This idea is in accordance with the dynamic and resonance light scattering data, which demonstrate an increase of the scattering particle size at the TPPS{sub 4} addition to QD solutions. - Highlights: Black-Right-Pointing-Pointer Quantum Dot luminescence quenching by TPPS porphyrin was studied in water solutions. Black-Right-Pointing-Pointer The size of particles in QD solutions possessed increase at the TPPS4 addition. Black-Right-Pointing-Pointer Quenching of the QD luminescence by TPPS4 is realized in contact QD-porphyrin complexes. Black-Right-Pointing-Pointer The formation of mixed quantum dot-porphyrin aggregates takes place.
Energy Technology Data Exchange (ETDEWEB)
Gloor, R.
2006-07-01
This final report published by the Swiss Federal Office of Energy (SFOE) presents the results of a study made on so-called intelligent switches that switch an induction motor automatically into star configuration when at low load and, when higher loading returns, back again into the delta configuration. The results of theoretical calculations and measurements made in practice are discussed. The results are presented for various application areas including hydraulics, dynamic converters and standard applications. Also, the use of switches in applications such as wood-cutters, transport systems and stone-crushers are looked at. The results are discussed and the possible risks involved in the use of star-delta switches are looked at. Conclusions are drawn on their use from the economical point of view.
Directory of Open Access Journals (Sweden)
Jan Kulczyk
2014-09-01
Full Text Available Propeller-hull interaction coefficients - the wake fraction and the thrust deduction factor - play significant role in design of propulsion system of a ship. In the case of inland waterway vessels the reliable method of predicting these coefficients in early design stage is missing. Based on the outcomes from model tests and from numerical computations the present authors show that it is difficult to determine uniquely the trends in change of wake fraction and thrust deduction factor resulting from the changes of hull form or operating conditions. Nowadays the resistance and propulsion model tests of inland waterway vessels are carried out rarely because of relatively high costs. On the other hand, the degree of development of computational methods enables’ to estimate the reliable values o interaction coefficients. The computations referred to in the present paper were carried out using the authors’ own software HPSDKS and the commercial software Ansys Fluent.
HTST pasteurization of milk is generally ineffective against spore-forming bacteria such as Bacillus anthracis (BA) but is lethal to its vegetative cells. Crossflow microfiltration (MF), using ceramic membranes with a pore diameter of 1.4 um, has been shown to physically remove somatic cells, vegeta...
2014-09-18
between the 5s electron and the silver nucleus. Breit and Rabi [5] described this hyperfine interaction in the context of the Stern-Gerlach...experiment, and Rabi et al. [6] were the first to directly measure nuclear magnetic moments with this beam technique [7]. 1 quantum angular momentum or spin...interaction matrix can be separated into isotropic and anisotropic parts, A( 14N) → A 1 0 0 0 1 0 0 0 1 + P -2 5 0 0 0 -2 5 0 0 0 4 5
Fluorescence quenching of Rhodamine B base by two amines
Bakkialakshmi, S.; Selvarani, P.; Chenthamarai, S.
2013-03-01
Fluorescence quenching of Rhodamine B base (RhB) in DMF solution has been studied at different concentrations of the amine Triethyl amine (TEA) and n-butyl amine (NBA) at room temperature. It has been observed that the fluorescence intensity of RhB decrease with increase in the concentration of the TEA and NBA. It has been observed that the quenching due to amines proceeds via dynamic quenching process. The rate constants for the quenching process have been calculated using Stern-Volmer equation. Time resolved fluorescence study and 1H NMR spectral study have also been carried out and discussed.
Improved Inference of Heteroscedastic Fixed Effects Models
Directory of Open Access Journals (Sweden)
Afshan Saeed
2016-12-01
Full Text Available Heteroscedasticity is a stern problem that distorts estimation and testing of panel data model (PDM. Arellano (1987 proposed the White (1980 estimator for PDM with heteroscedastic errors but it provides erroneous inference for the data sets including high leverage points. In this paper, our attempt is to improve heteroscedastic consistent covariance matrix estimator (HCCME for panel dataset with high leverage points. To draw robust inference for the PDM, our focus is to improve kernel bootstrap estimators, proposed by Racine and MacKinnon (2007. The Monte Carlo scheme is used for assertion of the results.
Magnetic resonance, especially spin echo, in spinor Bose-Einstein condensates
International Nuclear Information System (INIS)
Yasunaga, Masashi; Tsubota, Makoto
2009-01-01
Magnetic resonance, especially NMR and ESR, has been studied in magnetic materials for a long time, having been used in various fields. Spin echo is typical phenomenon in magnetic resonance. The magnetic resonance should be applied to spinor Bose-Einstein condensates (BECs). We numerically study spin echo of a spinor BEC in a gradient magnetic field by calculating the spin-1 two-dimensional Gross-Pitaevskii equations, obtaining the recovery of the signal of the spins, which is called spin echo. We will discuss the relation between the spin echo and the Stern-Gelrach separation in the system.
Gouy Phase Radial Mode Sorter for Light: Concepts and Experiments
Gu, Xuemei; Krenn, Mario; Erhard, Manuel; Zeilinger, Anton
2018-03-01
We present an in principle lossless sorter for radial modes of light, using accumulated Gouy phases. The experimental setups have been found by a computer algorithm, and can be intuitively understood in a geometric way. Together with the ability to sort angular-momentum modes, we now have access to the complete two-dimensional transverse plane of light. The device can readily be used in multiplexing classical information. On a quantum level, it is an analog of the Stern-Gerlach experiment—significant for the discussion of fundamental concepts in quantum physics. As such, it can be applied in high-dimensional and multiphotonic quantum experiments.
On the therapist's yearning for intimacy.
Yerushalmi, Hanoch
2013-07-01
From the beginning of clinical psychoanalysis, analysts have been at risk of succumbing to yearnings for intimacy and contact that are stirred up by the heat of the analytic encounter. Recently, as theoretical developments have encouraged us to create moments of meeting (Stern et al. 1998) and have urged us to tolerate the feelings stimulated by enactments, these risks have increased. The author points out that foregoing the realization of this yearning within the analytic relationship and the resultant mourning for the loss of a fantasy or illusion carries a heavy personal price tag for the therapist. © 2013 The Psychoanalytic Quarterly, Inc.
Honor Killing: Where Pride Defeats Reason.
Kanchan, Tanuj; Tandon, Abhishek; Krishan, Kewal
2016-12-01
Honor killings are graceless and ferocious murders by chauvinists with an antediluvian mind. These are categorized separately because these killings are committed for the prime reason of satisfying the ego of the people whom the victim trusts and always looks up to for support and protection. It is for this sole reason that honor killings demand strict and stern punishment, not only for the person who committed the murder but also for any person who contributed or was party to the act. A positive change can occur with stricter legislation and changes in the ethos of the society we live in today.
Directory of Open Access Journals (Sweden)
Hind Jabli
2010-01-01
Full Text Available The reaction of 1,5-dibenzyl-3-propargyl-1,5-benzodiazepine-2,4-dione with ethyl azidoacetate in the presence of copper sulfate pentahydrate and sodium ascorbate leads to the formation of the title regioisomer, C30H29N5O4, which features a phenylene ring fused with a seven-membered diazepinyl ring. The latter ring adopts a boat conformation (with the methyltriazolylacetate-bearing C atom as the prow and the fused-ring C atoms as the stern. The benzyl groups connected to the diazepinyl ring jprotrude from the sides; the methyltriazolylacetate substituent occupies an axial position.
Jabli, Hind; Kandri Rodi, Y; Ladeira, Sonia; Essassi, El Mokhtar; Ng, Seik Weng
2009-12-12
The reaction of 1,5-dibenzyl-3-propargyl-1,5-benzodiazepine-2,4-dione with ethyl azido-acetate in the presence of copper sulfate pentahydrate and sodium ascorbate leads to the formation of the title regioisomer, C(30)H(29)N(5)O(4), which features a phenyl-ene ring fused with a seven-membered diazepinyl ring. The latter ring adopts a boat conformation (with the methyl-triazolylacetate-bearing C atom as the prow and the fused-ring C atoms as the stern). The benzyl groups connected to the diazepinyl ring jprotrude from the sides; the methyl-triazolylacetate substituent occupies an axial position.
Surface-plasmon dispersion relation for the inhomogeneous charge-density medium
International Nuclear Information System (INIS)
Harsh, O.K.; Agarwal, B.K.
1989-01-01
The surface-plasmon dispersion relation is derived for the plane-bounded electron gas when there is an inhomogeneous charge-density distribution in the plasma. The hydrodynamical model is used. Both cphi and dcphi/dx are taken to be continuous at the surface of the slab, where cphi is the scalar potential. The dispersion relation is compared with the theoretical works of Stern and Ferrell and of Harsh and Agarwal. It is also compared with the observations of Kunz. A dispersion relation for the volume-plasmon oscillations is derived which resembles the well-known relation of Bohm and Pines
DEFF Research Database (Denmark)
Andersen, Mathias Bækbo; Frey, Jared; Pennathur, Sumita
2011-01-01
, and pK+ are constant and independent of surface composition. Our theoretical model consists of three parts: (i) a chemical equilibrium model of the bare or coated wall, (ii) a chemical equilibrium model of the buffered bulk electrolyte, and (iii) a self-consistent Gouy–Chapman–Stern triple-layer model...... of the electrochemical double layer coupling these two equilibrium models. To validate our model, we used both pH-sensitive dye-based capillary filling experiments as well as electro-osmotic current-monitoring measurements. Using our model we predict the dependence of ζ potential, surface charge density, and capillary...
Gouy Phase Radial Mode Sorter for Light: Concepts and Experiments.
Gu, Xuemei; Krenn, Mario; Erhard, Manuel; Zeilinger, Anton
2018-03-09
We present an in principle lossless sorter for radial modes of light, using accumulated Gouy phases. The experimental setups have been found by a computer algorithm, and can be intuitively understood in a geometric way. Together with the ability to sort angular-momentum modes, we now have access to the complete two-dimensional transverse plane of light. The device can readily be used in multiplexing classical information. On a quantum level, it is an analog of the Stern-Gerlach experiment-significant for the discussion of fundamental concepts in quantum physics. As such, it can be applied in high-dimensional and multiphotonic quantum experiments.
Facteur 4 : le chantier social et politique
Directory of Open Access Journals (Sweden)
Bertrand Zuindeau
2009-06-01
Full Text Available Présentation de l’appel à communicationFace au défi majeur du changement climatique, technologues, modélisateurs et économistes, et non des moindres, ont décrit des réponses possibles. Du GIEC à Lord Stern, du LEPII au CIRED en passant par Mc-Kinsey, la division par quatre ou plus à l’horizon 2050 des émissions dans les pays développés puis dans les pays émergents est décrite comme difficile mais possible. Cependant, l’accent est encore trop peu mis sur les changements d’ordre institutionnel,...
Novel nanostructured materials to develop oxygen-sensitive films for optical sensors
International Nuclear Information System (INIS)
Fernandez-Sanchez, Jorge F.; Cannas, Rita; Spichiger, Stefan; Steiger, Rolf; Spichiger-Keller, Ursula E.
2006-01-01
Novel nanostructured materials, such as aluminum oxide (AlOOH), silicon oxide (SiO 2 ) or zirconium oxide (ZrO 2 ) embedded into PVA, were investigated as potential matrices to incorporate organometallic compounds (OMCs) for the development of optical oxygen-sensitive sensors which make use of the principle of luminescence quenching. In order to assess the benefits and drawbacks of the nanoporous material, the luminescence quantum yield and the Stern-Volmer constants were investigated and compared with the values shown for the same OMCs solubilized in polymer films (polystyrene). Referred to polymer films, the incorporation of the dyes into nanoporous membranes increased the Stern-Volmer constant by more than a factor of 100. Their response time was less than 1 s and the optode membranes were stable at room temperature for at least 9 months. Sterilization by autoclavation and gamma irradiation resulted in a marginal loss in activity. The photostability and sterilizability of the oxygen-sensitive membranes and the performance of the optodes with respect to of different types of metal oxides are discussed in the paper, as well as the influence of the total pore volume (TPV), the pore diameter (PD), the transparency of the film and the geometry of the pores. The OMCs used in this work were: ETH T -3003 (tris(4,7-bis(4-octylphenyl)-1,10-phenanthroline) ruthenium(II)), N-926 (bis(2-phenylpyridinyl)-N 4 ,N 4 ,N 4 ',N 4 '-tetramethyl-(4,4'-diamine-2,2'-bipyridine) iridium(III) chlorate), N-833 (tetrabutylammonium bis(isothiocyanate) bis(2-phenylpyridinyl)-iridium(III)) and N-837 (tetrabutylammonium bis(cyanate) bis(2-phenylpyridinyl)-iridium(III))
How to become a fanatical ecologist
International Nuclear Information System (INIS)
Bato, R.; Suda, P.
2007-01-01
Scientists are discussing the economic impact of global warming on prosperity and the global economy. The last piece in the jigsaw is a report by the team led by Nicholas Stern commissioned by the British government. At the end of last year the report managed to excite the whole world by claiming that the cost related to global warming 'reached and will reach' 5 to 25 percent of global GDP. This estimate exceeds even the most pessimistic previous calculations. Reports similar to this one should bring rational arguments into this global discussion. The author of the report has made a brilliant career as an academic and economist at the World Bank. It is possible to forgive him that he delivered an analysis based on an order from Tony Blair who decided to show his 'environmental' face to the world. We can accept the essays on the fate of the mankind: calls for large scale action, global taxes and megalomaniac projects supported by the state. But all this should have been based on sound economics. The project gives the impression this was the case. It received compliments from top economists such as Nobel Prize winners Joseph Stiglitz, Robert Solow and Amartya Sen. But at the same time it attracted strong criticism, for instance, from renowned economist William Nordhaus. The document of seven hundred pages prepared by the Stern team is an example of inaccurate argumentation surrounded by an academic aura. And so the report that should have supported environmentalist politicians and the general public who wish to protect the environment is possibly more harmful than helpful. (authors)
Determination of the spin polarization of a 4He+ ion beam
International Nuclear Information System (INIS)
Suzuki, T.; Yamauchi, Y.
2008-01-01
It was demonstrated that the spin polarization of a 4 He + ion beam (P He + ) can be determined from the spin dependence of the electron emission in the deexcitation process of spin-polarized He metastable atoms (He*, 2 3 S 1 ) and spin-polarized He + ions on Fe (100) surfaces. On Fe (100) surfaces, both He* and He + deexcite via Auger neutralization, and therefore, the spin asymmetry obtained from spin-polarized He + ion neutralization spectroscopy should be equal to that from spin-polarized metastable He* deexcitation spectroscopy. The spin polarization of He* was obtained from Stern-Gerlach measurements. P He + was finally determined to be 0.19±0.02
Naumova, E. V.; Melnikov, A. G.; Melnikov, G. V.
2013-05-01
Fluorescence and phosphorescence quenching processes of polar and non-polar luminescent probes associated with human serum albumin (HSA) in phosphate buffer at pH 7.4 were studied. Stern-Volmer quenching constants of anthracene and pyrene fluorescence and eosin phosphorescence and rate constants for quenching of eosin triplet states were determined. The polarity index of pyrene bound to HSA was obtained as a function of thallium nitrate concentration. The influences of structural changes in the proteins that were stimulated by heavy-metal salts and of screening of protein charges by salt ions on quenching processes of singlet and triplet states of the probes were found.
[Survival of Bacillus anthracis spores in various tannery baths].
Mendrycka, M; Mierzejewski, J
2000-01-01
The influence of tannery baths: liming, deliming, bating, pickling, tanning, retannage on the survival and on the germination dynamism of B. anthracis spores (Sterne strain) was investigated. The periods and the conditions of this influence were established according to technological process of cow hide tannage. Practically after every bath some part of the spores remained vital. The most effective killing of spores occurred after pickling, liming and deliming. Inversely, the most viable spores remained after bating and retannage process. The lack of correlation that was observed between survival and germination of spores after retannage bath can be explained by different mechanism of spores germination inhibition and their killing.
International Nuclear Information System (INIS)
Bhattar, S.L.; Kolekar, G.B.; Patil, S.R.
2008-01-01
Fluorescence resonance energy transfer (FRET) between perylene and riboflavin is studied in micellar solution of sodium dodecyl sulfate. The fluorescence of perylene is quenched by riboflavin and quenching is in accordance with Stern-Volmer relation. The efficiency of energy transfer is found to depend on the concentration of riboflavin. The value of critical energy transfer distance (R 0 ) calculated by using Foster relation is 32.13 A, and as it is less than 50 A, it indicates efficient energy transfer in the present system. The analytical relation was established between extent of sensitization and concentration of riboflavin, which helped to estimate vitamin B 2 directly from pharmaceutical tablets
Energy Technology Data Exchange (ETDEWEB)
Bhattar, S.L.; Kolekar, G.B. [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur 416 004, Maharashtra (India); Patil, S.R. [Fluorescence Spectroscopy Research Laboratory, Department of Chemistry, Shivaji University, Kolhapur 416 004, Maharashtra (India)], E-mail: srp_fsl@rediffmail.com
2008-03-15
Fluorescence resonance energy transfer (FRET) between perylene and riboflavin is studied in micellar solution of sodium dodecyl sulfate. The fluorescence of perylene is quenched by riboflavin and quenching is in accordance with Stern-Volmer relation. The efficiency of energy transfer is found to depend on the concentration of riboflavin. The value of critical energy transfer distance (R{sub 0}) calculated by using Foster relation is 32.13 A, and as it is less than 50 A, it indicates efficient energy transfer in the present system. The analytical relation was established between extent of sensitization and concentration of riboflavin, which helped to estimate vitamin B{sub 2} directly from pharmaceutical tablets.
Transports and climate change: framework for public action
International Nuclear Information System (INIS)
Bureau, D.
2008-01-01
The author proposes an analysis of instruments to be implemented within the frame of a 'transports and climate change' sector-based plan. This analysis is based on a modelling of this sector, and includes some of the instruments proposed in the Stern report. After a presentation of this analysis framework, the author comments the issue of articulating technological policies and those aiming at the modification of behaviours through the setting of an appropriate price-signal. This aspect is further studied by taking a pre-existing substantial fuel taxing into account. Then the issue of articulation with transport policy is examined for the assessment of infrastructures which would be alternative to roads
Current Status and Future Prospects for Nuclear Power
International Nuclear Information System (INIS)
Juhn, P.E.
1999-01-01
In the past 50 years, nuclear power has grown from a new scientific development to become a major part of the energy mix in over 30 countries. In 1998, 434 power reactors worldwide produced 2294 billion kWh of electricity, slightly up on 1997 output. Sixteen countries relied on nuclear power for 25 percent or more of their electricity. Accumulated operating experience for nuclear power plants reached over 9,000 reactor-years. In 1998, 36 nuclear power plants were under construction: 14 in Eastern Europe, 12 in the Fat East; 7 in the Middle East and South Asia, 2 in Latin America, 1 in stern Europe (France)
Study on zigzag maneuver characteristics of V-U very large crude oil (VLCC) tankers
Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman
2012-06-01
The Department of Marine Technology at the Faculty of Mechanical Engineering, University Teknologi Malaysia has recently developed an Ship Maneuverability tool which intends to upgrade student's level understanding the application of fluid dynamic on interaction between hull, propeller, and rudder during maneuvering. This paper discusses zigzag maneuver for conventional Very Large Crude Oil (VLCC) ships with the same principal dimensions but different stern flame shape. 10/10 zigzag maneuver characteristics of U and V types of VLCC ships are investigated. Simulation results for U-type show a good agreement with the experimental data, but V-type not good agreement with experimental one. Further study on zigzag maneuver characteristics are required.
Images of Freud in Popular Culture and Fiction
DEFF Research Database (Denmark)
Sørensen, Bent
in popular culture, where Sigmund has long had iconic status, both in terms of his own physical likeness and in terms of stereotyped versions of his main ideas. To complement this analysis I shall contrast the popular image of Freud with the use of him in recent fiction by E.L. Doctorow and John Irving.......Historiographic metafiction and postmodern pastiche, both defined by critic Linda Hutcheon as subversive literary and cultural strategies, have put Freud to work both as a clown and a stern cultural critic. My paper will first take a lighthearted look at some of the humorous images we find of Freud...
Quenching of p-Cyanophenylalanine Fluorescence by Various Anions.
Pazos, Ileana M; Roesch, Rachel M; Gai, Feng
2013-03-20
To expand the spectroscopic utility of the non-natural amino acid p -cyanophenylalanine (Phe CN ), we examine the quenching efficiencies of a series of commonly encountered anions toward its fluorescence. We find that iodide exhibits an unusually large Stern-Volmer quenching constant, making it a convenient choice in Phe CN fluorescence quenching studies. Indeed, using the villin headpiece subdomain as a testbed we demonstrate that iodide quenching of Phe CN fluorescence offers a convenient means to reveal protein conformational heterogeneity. Furthermore, we show that the amino group of Phe CN strongly quenches its fluorescence, suggesting that Phe CN could be used as a local pH sensor.
Risk aversion, time preference, and the social cost of carbon
International Nuclear Information System (INIS)
Anthoff, David; Tol, Richard S J; Yohe, Gary W
2009-01-01
The Stern Review reported a social cost of carbon of over $300/tC, calling for ambitious climate policy. We here conduct a systematic sensitivity analysis of this result on two crucial parameters: the rate of pure time preference, and the rate of risk aversion. We show that the social cost of carbon lies anywhere in between 0 and $120 000/tC. However, if we restrict these two parameters to matching observed behaviour, an expected social cost of carbon of $60/tC results. If we correct this estimate for income differences across the world, the social cost of carbon rises to over $200/tC.
Photoinduced electron transfer between the dendritic zinc phthalocyanines and anthraquinone
Chen, Kuizhi; Wen, Junri; Liu, Jiangsheng; Chen, Zhenzhen; Pan, Sujuan; Huang, Zheng; Peng, Yiru
2015-03-01
The intermolecular electron transfer between the novel dendritic zinc (II) phthalocyanines (G1-DPcB and G2-DPcB) and anthraquinone (AQ) was studied by steady-state fluorescence and UV/Vis absorption spectroscopic methods. The effect of dendron generation on intermolecular electron transfer was investigated. The results showed that the fluorescence emission of these dendritic phthalocyanines could be greatly quenched by AQ upon excitation at 610 nm. The Stern- Volmer constant (KSV) of electron transfer was decreased with increasing the dendron generations. Our study suggested that these novel dendritic phthalocyanines were effective new electron donors and transmission complexes and could be used as a potential artifical photosysthesis system.
DEFF Research Database (Denmark)
Revil, A.; Coperey, A.; Shao, Z.
2017-01-01
The complex conductivity of soil remains poorly known despite the growing importance of this method in hyrogeophysics. In order to fill this gap of knowledge, we investigate the complex conductivity of 71 soils samples (including 4 peat samples) and one clean sand in the frequency range 0.1 Hertz...... to 45 kHz. The soil samples are saturated with 6 different NaCl brines with conductivities (0.031, 0.53, 1.15, 5.7, 14.7, and 22 S m-1, NaCl, 25°C) in order to determine their intrinsic formation factor and surface conductivity. This dataset is used to test the predictions of the dynamic Stern...
Structural modifications of vesicular aggregates following gamma-irradiation
International Nuclear Information System (INIS)
Mantaka-Marketou, A.E.; Domasou, A.S.
1991-01-01
The structural changes of the didodecyldimethylammonium bromide (DDAB) vesicular bilayers after γ-irradiation and under conditions where mainly OH radicals are present are reported. Alterations of the vesicular structure, such as polarity and fluidity, were detected after a dose of 0.65 kGy. A higher dose of ∼14kGy cause important damage to the well organized molecular structure and this is manifested by an important augmentation of the fluidity and polarity of the Stern region of the aggregates. Increased water penetration into the bilayer of the vesicle is probably the reason for these changes and electron micrographs support this hypothesis. (author)
DEFF Research Database (Denmark)
Holck, Ulla
continues with practices on basic improvisational techniques related to time, form and emotions: synchronization, turn-taking, theme-with-variations, matching/attunement, vitality forms, simple musical playing rules, etc. The techniques are connected to macro- and micro-regulation of arousal and emotions......). Turn-taking in music therapy with children with communication disorders. British Journal of Music Therapy, 18(2), 45-53. Malloch, S. & Trevarthen, C. (Eds) (2009). Communicative Musicality. Exploring the basis of human companionship. Oxford: Oxford University Press. Stern, D. N. (2010). Forms...... of Vitality. Oxford: Oxford University Press. Wigram, T. (2004). Improvisation. Methods and Techniques for Music Therapy Clinicians, Educators and Students. London: Jessica Kingsley Publishers....
Atomic Pioneers Book 3 From the Late 19th to the Mid-20th Century
Energy Technology Data Exchange (ETDEWEB)
Hiebert, Ray [University of Maryland; Hiebert, Roselyn
1973-01-01
This book tells the story of the atom by presenting a brief account of the lives and work of 24 atomic scientists who brought the world into the complex Age of the Atom by mid-20th century. The 24 are: Albert Einstein, James Franck, Max Born, Peter J.W. Debye, Niels Bohr, George von Hevesy, Henry G.J. Moseley, Gustav Hertz, Erwin Schrodinger, Otto Stern, James Chadwick, Arthur H. Compton, Louis Victor de Broglie, Harold C. Urey, John D. Cockcroft, Patrick M.S. Blackett, Isidor I. Rabi, Leo Szilard, Jean Frederic Joliot-Curie, Irene Joliot-Curie, Wolfgang Pauli, Ernest O. Lawrence, Enrico Fermi, and Robert J. Van de Graaff.
Energy Technology Data Exchange (ETDEWEB)
Duffa, C.; Charmasson, S. [IRSN/PRP-ENV/SESURE/LERCM - Antenne de Radioecologie Marine, Centre Ifremer, Zone portuaire de Bregaillon, 13507 La Seyne sur Mer (France); Bailly du Bois, P.; Fievet, B. [IRSN/PRP-ENV/SERIS/LRC (France); Couvez, C.; Renaud, P. [IRSN/PRP-ENV/SESURE/DIR (France); Didier, D. [IRSN/PRP-CRI/SESUC/BMTA (France)
2014-07-01
The Fukushima nuclear accident led to the most important accidental release of artificial radionuclides into the sea. This accident has underlined the importance of being able to adequately reproduce the fate of radioactive releases and to estimate their consequences for the marine environment. For its Crisis Centre, the French Institute for Radioprotection and Nuclear Safety (IRSN) has operational tools, in order to help experts and decision makers in case of any atmospheric accidental release and terrestrial environment contamination. The on-going project aims to develop tools to manage any marine contamination of the French coastal areas. We should be able to evaluate and anticipate the marine post-accidental situation: contaminated areas localization and contamination levels, and possible consequences. Many sites has be considered as potential source terms into the sea: the Coastal Nuclear Power Plants, the La Hague reprocessing Plant, the Brest and Toulon Military Harbours as home-ports of nuclear powered vessels, and different river mouths (Rhone River, Gironde, Loire, Seine) that could be contaminated by upstream accidental release. To achieve this goal, two complementary approaches are developed: Marine sheets and a dedicated modelling tool (STERNE). - Marine sheets aim to summarize marine environment characteristics for the different sites, identify potential stakes for human protection such as aquaculture areas, beaches, or industrial water intakes, and ecological stakes. Whenever possible, a local climatology (main currents depending on meteorological or tide conditions) that could be a support to first environmental measurement strategy is proposed. A list of available local contacts for any operational management is also provided. - The modelling tool, STERNE (Simulation du Transport et du transfert d'Elements Radioactifs dans l'environNEment marin), must predict radionuclide dispersion and contamination of water, marine species and sediments
International Nuclear Information System (INIS)
Stern, Charles R
2001-01-01
Continental crust may be incorporated in mantle-derived Andean magmas as these magmas rise through the crust (Hildreth and Moorbath, 1988), or alternatively, crust may be tectonically transported into the mantle by subduction of trench sediments and subduction erosion of the continental margin, and then added into the mantle source region of Andean magmas (Stern, 1991). Since the mantle has relatively low Sr, Nd, and Pb concentrations compared to continental crust, differences in the isotopic compositions of magmas erupted in different region of the Andes may be produced by relatively small differences in the amount of subducted crust added to the mantle source region of these magmas. By comparison, significantly larger amounts of crust must be assimilated by mantle-derived magmas to produce isotopic differences of similar magnitude. Therefore, constraining the process by which continental crust is incorporated in Andean magmas has important implications for understanding the chemical cycling that takes place in the Andean subduction-related magma factory. Isotopic data suggest the incorporation of a greater proportion of crust in Andean magmas erupted at the northern portion of the Southern Volcanic Zone of central Chile compared to those erupted in the southern portion of the Southern Volcanic Zone of south central Chile (SSVZ) (Stern et al., 1984; Futa and Stern, 1988; Hildreth and Moorbath, 1988). The NSVZ occurs just south of the current locus of the subduction of the Juan Fernandez Ridge. The southward migration of the locus of subduction of this ridge has resulted in decreasing subduction angle below the NSVZ, the eastward migration of the volcanic front of the Andean arc, and an increase in the crustal thickness below the arc. These factors together have caused changes, since the middle Miocene, in the isotopic composition of Andean igneous rocks of central Chile. The data indicate a close chronologic relation between the southward migrations of the locus
International Nuclear Information System (INIS)
Eastman, T.; Sheldon, R.; Hamilton, D.; Mcilwain, C.
1992-03-01
Although many properties of the Earth's magnetosphere have been measured and quantified in the past 30 years since it was discovered, one fundamental (for a zeroeth order magnetohydrodynamic (MHD) equilibrium) measurement was made infrequently and with poor spatial coverage: the global electric field. This oversight is in part due to the difficulty of measuring a plasma electric field, and in part due to the difficulty of measuring a plasma electric field, and in part due to the neglect of theorists. However, there is renewed interest in the convection electric field, since it has been realized that it is vital for understanding many aspects of the magnetosphere: the global MHD equilibrium, reconnection rates, Region 2 Birkeland currents, magnetosphere-ionosphere coupling, ring current and radiation belt transport, substorm injections, acceleration mechanisms, etc. Unfortunately the standard experimental methods have not been able to synthesize a global field (excepting the pioneering work of McIlwain's geostationary models), and we are left with an overly simplistic theoretical field, the Volland-Stern electric field mode. Again, single point measurements of the plasma pause were used to infer the appropriate amplitudes of the model, parameterized by Kp (Maynard and Chen, JGR 1975). Although this result was never intended to be the definitive electric field model, it has gone nearly unchanged for 15 years. However, the data sets being taken today require a great deal more accuracy than can be provided by the Volland-Stern model. Nor has the variability of the electric field shielding been properly addressed, although effects of penetrating magnetospheric electric fields has been seen in mid- and low-latitude ionospheric data sets. The growing interests in substorm dynamics also requires a much better assessment of the electric fields responsible for particle injections
Plaut, Roger D; Beaber, John W; Zemansky, Jason; Kaur, Ajinder P; George, Matroner; Biswas, Biswajit; Henry, Matthew; Bishop-Lilly, Kimberly A; Mokashi, Vishwesh; Hannah, Ryan M; Pope, Robert K; Read, Timothy D; Stibitz, Scott; Calendar, Richard; Sozhamannan, Shanmuga
2014-03-01
In order to better characterize the Bacillus anthracis typing phage AP50c, we designed a genetic screen to identify its bacterial receptor. Insertions of the transposon mariner or targeted deletions of the structural gene for the S-layer protein Sap and the sporulation genes spo0A, spo0B, and spo0F in B. anthracis Sterne resulted in phage resistance with concomitant defects in phage adsorption and infectivity. Electron microscopy of bacteria incubated with AP50c revealed phage particles associated with the surface of bacilli of the Sterne strain but not with the surfaces of Δsap, Δspo0A, Δspo0B, or Δspo0F mutants. The amount of Sap in the S layer of each of the spo0 mutant strains was substantially reduced compared to that of the parent strain, and incubation of AP50c with purified recombinant Sap led to a substantial reduction in phage activity. Phylogenetic analysis based on whole-genome sequences of B. cereus sensu lato strains revealed several closely related B. cereus and B. thuringiensis strains that carry sap genes with very high similarities to the sap gene of B. anthracis. Complementation of the Δsap mutant in trans with the wild-type B. anthracis sap or the sap gene from either of two different B. cereus strains that are sensitive to AP50c infection restored phage sensitivity, and electron microscopy confirmed attachment of phage particles to the surface of each of the complemented strains. Based on these data, we postulate that Sap is involved in AP50c infectivity, most likely acting as the phage receptor, and that the spo0 genes may regulate synthesis of Sap and/or formation of the S layer.
PRIMUS: INFRARED AND X-RAY AGN SELECTION TECHNIQUES AT 0.2 < z < 1.2
Energy Technology Data Exchange (ETDEWEB)
Mendez, Alexander J.; Coil, Alison L.; Aird, James; Diamond-Stanic, Aleksandar M. [Center for Astrophysics and Space Sciences, Department of Physics, University of California, 9500 Gilman Dr., La Jolla, San Diego, CA 92093 (United States); Moustakas, John [Department of Physics and Astronomy, Siena College, 515 Loudon Road, Loudonville, NY 12211 (United States); Blanton, Michael R. [Center for Cosmology and Particle Physics, Department of Physics, New York University, 4 Washington Place, New York, NY 10003 (United States); Cool, Richard J. [Observatories of the Carnegie Institution for Science, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Eisenstein, Daniel J. [Harvard College Observatory, 60 Garden St., Cambridge, MA 02138 (United States); Wong, Kenneth C. [Steward Observatory, University of Arizona, 933 N. Cherry Ave., Tucson, AZ 85721 (United States); Zhu Guangtun [Department of Physics and Astronomy, Johns Hopkins University, 3400 N. Charles Street, Baltimore, MD 21218 (United States)
2013-06-10
We present a study of Spitzer/IRAC and X-ray active galactic nucleus (AGN) selection techniques in order to quantify the overlap, uniqueness, contamination, and completeness of each. We investigate how the overlap and possible contamination of the samples depend on the depth of both the IR and X-ray data. We use Spitzer/IRAC imaging, Chandra and XMM-Newton X-ray imaging, and spectroscopic redshifts from the PRism MUlti-object Survey to construct galaxy and AGN samples at 0.2 < z < 1.2 over 8 deg{sup 2}. We construct samples over a wide range of IRAC flux limits (SWIRE to GOODS depth) and X-ray flux limits (10 ks to 2 Ms). We compare IR-AGN samples defined using both the IRAC color selection of Stern et al. and Donley et al. with X-ray-detected AGN samples. For roughly similar depth IR and X-ray surveys, we find that {approx}75% of IR-selected AGNs are also identified as X-ray AGNs. This fraction increases to {approx}90% when comparing against the deepest X-ray data, indicating that at most {approx}10% of IR-selected AGNs may be heavily obscured. The IR-AGN selection proposed by Stern et al. suffers from contamination by star-forming galaxies at various redshifts when using deeper IR data, though the selection technique works well for shallow IR data. While similar overall, the IR-AGN samples preferentially contain more luminous AGNs, while the X-ray AGN samples identify a wider range of AGN accretion rates including low specific accretion rate AGNs, where the host galaxy light dominates at IR wavelengths. The host galaxy populations of the IR and X-ray AGN samples have similar rest-frame colors and stellar masses; both selections identify AGNs in blue, star-forming and red, quiescent galaxies.
Magnetism of iron, cobalt and nickel clusters studied in molecular beams
International Nuclear Information System (INIS)
Billas, I.
1995-01-01
The magnetic properties of iron, cobalt and nickel clusters in a molecular beam have been studied in a magnetic Stern-Gerlach deflection experiment. The molecular beam apparatus consists of a laser vaporization cluster source with high intensity and stability and a high-resolution time-of-flight mass spectrometer for the deflection measurements. Several novel experimental features have been developed in this work, like a nozzle which can be heated up to 1000 K and a chopper to measure the dwell times of the clusters in the source and their corresponding velocities. These new developments have allowed the measurement and the control of the temperature of the free clusters. The Stern-Gerlach deflection experiments have been performed on Fe, Co and Ni clusters in the mass range from 20 to 700 atoms. All clusters show single-sided deflection toward increasing field. This observation indicates that a spin relaxation process occurs within the isolated clusters. The participation of both the cluster rotational and vibrational degrees of freedom to the spin relaxation has been experimentally demonstrated. The cluster magnetization has been determined as a function of applied magnetic field B and as a function of dwell times of the clusters in the source before the supersonic expansion into vacuum. Superparamagnetic behavior has been observed when the cluster rotational speed is much larger than the Larmor frequency of the cluster magnetic moment μ in the field B. In particular, for μB<< kT, the cluster magnetization depends on B/T. For lower rotational speeds, reduced values of the magnetization have been observed. The magnetic moments of the superparamagnetic Fe, Co and Ni clusters have been measured as a) a function of cluster size N at low temperature and b) as a function of cluster temperature T for various size ranges. (author) figs., tabs., refs
Arsenite adsorption on goethite at elevated temperatures
International Nuclear Information System (INIS)
Kersten, Michael; Vlasova, Nataliya
2009-01-01
Experimental closed-system ΔT acid-base titrations between 10 deg. C and 75 deg. C were used to constrain a temperature-dependent 1-pK basic Stern model of the goethite surface complexation reactions. Experimental data for the temperature dependence of pH PZC determined by the one-term Van't Hoff extrapolation yield a value for goethite surface protonation enthalpy of -49.6 kJ mol -1 in good agreement with literature data. Batch titration data between 10 deg. C and 75 deg. C with arsenite concentrations between 10 μM and 100 μM yield adsorption curves, which increases with pH, peak at a pH of 9, and decrease at higher pH values. The slope of this bend becomes steeper with increasing temperature. A 1-pK charge distribution model in combination with a basic Stern layer option could be established for the pH-dependent arsenite adsorption. Formation of two inner-sphere bidentate surface complexes best matched the experimental data in agreement with published EXAFS spectroscopic information. The temperature behaviour of the thus derived intrinsic equilibrium constants can be well represented by the linear Van't Hoff logK T int vs. 1/T plot. Adsorption of arsenite on the goethite surface is exothermic (negative Δ r H 298 values) and therefore becomes weaker with increasing temperature. Application of the new constants with the aqueous speciation code VMINTEQ predicts that the As(III) concentration in presence of goethite sorbent decreases by 10 times once the hydrothermal solution is cooled from 99 deg. C to 1 deg. C. The model curve matches data from a natural thermal water spring system. The increase of adsorption efficiency for As along the temperature gradient may well serve as an additional process to prevent ecosystem contamination by As-rich water seepage from geothermal energy generation facilities
Geometrical charged-particle optics. 2. ed.
International Nuclear Information System (INIS)
Rose, Harald
2013-01-01
Provides a unique theoretical treatment of charged-particle optics. Displays novel unpublished results on several topics. Provides insight into the properties of charged-particle devices. Treats wave optical properties of the electron. Presents the resolution limit of electron microscopes and novel theoretical treatment of the Stern-Gerlach effect. This second edition is an extended version of the first edition of Geometrical Charged-Particle Optics. The updated reference monograph is intended as a guide for researchers and graduate students who are seeking a comprehensive treatment of the design of instruments and beam-guiding systems of charged particles and their propagation in electromagnetic fields. Wave aspects are included in this edition for explaining electron holography, the Aharanov-Bohm effect and the resolution of electron microscopes limited by diffraction. Several methods for calculating the electromagnetic field are presented and procedures are outlined for calculating the properties of systems with arbitrarily curved axis. Detailed methods are presented for designing and optimizing special components such as aberration correctors, spectrometers, energy filters monochromators, ion traps, electron mirrors and cathode lenses. In particular, the optics of rotationally symmetric lenses, quadrupoles, and systems composed of these elements are discussed extensively. Beam properties such as emittance, brightness, transmissivity and the formation of caustics are outlined. Relativistic motion and spin precession of the electron are treated in a covariant way by introducing the Lorentz-invariant universal time and by extending Hamilton's principle from three to four spatial dimensions where the laboratory time is considered as the fourth pseudo-spatial coordinate. Using this procedure and introducing the self action of the electron, its accompanying electromagnetic field and its radiation field are calculated for arbitrary motion. In addition, the Stern
Effects of tidal distortion on binary-star velocity curves and ellipsoidal variation
International Nuclear Information System (INIS)
Wilson, R.E.; Sofia, S.
1976-01-01
Radial velocity curves for the more massive components of binaries with extreme mass ratios can show a large distortion due to tides, as first recognized by Sterne. Binaries in which the effect is large should be rare because nearly all such binaries would be in the rapid phase of mass transfer. However, the optical counterparts of some X-ray binaries may show the effect, which would then serve as a new means of extracting considerable information from the observations. The essential parts of the computational procedure are given. Light curves for ellipsoidal variables with extreme mass ratios were also computed, and were found to be less sinusoidal than those with normal mass ratios
Energy Technology Data Exchange (ETDEWEB)
Piepel, Gregory F. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hutchison, Janine R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2014-12-05
This report describes the experimental design for a laboratory study to quantify the recovery efficiencies and false negative rates of a validated, macrofoam-swab sampling method for low concentrations of Bacillus anthracis Sterne (BAS) and Bacillus atrophaeus (BG) spores on four surface materials (stainless steel, glass, vinyl tile, plastic light cover panel). Two analytical methods (culture and polymerase chain reaction) will be used. Only one previous study has investigated how the false negative rate depends on test factors. The surrogates BAS and BG have not been tested together in the same study previously. Hence, this study will provide for completing gaps in the available information on the performance of macrofoam-swab sampling at low concentrations.
Investigation of a method for predicting AUV derivatives
Digital Repository Service at National Institute of Oceanography (India)
Barros, E.A. de; Pascoal, A.; Desa, E.S.
by Hoerner (1985) for streamlined shapes at low Reynolds numbers, the foil drag coefficient is computed as ðC D 0 Þ F ¼ 2C f t c C18C19 C01 þ 2C f þ t c "# S fðFÞ L 2 , (17) where t is the foil maximum thickness, c is the corresponding chord, and S f... in this case (0.168m). Fig. 8 shows a series of plots of the performance index versus the total span for three different locations of the stern plane. The highest curve (x 0 W ¼C00.266) corresponds to the location furthest way from the vehicle centre of mass...
A photochemical study of uranyl ion interaction with the Triton X-100 micellar system
International Nuclear Information System (INIS)
Das, S.K.; Ganguly, B.N.
1996-01-01
This is a report on the spectroscopic characteristics of UO 2 2+ in the excited state in Triton X-100 micellar medium. It also indicates some important results of viscosity and surface tension measurements of the system which have direct relevance to the spectroscopic investigation in the excited state. The quenching of the UO 2 2+ fluorescence due to Triton X-100, upon micellization in the aqueous medium, reveals two kinds of microenvironments of the fluorophore from the Stern-Volmer plot. This has been verified by flash photolytic measurements. A blue shift of the quenched emission spectrum is ascribed to the collisional encounter of UO 2 1 + with the head groups of Triton X-100
Economic value added or earnings: What explains market value in Indian firms?
Directory of Open Access Journals (Sweden)
Nufazil Altaf
2016-12-01
Full Text Available The purpose of this paper is to empirically test the claim made by Stern Stewart & Company that economic value added is a better metric that traditional earning based measures in explaining market value. For better exposition, a sample of 325 Indian firms has been divided into two parts- 170 firms belonging to Indian manufacturing companies and 155 companies belonging to the Indian service sector. After performing univariate and multivariate regression analyses, the results of the study reveal that the operating income has a strong linkage with market value added in both manufacturing and service sectors. For both the sectors, the economic value added shows weaker but positive relationship with the market value added.
Resolution of the EPR Paradox for Fermion Spin Correlations
Close, Robert
2011-10-01
The EPR paradox addresses the question of whether a physical system can have a definite state independent of its measurement. Bell's Theorem places limits on correlations between local measurements of particles whose properties are established prior to measurement. Experimental violation of Bell's theorem has been regarded as evidence against the existence of a definite state prior to measurement. We model fermions as having a spatial distribution of spin values, so that a Stern-Gerlach device samples the spin distribution differently at different orientations. The computed correlations agree with quantum mechanical predictions and experimental observations. Bell's Theorem is not applicable because for any sampling of angles, different points on the sphere have different density of states.
Banjare, Manoj Kumar; Behera, Kamalakanta; Satnami, Manmohan L.; Pandey, Siddharth; Ghosh, Kallol K.
2017-12-01
Host-guest complexation between ionic liquid (IL) 1-butyl-3-methylimidazolium octylsulphate [Bmim][OS] and cyclodextrins (α- and β- CDs) have been studied. Surface tension, conductivity measurements revealed the formation of 1:1 (M) stoichiometry for inclusion complexes (ICs) and further confirmed by UV-Visible and FT-IR results. The nature of the complexes has been established using interfacial and thermodynamic parameters. The aggregation number, Stern-Volmer constants, association constants were obtained from fluorescence quenching and Benesi-Hildebrand methods. The critical micelle concentration (cmc) and association constants of [Bmim][OS] are higher for β-CD as compared to α-CD. FT-IR spectra indicated that CDs and [Bmim][OS] could from ICs with stoichiometry 1:1 (M).
Energy Technology Data Exchange (ETDEWEB)
Piepel, Gregory F.; Hutchison, Janine R.
2014-04-16
This report describes the experimental design for a laboratory study to quantify the recovery efficiencies and false negative rates of a validated, macrofoam swab sampling method for low concentrations of Bacillus anthracis Sterne (BAS) and Bacillus atrophaeus (BG) spores on four surface materials (stainless steel, glass, vinyl tile, plastic light cover panel). Two analytical methods (plating/counting and polymerase chain reaction) will be used. Only one previous study has investigated false negative as a function of affecting test factors. The surrogates BAS and BG have not been tested together in the same study previously. Hence, this study will provide for completing gaps in the available information on the performance of macrofoam swab sampling at low concentrations.
Effect of Nitrite Ions on Steel Corrosion Induced by Chloride or Sulfate Ions
Directory of Open Access Journals (Sweden)
Zhonglu Cao
2013-01-01
Full Text Available The influence of nitrite concentration on the corrosion of steel immersed in three simulated pH environments containing chloride ions or sulfate ions has been investigated by comparing and analyzing the change of half-cell potential, the change of threshold level of Cl- or SO42-, the change of threshold level of NO2-/Cl- or NO2-/SO42- mole ratio, and the changes of anodic/cathodic polarization curves and Stern-Geary constant B. The corrosivity of chloride ions against sulfate ions also has been discussed in pH 12.6, pH 10.3, and pH 8.1 environments containing 0, 0.053, and 0.2 mol/L NO2, respectively.
Kuusk, Priit, 1938-
2001-01-01
New Yorgi FO ja Metropolitan Opera hooaja algusest. Festivalist "Internationales Beethovenfest" 21. sept.-9. okt. Bonnis. Jaapani kunstipreemia "Praemium Imperiale" pälvis teiste seas ka O. Coleman. Lühidalt I. Sternist
International Nuclear Information System (INIS)
Ryu, Eui-Seung; You, Sung-Chang
2014-01-01
As pressure tube diameter creep increase, the coolant flows through some of the interior subchannels of the fuel bundle are reduced and consequently reduces the Critical Heat Flux (CHF). For this reason, Canadian Utilities have performed the project that developing the new fuel design (modified 37-element bundle) to increase critical heat flux. The modified 37-element (37M) bundle has the same overall geometry as the reference 37-element (37R) bundle that is using in the Wolsong units now but the center element diameter has been reduced from 13.06mm to 11.5mm. The reduction in center element diameter of the 37M bundle design increase the flow of center areas to improve the cooling and thus to enhance CHF. The CHF experiments with 37M bundle string simulator in un-crept and crept (3.3%, 5.1% peak creep) flow channels were completed at Stern Laboratories in 2008. A substantially large increase in dryout-power was observed for the 37M bundle compared to the 37R bundle, particularly in the 5.1% crept channel. As a result of the experiments, Ontario Power Generation (OPG) and Bruce Power (BP) have increased the operational margin with this CHF correlation and has fully refueled the 37M fuel on some units or almost done on the other units. KHNP also has performed the project to refuel the 37M bundle which is the same design with OPG and BP recently. This paper summarizes the comparison assessment of Thermalhydraulic (T/H) behavior for 37M bundle and 37R bundle with their own correlations and geometry parameters. This analysis performed with the thermal hydraulic code (NUCIRC) and the site measured data at the Wolsong Unit2. Tests to evaluate the CHF performance with the 37M fuel bundle have been conducted in 2008 using the un-crept, 3.3% crept and 5.1% crept flow channels in the CHF Test facility at Stern Laboratories. In addition pressure drop tests have been performed at the same time. The changes of geometry from 37R bundle to 37M bundle reduced the center element
International Nuclear Information System (INIS)
Rabbia, O.M.; Hernandez, L.B.; King, R.W.; Lopez Escobar, L
2001-01-01
The giant El Teniente porphyry Cu-Mo deposit is located in the Andes foothills of Central Chile (34 o S). In simplistic terms, the igneous rocks at the mine can be grouped in two major units: a felsic suite of silicic intrusives (the porphyries; SiO 2 ≥56wt%) with subvertical stock-like to dyke shapes, and a mafic volcanic to subvolcanic sequence (the Farellones formation; SiO 2 <≤56wt%) with a sub-horizontal nature. The felsic rocks intrude the volcanogenic Farellones formation, which is known at the mine site as 'Andesitas de la mina'. The major felsic intrusives are locally known as the 'Diorita Sewell' and 'Porfido Teniente' bodies, plus a series of minor plugs, apophyses and dikes. According to Cuadra (1986), the age of the main intrusive units spans from Late Miocene ('Diorita Sewell'; 7-8Ma) to Early Pliocene ('Porfido Teniente'; ∼4-5Ma). These felsic intrusives are closely related to copper mineralization ( ∼4-5Ma; Cuadra, 1986), particularly the younger 'Porfido Teniente' (Camus, 1975). Additionally, Skewes and Stern (1996) have suggested the existence of an even slightly younger porphyry pluton, not exposed at surface, but still linked to the ore genesis. Similar felsic intrusive bodies are also present in the Laguna La Huifa area (Reich, 2001), located less than 3 km to the NE from the main El Teniente body. The copper mineralization here, is interpreted to be almost contemporaneous with the El Teniente mineralization (Cuadra, 1986). Based on petrographic and geochemical information on the silicic intrusive suite, Rabbia et al. (2000) suggested that this magmatism could be considered as a Phanerozoic equivalent of an Archean high-Al TTG. Furthermore it may be classified as a modified (Na-rich) 'I' type granitoid, in the sense of Atherton and Petford (1993) and Petford and Atherton (1996). According to these authors, the younger (and hotter) lower Andean crust would be a better candidate than the older (and colder) subducted Nazca plate basalts
International Nuclear Information System (INIS)
Wall, R.M.; Lara, L.E.; Perez de Arce, C
2001-01-01
The Pudahuel Ignimbrite (Wall et al., 1996) is a characteristic pyroclastic flow deposit placed in the Central Depression, within the Maipo, Mapocho and Cachapoal valleys and, in the eastern side of the Andes, at Yaucha and Papagayos rivers as well (Harrington, 1989; Guerstein, 1993). Close to Santiago, Pudahuel Ignimbrite reaches 40 m in thickness (Dragicevic, 1962) which decreces up to 5 m 60 km to the west. The deposit is compounded by ash and lapilli size pumice within a cineritic matrix with shards, crystals and pumice fragments. Facies of both, laminar and turbulent flow regime can be distinguished, the latter prevailing near topographic barriers and on river plain floors. There, traction structures like cross-bedding and important amount of litic clasts are characteristic. Pumices are rhyolitic in composition (ca. 75% SiO 2 ; Stern et al., 1984; Guerstein, 1993) and have few 0.5-2 mm long biotite crystals. Two 40 Ar/ 39 Ar step-heating experiments on biotite from pumices of two localities, Maipu (Santiago) and Bollenar (Melipilla), show plateau ages of 2.3±0.3 Ma (RW-371) and 2.2±0.3 Ma (RW-1009). In both cases, the first step of the experiment indicates loss of Ar from the cristal rims wich was removed for the plateau calculus only in the second case. For the RW-371 sample an inverse isocrone age of 1.4±0.8 Ma (MSWD: 0.98) was obtained. Previously, the Pudahuel Ignimbrite was dated by Stern et al. (1984) in ca. 450 ka using zircon fission-tracks. Although inconsistent with our new ages, these pleistocene age seemed coherent with the discovery of an Antifer (deer) bone by Tavera (1978) within the ignimbrite close to Santiago. Nevertheless, as was apointed by Tavera (1978) himself, the Antifer genus is recognized in Argentina in the Pliocene-Quaternary interval and make possible a review of the well known 'pleistocene' mammal vertebrate associations in Chile. Another consequence of the new possible pliocene ages is that, since the ignimbrite does not show
Directory of Open Access Journals (Sweden)
Posada D. Adolfo
1986-09-01
Full Text Available The behavior and agricultural characteristics of two kinds of Chrysanthemum (White Marble and Yellow Polaris were evaluated in terms of yield and quality of the product. Two different kinds of planting systems were applied (single stem and pinched stem. The experimental design in randomized whole blocks for each variety and system including four density treatments (80, 90, 110 and 115 sterns per 1.05 m2 was repeated six times. The experimental unit was of 2.10 m2; 1.26 m2 were harvested. A strong discrepancy between the quantity and quality of the product was observed. The highest yields were obtained with densities of 110 and 115 stems per 1.05 m2. However, the experimental units dis not always met both requirements of a diameter greater than seven cm and three or more marketable flowers per stem. If maximizing production of acceptable bunches is taken as a decision variable, a density of 90 sterns per 1.05 m2 with a 3/3/2/2/2/3/3 arrangement with pinched stern for Yellow Polar is seems a better alternative. As for White Marble, it would be better to have 80 stems per 1.05 m2 with a 3/2/2/2/2/2/3 arrangement in the single stem, but the probability of acceptance is only 0.666. In addition, White Marble showed more susceptibility to dwarfism.Se evaluó el comportamiento y características agronómicas asociadas con el rendimiento y la calidad del producto en las variedades White Marble y Yellow Polaris, en los sistemas de tallo único y tallo despuntado. El diseño experimental de bloques completos al azar para cada variedad y sistema incluía cuatro tratamientos de densidad (80, 90, 110 Y 115 tallos por 1.05 m2, con seis repeticiones. La unidad experimental fue de 2.10 m2, cosechando 1. 26m2(1.05 x 1.20. Se observó marcado antagonismo entre la cantidad y la calidad del producto comercial. Los mayores rendimientos se obtuvieron con densidades de 110 y 115 tallos por 1.05 m2, pero no siempre la producción cumplía con los requisitos de di
Ekphrasis as a protagonist of parody - on some poems of Olgerd Dziechciarz
Directory of Open Access Journals (Sweden)
Aneta Grodecka
2009-01-01
Full Text Available The appearance of the parody of poetic ekphrasis is an important argument in disputes concerning its status. The author considers Olgerd Dziechciarz's collection of poems Galeria "Humbug" [The "Humbug" Gallery] as a missing link of reconstruction of the genre, referring to her own studies conducted as a post-graduate work Wiersze o obrazach. Studium z dziejów ekfrazy [Poems on pictures. A study in the history of ekphrasis] (in preparation. In the course of the analysis the author referred to paintings (H. Bosch, P. Cezanne, Michelangelo, other poetic commentaries of C. Miłosz, A. Stern as well as studies on art (among others D. Freedberg, F. Arnau, considering mainly the problems connected with the reception of pictures.
A Geometrical Approach to Bell's Theorem
Rubincam, David Parry
2000-01-01
Bell's theorem can be proved through simple geometrical reasoning, without the need for the Psi function, probability distributions, or calculus. The proof is based on N. David Mermin's explication of the Einstein-Podolsky-Rosen-Bohm experiment, which involves Stern-Gerlach detectors which flash red or green lights when detecting spin-up or spin-down. The statistics of local hidden variable theories for this experiment can be arranged in colored strips from which simple inequalities can be deduced. These inequalities lead to a demonstration of Bell's theorem. Moreover, all local hidden variable theories can be graphed in such a way as to enclose their statistics in a pyramid, with the quantum-mechanical result lying a finite distance beneath the base of the pyramid.
Measurement of flows around modern commercial ship models
Kim, W. J.; Van, S. H.; Kim, D. H.
To document the details of flow characteristics around modern commercial ships, global force, wave pattern, and local mean velocity components were measured in the towing tank. Three modern commercial hull models of a container ship (KRISO container ship = KCS) and of two very large crude-oil carriers (VLCCs) with the same forebody and slightly different afterbody (KVLCC and KVLCC2) having bow and stern bulbs were selected for the test. Uncertainty analysis was performed for the measured data using the procedure recommended by the ITTC. Obtained experimental data will provide a good opportunity to explore integrated flow phenomena around practical hull forms of today. Those can be also used as the validation data for the computational fluid dynamics (CFD) code of both inviscid and viscous flow calculations.
Chemiluminescence of curcumin and quenching effect of dimethyl sulfoxide on its peroxyoxalate system
Energy Technology Data Exchange (ETDEWEB)
Yari, Abdollah, E-mail: a.yari@ymail.co [Lorestan University, Department of Chemistry, Flakalaflak Street, 68178-17133 Khorramabad (Iran, Islamic Republic of); Saidikhah, Marzieh [Lorestan University, Department of Chemistry, Flakalaflak Street, 68178-17133 Khorramabad (Iran, Islamic Republic of)
2010-04-15
The chemiluminescence behavior of the reaction between bis(2,4,6-trichlorophenyl)oxalate (TCPO) and hydrogen peroxide, in the presence of curcumin as fluorophore, has been investigated. Experimental factors such as TCPO, sodium salicylate (SS), hydrogen peroxide and curcumin concentration were optimized. The chemiluminescence signal showed a linear decay while dimethyl sulfoxide (DMSO) was added to the peroxyoxalate (PO-CL) system. The reaction resulted in a Stern-Volmer plot with a K{sub q} value of 7.3x10{sup 4}. The evaluated lower and upper detection limits of measurable concentrations of DMSO are 3.50x10{sup -5} and 1.53x10{sup -4} M, respectively. The PO-CL parameters were estimated by computer fitting of the experimental CL intensity to proper models.
Inequality, climate impacts on the future poor, and carbon prices.
Dennig, Francis; Budolfson, Mark B; Fleurbaey, Marc; Siebert, Asher; Socolow, Robert H
2015-12-29
Integrated assessment models of climate and the economy provide estimates of the social cost of carbon and inform climate policy. We create a variant of the Regional Integrated model of Climate and the Economy (RICE)-a regionally disaggregated version of the Dynamic Integrated model of Climate and the Economy (DICE)-in which we introduce a more fine-grained representation of economic inequalities within the model's regions. This allows us to model the common observation that climate change impacts are not evenly distributed within regions and that poorer people are more vulnerable than the rest of the population. Our results suggest that this is important to the social cost of carbon-as significant, potentially, for the optimal carbon price as the debate between Stern and Nordhaus on discounting.
Directory of Open Access Journals (Sweden)
Guo Lijun
2014-06-01
Full Text Available Chinese comprehensive universities will face the stern tenet of the development of Russian as a specialty. Connecting this specialty with the advantage of the development of university disciplines and taking one’s own path of building the Russian language specialty using one’s own know-hows and accomplishments is an important issue instructors of Russians are going to have to tackle. This article analyzes the major tenet of the development of the Russian language specialty in comprehensive universities. The article provides the author’s speculations and proposes a countermeasure in respect of the development of the Russian language specialty in comprehensive universities, which, the author hopes, will help the cause of the development of the Russian language specialty in comprehensive universities.
Perceptions of parental control and the development of indecision among late adolescent females.
Ferrari, J R; Olivette, M J
1993-01-01
Late adolescent females (N = 86; M age = 19.1 years) completed reliable and valid self-report measures on their perception of both parents' authority style (authoritarian, authoritative, permissive) and their own tendency toward decisional procrastination. Households where daughters perceived both parents as high authoritarian (n = 32) were significantly more likely to raise daughters with strong indecision tendencies than were parents perceived as low authoritarian (n = 23). Mothers and fathers perceived as high (n = 22) or low (n = 22) authoritative, and high (n = 32) or low (n = 24) permissive, did not produce significant differences in daughters' self-reported decisional procrastination. Results suggest that parental authority characterized by stern inflexibility and overcontrol has the greatest influence on daughters who develop chronic indecision tendencies.
Quantum theory as the most robust description of reproducible experiments
International Nuclear Information System (INIS)
De Raedt, Hans; Katsnelson, Mikhail I.; Michielsen, Kristel
2014-01-01
It is shown that the basic equations of quantum theory can be obtained from a straightforward application of logical inference to experiments for which there is uncertainty about individual events and for which the frequencies of the observed events are robust with respect to small changes in the conditions under which the experiments are carried out. - Highlights: • It is shown that logical inference, that is, inductive reasoning, provides a rational explanation for the success of quantum theory. • The Schrödinger equation is obtained through logical inference applied to robust experiments. • The singlet and triplet states follow from logical inference applied to the Einstein-Podolsky-Rosen-Bohm experiment. • Robustness also leads to the quantum theoretical description of the Stern-Gerlach experiment
Bader, Oren
2016-05-01
Attending to bodily expression of emotions plays an important role in the human social world. It provides subjects with valuable information, constructs opportunities to act, and importantly, as Daniel Stern pointed out, it is involved in the constitution of the direct experience of others. Whether mutual or one-sided, these direct experiences, in which the subject can share the perspectives and attitudes of other subjects, always comprise one person's bodily expression of emotions that is available to another person. In this article I suggest that attending to other subjects' expressed emotions involves a special (social) mode of attention and emotional sharing. This suggestion challenges Dan Zahavi's view that confines the sharing of emotions solely to reciprocal experiences. Copyright © 2016 Elsevier Inc. All rights reserved.
Weak values in collision theory
de Castro, Leonardo Andreta; Brasil, Carlos Alexandre; Napolitano, Reginaldo de Jesus
2018-05-01
Weak measurements have an increasing number of applications in contemporary quantum mechanics. They were originally described as a weak interaction that slightly entangled the translational degrees of freedom of a particle to its spin, yielding surprising results after post-selection. That description often ignores the kinetic energy of the particle and its movement in three dimensions. Here, we include these elements and re-obtain the weak values within the context of collision theory by two different approaches, and prove that the results are compatible with each other and with the results from the traditional approach. To provide a more complete description, we generalize weak values into weak tensors and use them to provide a more realistic description of the Stern-Gerlach apparatus.
Novel Luminescent Probe Based on a Terbium(III) Complex for Hemoglobin Determination
Yegorova, A. V.; Leonenko, I. I.; Aleksandrova, D. I.; Scrypynets, Yu. V.; Antonovich, V. P.; Ukrainets, I. V.
2014-09-01
We have studied the spectral luminescent properties of Tb(III) and Eu(III) complexes with a number of novel derivatives of oxoquinoline-3-carboxylic acid amides (L1-L5 ). We have observed quenching of the luminescence of 1:1 Tb(III)-L1-5 complexes by hemoglobin (Hb), which is explained by resonance energy transfer of electronic excitation from the donor (Tb(III)-L1-5 ) to the acceptor (Hb). Using the novel luminescent probe Tb(III)-L1, we have developed a method for determining Hb in human blood. The calibration Stern-Volmer plot is linear in the Hb concentration range 0.6-36.0 μg/mL, detection limit 0.2 μg/mL (3·10-9 mol/L).
Directory of Open Access Journals (Sweden)
Juan Carlos Muñoz
2008-12-01
Full Text Available The Environmental Kuznets Curve hypothesis suggests the existence of an inverted U-shaped relationship between environmental degradation and income. Several economists assume that the environmental impacts occurred during the first stages of the development process will be reverted as a result of economic growth. Yet Perman and Stern (2003 have argued that the econometric methods used in the earlier analysis of the EKC are inappropriate, given the time properties of the series. This article examines the appropriateness of the EKC for a panel of 46 countries and 21 periods by implementing individual and panel tests for unit roots and cointegration. An error correction model is also estimated. The results do not support evidence of a common EKC for the countries analyzed.
Quantum theory as the most robust description of reproducible experiments
Energy Technology Data Exchange (ETDEWEB)
De Raedt, Hans, E-mail: h.a.de.raedt@rug.nl [Department of Applied Physics, Zernike Institute for Advanced Materials, University of Groningen, Nijenborgh 4, NL-9747AG Groningen (Netherlands); Katsnelson, Mikhail I., E-mail: M.Katsnelson@science.ru.nl [Radboud University Nijmegen, Institute for Molecules and Materials, Heyendaalseweg 135, NL-6525AJ Nijmegen (Netherlands); Michielsen, Kristel, E-mail: k.michielsen@fz-juelich.de [Institute for Advanced Simulation, Jülich Supercomputing Centre, Forschungszentrum Jülich, D-52425 Jülich (Germany); RWTH Aachen University, D-52056 Aachen (Germany)
2014-08-15
It is shown that the basic equations of quantum theory can be obtained from a straightforward application of logical inference to experiments for which there is uncertainty about individual events and for which the frequencies of the observed events are robust with respect to small changes in the conditions under which the experiments are carried out. - Highlights: • It is shown that logical inference, that is, inductive reasoning, provides a rational explanation for the success of quantum theory. • The Schrödinger equation is obtained through logical inference applied to robust experiments. • The singlet and triplet states follow from logical inference applied to the Einstein-Podolsky-Rosen-Bohm experiment. • Robustness also leads to the quantum theoretical description of the Stern-Gerlach experiment.
Energy Technology Data Exchange (ETDEWEB)
Celebi, Neslihan [Faculty of Arts and Sciences, Department of Chemistry, Atatuerk University, 25240 Erzurum (Turkey); Arik, Mustafa [Faculty of Arts and Sciences, Department of Chemistry, Atatuerk University, 25240 Erzurum (Turkey); Onganer, Yavuz [Faculty of Arts and Sciences, Department of Chemistry, Atatuerk University, 25240 Erzurum (Turkey)]. E-mail: yonganer@atauni.edu.tr
2007-09-15
The fluorescence quenching of pyronin B and pyronin Y molecules by molecular oxygen in aqueous solution was studied by using steady-state and time-resolved fluorescence and UV-Vis absorption spectroscopy techniques. In order to understand the quenching mechanism, fluorescence decays, absorption and fluorescence spectra of the probes were recorded as a function of the oxygen concentration and temperature. The quenching was found to be appreciable and shows positive deviation in the Stern-Volmer representation obtained from the fluorescence intensity ratio. Fluorescence quenching constants (k {sub q}) were calculated from the {tau} {sub o}/{tau} vs. [Q] plots having linear correlation and compared with calculated diffusion-controlled rate constants (k {sub diff}) values. Experimental results were in good agreement with the simultaneous dynamic and static quenching model.
International Nuclear Information System (INIS)
Celebi, Neslihan; Arik, Mustafa; Onganer, Yavuz
2007-01-01
The fluorescence quenching of pyronin B and pyronin Y molecules by molecular oxygen in aqueous solution was studied by using steady-state and time-resolved fluorescence and UV-Vis absorption spectroscopy techniques. In order to understand the quenching mechanism, fluorescence decays, absorption and fluorescence spectra of the probes were recorded as a function of the oxygen concentration and temperature. The quenching was found to be appreciable and shows positive deviation in the Stern-Volmer representation obtained from the fluorescence intensity ratio. Fluorescence quenching constants (k q ) were calculated from the τ o /τ vs. [Q] plots having linear correlation and compared with calculated diffusion-controlled rate constants (k diff ) values. Experimental results were in good agreement with the simultaneous dynamic and static quenching model
Lesbian identity and the politics of representation in Betty Parsons's gallery.
Gibson, A
1994-01-01
Although Betty Parsons had been unusually open about her love relationships with women in the twenties and thirties, she later became reticent, retiring to the closet. Her increased discretion after World War II, during the Cold War, coincided with her rise as the art dealer most prominently associated with the international emergence of Abstract Expressionism. Parsons incurred the objections of her Abstract Expressionists, however, by showing artists who included both abstraction and naturalism in their work, such as Sonia Sekula, Forrest Bess, and Hedda Sterne. This article examines her definition of abstraction as difference through her friend Theodoros Stamos's notion of camp and helps to explain her admiration of Barnett Newman despite her refusal to devote her gallery exclusively to his narrower version of significant abstraction.
Solar Eclipse-Induced Changes in the Ionosphere over the Continental US
Erickson, P. J.; Zhang, S.; Goncharenko, L. P.; Coster, A. J.; Hysell, D. L.; Sulzer, M. P.; Vierinen, J.
2017-12-01
For the first time in 26 years, a total solar eclipse occurred over the continental United States on 21 August 2017, between 16:00-20:00 UT. We report on American solar eclipse observations of the upper atmosphere, conducted by a team led by MIT Haystack Observatory. Efforts measured ionospheric and thermospheric eclipse perturbations. Although eclipse effects have been studied for more than 50 years, recent major sensitivity and resolution advances using radio-based techniques are providing new information on the eclipse ionosphere-thermosphere-mesosphere (ITM) system response. Our study was focused on quantifying eclipse effects on (1) traveling ionospheric disturbances (TIDs) and atmospheric gravity waves (AGWs); (2) spatial ionospheric variations associated with the eclipse; and (3) altitudinal and temporal ionospheric profile variations. We present selected early findings on ITM eclipse response including a dense global network of 6000 GNSS total electron content (TEC) receivers (100 million measurements per day; 1x1 degree spatial grid) and the Millstone Hill and Arecibo incoherent scatter radars. TEC depletions of up to 60% in magnitude were associated with the eclipse umbra and penumbra and consistently trailed the eclipse totality center. TEC enhancements associated with prominent orographic features were observed in the western US due to complex interactions as the lower atmosphere cooled in response to decreasing EUV energy inputs. Strong TIDs in the form of bow waves, stern waves, and a stern wake were observed in TEC data. Altitude-resolved plasma parameter profiles from Millstone Hill saw a nearly 50% decrease in F region electron density in vertical profiles, accompanied by a corresponding 200-250 K decrease in electron temperature. Wide field Millstone Hill radar scans showed similar decreases in electron density to the southwest, maximizing along the line of closest approach to totality. Data is available to the research community through the MIT
Effective antiprotease-antibiotic treatment of experimental anthrax
Directory of Open Access Journals (Sweden)
MacAfee Rebecca
2005-04-01
Full Text Available Abstract Background Inhalation anthrax is characterized by a systemic spread of the challenge agent, Bacillus anthracis. It causes severe damage, including multiple hemorrhagic lesions, to host tissues and organs. It is widely believed that anthrax lethal toxin secreted by proliferating bacteria is a major cause of death, however, the pathology of intoxication in experimental animals is drastically different from that found during the infectious process. In order to close a gap between our understanding of anthrax molecular pathology and the most prominent clinical features of the infectious process we undertook bioinformatic and experimental analyses of potential proteolytic virulence factors of B. anthracis distinct from lethal toxin. Methods Secreted proteins (other than lethal and edema toxins produced by B. anthracis were tested for tissue-damaging activity and toxicity in mice. Chemical protease inhibitors and rabbit immune sera raised against B. anthracis proteases were used to treat mice challenged with B. anthracis (Sterne spores. Results B. anthracis strain delta Ames (pXO1-, pXO2- producing no lethal and edema toxins secrets a number of metalloprotease virulence factors upon cultivation under aerobic conditions, including those with hemorrhagic, caseinolytic and collagenolytic activities, belonging to M4 and M9 thermolysin and bacterial collagenase families, respectively. These factors are directly toxic to DBA/2 mice upon intratracheal administration at 0.5 mg/kg and higher doses. Chemical protease inhibitors (phosphoramidon and 1, 10-phenanthroline, as well as immune sera against M4 and M9 proteases of B. anthracis, were used to treat mice challenged with B. anthracis (Sterne spores. These substances demonstrate a substantial protective efficacy in combination with ciprofloxacin therapy initiated as late as 48 h post spore challenge, compared to the antibiotic alone. Conclusion Secreted proteolytic enzymes are important pathogenic
Aucelio, Ricardo Q.; Carvalho, Juliana M.; Real, Juliana T.; Maqueira-Espinosa, Luis; Pérez-Gramatges, Aurora; da Silva, Andrea R.
2017-02-01
Flavonoids are polyphenols that help the maintenance of health, aiding the prevention of diseases. In this work, CdTe QDs coated with 3-mercaptopropionic acid (3MPA), with an average size of 2.7 nm, were used as photoluminescence probe for flavonoids in different conditions. The interaction between 14 flavonoids and QDs was evaluated in aqueous dispersions in the absence and in the presence of cetyltrimethylammonium bromide (CTAB). To establish a relationship between photoluminescence quenching and the concentration of flavonoids, the Stern-Volmer model was used. In the absence of CTAB, the linear ranges for quercetin, morin and rutin were from 5.0 × 10- 6 mol L- 1 to 6.0 × 10- 5 mol L- 1 and from 1.0 × 10- 5 mol L- 1 to 6.0 × 10- 4 mol L- 1 for kaempferol. The sensibility of the Stern-Volmer curves (Ks) indicated that quercetin interacts more strongly with the probe: Ks quercetin > Ks kaempferol > Ks rutin > Ks morin. The conjugation extension in the 3 rings, and the acidic hydroxyl groups (positions 3ʹand 4ʹ) in the B-ring enhanced the interaction with 3MPA-CdTe QDs. The other flavonoids do not interact with the probe at 10- 5 mol L- 1 level. In CTAB organized dispersions, Ks 3-hydroxyflavone > Ks 7-hydroxyflavone > Ks flavona > Ks rutin in the range from 1.0 × 10- 6 mol L- 1 to 1.2 × 10- 5 mol L- 1 for flavones and of 1.0 × 10- 6 mol L- 1 to 1.0 × 10- 5 mol L- 1 for rutin. Dynamic light scattering, conductometric measurements and microenvironment polarity studies were employed to elucidate the QDs-flavonoids interaction in systems containing CTAB. The quenching can be attributed to the preferential solubility of hydrophobic flavonoid in the palisade layer of the CTAB aggregates adsorbed on the surface of the 3MPA CdTe QDs.
Arsenite adsorption on goethite at elevated temperatures
Energy Technology Data Exchange (ETDEWEB)
Kersten, Michael [Environmental Geochemistry Group, Institute of Geosciences, Johannes Gutenberg-University, Mainz 55099 (Germany)], E-mail: kersten@uni-mainz.de; Vlasova, Nataliya [Environmental Geochemistry Group, Institute of Geosciences, Johannes Gutenberg-University, Mainz 55099 (Germany)
2009-01-15
Experimental closed-system {delta}T acid-base titrations between 10 deg. C and 75 deg. C were used to constrain a temperature-dependent 1-pK basic Stern model of the goethite surface complexation reactions. Experimental data for the temperature dependence of pH{sub PZC} determined by the one-term Van't Hoff extrapolation yield a value for goethite surface protonation enthalpy of -49.6 kJ mol{sup -1} in good agreement with literature data. Batch titration data between 10 deg. C and 75 deg. C with arsenite concentrations between 10 {mu}M and 100 {mu}M yield adsorption curves, which increases with pH, peak at a pH of 9, and decrease at higher pH values. The slope of this bend becomes steeper with increasing temperature. A 1-pK charge distribution model in combination with a basic Stern layer option could be established for the pH-dependent arsenite adsorption. Formation of two inner-sphere bidentate surface complexes best matched the experimental data in agreement with published EXAFS spectroscopic information. The temperature behaviour of the thus derived intrinsic equilibrium constants can be well represented by the linear Van't Hoff logK{sub T}{sup int} vs. 1/T plot. Adsorption of arsenite on the goethite surface is exothermic (negative {delta}{sub r}H{sub 298} values) and therefore becomes weaker with increasing temperature. Application of the new constants with the aqueous speciation code VMINTEQ predicts that the As(III) concentration in presence of goethite sorbent decreases by 10 times once the hydrothermal solution is cooled from 99 deg. C to 1 deg. C. The model curve matches data from a natural thermal water spring system. The increase of adsorption efficiency for As along the temperature gradient may well serve as an additional process to prevent ecosystem contamination by As-rich water seepage from geothermal energy generation facilities.
SAMI3 Simulations of the Persistent May 1994 Plasmasphere Plume
Krall, J.; Huba, J.; Borovsky, J.
2017-12-01
We use the Naval Research Laboratory SAMI3 ionosphere/plasmasphere model[1] to explore the physics of a long-lived plasmasphere plume. A plasmasphere plume is a storm feature that extends the cold plasma that is normally trapped by the geomagnetic field (the plasmasphere) outward towards the bow shock. In the case of the May 1994 storm, the storm and the plume continued for 12 days. For the model storm, we imposed a Kp-driven Volland/Stern-Maynard/Chen potential [2-4]. Results are compared to measurements of the cold ion density from the 1989-046 spacecraft in geosynchronous orbit [5]. We find that many details of the observed plume are reproduced by SAMI3, but only if a background magnetosphere density is included as a boundary condition. We also find that high-speed, field aligned plasma flows contribute significantly to the observed plume density. [1] Huba, J. and J. Krall (2013), Modeling the plasmasphere with SAMI3, Geophys. Res. Lett., 40, 6-10, doi:10.1029/2012GL054300 [2] Volland, H. (1973), A semiempirical model of large-scale magnetospheric electric fields, Journal of Geophysical Research, 78, 171-180, doi:10.1029/JA078i001p00171 [3] Stern, D.P. (1975), The motion of a proton in the equatorial magnetosphere, Journal of Geophysical Research, 80, 595-599, doi:10.1029/JA080i004p00595 [4] Maynard, N.C., and A.J. Chen (1975), Isolated cold plasma regions: Observations and their relation to possible production mechanisms, Journal of Geophysical Research, 80, 1009-1013, doi:10.1029/JA080i007p01009 [5] Borovsky, J.E., D.T. Welling, M.F. Thomsen, and M.H. Denton (2014), Long-lived plasmaspheric drainage plumes: Where does the plasma come from?, Journal of Geophysical Research: Space Physics, 119, 6496-6520, doi:10.1002/2014JA020228 Research supported by NRL base funds.
Directory of Open Access Journals (Sweden)
Clara Raznoszczyk de Schejtman
2006-12-01
Full Text Available El presente trabajo presenta una articulación entre resultados provenientes de la investigación empírica observacional en díadas madre-bebé y conceptualizaciones psicoanalíticas acerca de la estructuración psíquica. Se filmaron 48 díadas madre bebé y se evaluó la regulación afectiva a través del microanálisis de 3 minutos de interacción cara a cara madre-bebé. Se estudió la autoestima materna a través de una entrevista y de instrumentos autoadministrados. Se presentan los resultados obtenidos acerca de las relaciones entre la expresividad observada en la madre y el bebé, y la autoestima materna. Se presenta un desarrollo teórico sobre las implicancias para el psicoanálisis del estudio del fenómeno diádico interactivo y del pasaje de la regulación diádica madrebebé a la autorregulación que va logrando el infante. Se presentan desarrollos de Daniel Stern y Edward Tronick en esta temática y se propone un modelo de intervención clínica en primera infancia.The present paper deals with the overlapping between data obtained from observational mother-infant research and psychoanalytical conceptualizations on psychic structure. 48 mother-infant dyads were videotaped and affective regulation was studied through the microanalysis of 3 minutes face to face interaction. Maternal self esteem was studied through an interview and self administered instruments were offered to the mothers. Results are presented on the relations obtained between the observed expressivity in the mother and the infant, and Maternal Self Esteem. A theoretical discussion is presented regarding implications for psychoanalysis around the study of the interactive dyadic phenomenon and from the process from dyadic affective regulation to infant self regulation. Some ideas on the topic from Daniel Stern and Edward Tronick are presented and a psychotherapeutic intervention model in infancy is proposed.
Chairmanship of the Neptune/Pluto outer planets science working group
Stern, S. Alan
1993-11-01
The Outer Planets Science Working Group (OPSWG) is the NASA Solar System Exploration Division (SSED) scientific steering committee for the Outer Solar System missions. OPSWG consists of 19 members and is chaired by Dr. S. Alan Stern. This proposal summarizes the FY93 activities of OPSWG, describes a set of objectives for OPSWG in FY94, and outlines the SWG's activities for FY95. As chair of OPSWG, Dr. Stern will be responsible for: organizing priorities, setting agendas, conducting meetings of the Outer Planets SWG; reporting the results of OPSWG's work to SSED; supporting those activities relating to OPSWG work, such as briefings to the SSES, COMPLEX, and OSS; supporting the JPL/SAIC Pluto study team; and other tasks requested by SSED. As the Scientific Working Group (SWG) for Jupiter and the planets beyond, OPSWG is the SSED SWG chartered to study and develop mission plans for all missions to the giant planets, Pluto, and other distant objects in the remote outer solar system. In that role, OPSWG is responsible for: defining and prioritizing scientific objectives for missions to these bodies; defining and documenting the scientific goals and rationale behind such missions; defining and prioritizing the datasets to be obtained in these missions; defining and prioritizing measurement objectives for these missions; defining and documenting the scientific rationale for strawman instrument payloads; defining and prioritizing the scientific requirements for orbital tour and flyby encounter trajectories; defining cruise science opportunities plan; providing technical feedback to JPL and SSED on the scientific capabilities of engineering studies for these missions; providing documentation to SSED concerning the scientific goals, objectives, and rationale for the mission; interfacing with other SSED and OSS committees at the request of SSED's Director or those committee chairs; providing input to SSED concerning the structure and content of the Announcement of Opportunity
Measurement of flows around modern commercial ship models
Energy Technology Data Exchange (ETDEWEB)
Kim, W J; Van, S H; Kim, D H [Korea Research Inst. of Ships and Ocean Engineering, KORDI, Taejon (Korea)
2001-11-01
To document the details of flow characteristics around modern commercial ships, global force, wave pattern, and local mean velocity components were measured in the towing tank. Three modern commercial hull models of a container ship (KRISO container ship = KCS) and of two very large crude-oil carriers (VLCCs) with the same forebody and slightly different afterbody (KVLCC and KVLCC2) having bow and stern bulbs were selected for the test. Uncertainty analysis was performed for the measured data using the procedure recommended by the ITTC. Obtained experimental data will provide a good opportunity to explore integrated flow phenomena around practical hull forms of today. Those can be also used as the validation data for the computational fluid dynamics (CFD) code of both inviscid and viscous flow calculations. (orig.)
Intrinsic Fluorescence of PAMAM Dendrimers—Quenching Studies
Directory of Open Access Journals (Sweden)
Malgorzata Konopka
2018-05-01
Full Text Available Intrinsic, non-traditional fluorescence of polyamidoamine (PAMAM dendrimers that do not possess classical fluorophores has been attracting considerable interest for the last decade. Many hypotheses regarding the source of the fluorescence have appeared, but some of them are still disputable. In order to shed new light on the nature of the phenomenon, we applied quenchers that are normally used to study intrinsic fluorescence of proteins (i.e., KI, CsCl, and acrylamide. KI and acrylamide efficiently quenched steady state fluorescence of PAMAM G2, PAMAM G3, and PAMAM G4 dendrimers. Stern-Volmer plots exhibited a downward curvature that has been elucidated by heterogenous emission. We assume that there are two distinct fluorescent moieties in the dendrimer structure that are characterized by different accessibility to the quenchers.
Zero-point energy in early quantum theory
International Nuclear Information System (INIS)
Milonni, P.W.; Shih, M.-L.
1991-01-01
In modern physics the vacuum is not a tranquil void but a quantum state with fluctuations having observable consequences. The present concept of the vacuum has its roots in the zero-point energy of harmonic oscillators and the electromagnetic field, and arose before the development of the formalism of quantum mechanics. This article discusses these roots in the blackbody research of Planck and Einstein in 1912--1913, and the relation to Bose--Einstein statistics and the first indication of wave--particle duality uncovered by Einstein's fluctuation formula. Also considered are the Einstein--Stern theory of specific heats, which invoked zero-point energy in a way which turned out to be incorrect, and the experimental implications of zero-point energy recognized by Mulliken and Debye in vibrational spectroscopy and x-ray diffraction
New Fluorescence Probes for Biomolecules
Directory of Open Access Journals (Sweden)
Katarzyna Jurek
2015-07-01
Full Text Available Steady state fluorescence measurements have been used for the investigation of interaction between the bovine serum albumin (BSA and fluorescence probes: 3-hydroxy-2,4- bis[(3-methyl-1,3-benzoxazol-2(3H-ylidenemethyl]cyclobut-2-en-1-one (SQ6, 3-hydroxy- 2,4-bis[(3-methyl-1,3-benzothiazol-2(3H-ylidenemethyl]cyclobut-2-en-1-one (SQ7 and 3-hydroxy-2,4-bis[(1,3,3-trimethyl-1,3-dihydro-2H-indol-2-ylidenemethyl]cyclobut-2-en-1-one (SQ8. The binding constant between bovine serum albumin and squarine dyes has been determined by using both the Benesi-Hildebrand and Stern-Volmer equations. The negative value of free energy change indicates the existence of a spontaneous complexation process of BSA with squarine dyes.
Fluorescence study on the interaction of human serum albumin with Butein in liposomes
Toprak, Mahmut
2016-02-01
The interaction of Butein with human serum albumin in L-egg lecithin phosphatidycholine (PC) liposome has been investigated by fluorescence and absorption spectroscopy. The results of the fluorescence measurement indicated that Butein effectively quenched the intrinsic fluorescence of HSA via static quenching. The Stern-Volmer plots in all the liposome solutions showed a positive deviation from the linearity. According to the thermodynamic parameters, the hydrophobic interactions appeared be the major interaction forces between Butein and HSA. The effect of Butein on the conformation of HSA was also investigated by the synchronous fluorescence under the same experimental conditions. In addition, the partition coefficient of the Butein in the PC liposomes was also determined by using the fluorescence quenching process. The obtained results can be of biological significance in pharmacology and clinical medicine.
International Nuclear Information System (INIS)
Dorle, A.
1999-01-01
Luminescent lanthanide complexes are especially important as labels for the investigation of biological substances. The rare earths are employed as probes and are often able to substitute more expensive radioactive labels. The kinetic investigations of the reactions of Tb(III)- and Eu(III)-trisdipicolinate (charge: 3**-) with different charged iron complexes as quenchers (charge: 3 - , 1 - , 2 + ) (solvent: H 2 O) at varying ionic strength give results that can help to find out more details about how the intermolecular energy transfer takes place. By creating a Stern-Volmer plot one can get the rate constant of the luminescent quenching: Plotting the rate constants of quenching taken from the timeresolved flashphotolysis measurement (y-axis) versus the concentration of the quencher (x-axis) the resulting slope equals a rate constant k 2 of 2 nd order. (author)
Photoinduced electron transfer between benzyloxy dendrimer phthalocyanine and benzoquinone
Zhang, Tiantian; Ma, Dongdong; Pan, Sujuan; Wu, Shijun; Jiang, Yufeng; Zeng, Di; Yang, Hongqin; Peng, Yiru
2016-10-01
Photo-induced electron transfer (PET) is an important and fundamental process in natural photosynthesis. To mimic such interesting PET process, a suitable donor and acceptor couple were properly chosen. Dendrimer phthalocyanines and their derivatives have emerged as promising materials for artificial photosynthesis systems. In this paper, the electron transfer between the light harvest dendrimer phthalocyanine (donor) and the 1,4-benzoquinone (acceptor) was studied by UV/Vis and fluorescence spectroscopic methods. It was found that fluorescence of phthalocyanine was quenched by benzoquinone (BQ) via excited state electron transfer, from the phthalocyanine to the BQ upon excitation at 610 nm. The Stern-Volmer constant (KSV) of electron transfer was calculated. Our study suggests that this dendritic phthalocyanine is an effective new electron donor and transmission complex and could be used as a potential artificial photosynthesis system.
The trap of history. The States Party and the Revolt of the Netherlands, 1650-1660
Directory of Open Access Journals (Sweden)
Jasper van der Steen
2013-12-01
Full Text Available Historians of the First Stadholderless Period (1650-1672 have shown that supporters of the house of Orange evoked memories of Prince William i of Orange's role in the Revolt of the Netherlands in support of their political agendas. Jill Stern has recently argued that the supporters of True Freedom therefore needed to develop an alternative interpretation of the Revolt. Since she focuses on Orangist rhetoric, she has not asked why authors who sympathized with the States Party related their political ideology to the existing popular historical narratives about the conflict. These were, after all, tainted by Orangist associations. This article will argue that the past was a rich source of inspiration for politicians in the seventeenth-century 'present' but that the use of historical references was limited by the existing dominant storylines.
Polarizing matter and antimatter: A new method
International Nuclear Information System (INIS)
Onel, Y.
1992-02-01
Several years ago a self-polarization effect for stored (anti)- protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at the Indiana University Cyclotron Facility (IUCF) is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low-energy range and at SSC and LHC energies. In this progress report we will describe our progress in three parts: (A) Experimental work at IUCF Cooler Ring; (B) Our extensive computer simulations of the spin stability for the IUCF Cooler Ring; and (C) Theoretical studies
Polarizing matter and antimatter: A new method. Final report
International Nuclear Information System (INIS)
Onel, Y.
1994-12-01
Several years ago a self-polarization effect for stored (anti-)protons and ions was investigated theoretically. The effect is based on the well-known Stern-Gerlach effect in gradient fields. The aim of the ongoing measurements at the Indiana University Cyclotron Facility (IUCF) is to verify experimentally the various assumptions on which this effect is based. The final goal is to demonstrate this new polarization effect. The proposed effect could be a powerful tool to produce polarized stored hadron beams both in the low-energy range and at SSC and LHC energies. In this progress report the authors will describe the progress in three parts: (A) experimental work at IUCF Cooler Ring; (B) the extensive computer simulations of the spin stability for the IUCF Cooler Ring; and (C) theoretical studies
Chemically functionalized ZnS quantum dots as new optical nanosensor of herbicides
Masteri-Farahani, M.; Mahdavi, S.; Khanmohammadi, H.
2018-03-01
Surface chemical functionalization of ZnS quantum dots (ZnS-QDs) with cysteamine hydrochloride resulted in the preparation of an optical nanosensor for detection of herbicides. Characterization of the functionalized ZnS-QDs was performed with physicochemical methods such as x-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared (FT-IR) spectroscopy, energy dispersive x-ray (EDX) analysis, ultraviolet-visible (UV–vis) and photoluminescence (PL) spectroscopies. The optical band gap of the functionalized ZnS-QDs was determined by using Tauc plot as 4.1 eV. Addition of various herbicides resulted in the linearly fluorescence quenching of the functionalized ZnS-QDs according to the Stern-Volmer equation. The functionalized ZnS-QDs can be used as simple, rapid, and inexpensive nanosensor for practical detection and measurement of various herbicides.
Enhanced explosive sensing based on bis(methyltetraphenyl)silole nanoaggregate
Shin, Bomina; Sohn, Honglae
2018-01-01
New photoluminescent bis(methyltetraphenyl)silole nanoaggregates for the detection of trinitrotoluene (TNT) were developed by using aggregation-induced emission property. Bis(methyltetraphenyl)silole nanoaggregates exhibited that photoluminescence (PL) intensity was increased when the water fraction was increased to 90% by volume. Relative PL efficiency of bis(methyltetraphenyl)silole nanoaggregates was exponentially increased to the percent of water fraction and particle diameter was dependent on solvent composition. Particle size of bis(methyltetraphenyl)silole nanoaggregates was tuned by controlling the water fraction by volume. Absolute quantum yield of bis(methyltetraphenyl)silole nanoaggregates in 90% water volume fraction were 32.4%, which increases by about 40 times. Detection of TNT was achieved from the quenching PL measurement of bis(methyltetraphenyl)silole nanoaggregates by adding the TNT. A linear Stern-Volmer relationship was observed for the detection of TNT.
Climate change and wind power in Australia
International Nuclear Information System (INIS)
Millais, C.
2001-01-01
The article represents a stern criticism of Australia's attitude to climate change. Its climate change policy is described as 'Neanderthal'. The Australian government is said to be strongly opposed to ratification of the Kyoto Protocol. The Government's policy appears to be driven by vested interests in fossil fuels. A list of eight flaws in Australia's 2% renewables target is given; the target is said to be far too small for a country with so much renewables potential. However, investment in the country's enormous wind power potential is increasing and targets are given; six reasons why Australia needs to invest in wind power are given. It is suggested that by the end of this decade, 10% of Australia's electricity could come from wind power - a web site address giving further details is given
Photoinduced interaction between MPA capped CdTe QDs and certain anthraquinone dyes
Energy Technology Data Exchange (ETDEWEB)
Jagadeeswari, S.; Asha Jhonsi, M.; Kathiravan, A. [School of Chemistry, Bharathidasan University, Tiruchirappalli 620 024, Tamil Nadu (India); Renganathan, R., E-mail: rrengas@gmail.co [School of Chemistry, Bharathidasan University, Tiruchirappalli 620 024, Tamil Nadu (India)
2011-04-15
Photoinduced interaction of mercapto propionic acid (MPA) capped CdTe quantum dots (QDs) with certain anthraquinone dyes namely alizarin, alizarin red S, acid blue 129 and uniblue has been studied by steady state and time resolved fluorescence measurements. Addition of anthraquinone dyes to CdTe QDs results in the reduction of electron hole recombination has been observed (i.e., fluorescence quenching). The Stern-Volmer constant (K{sub SV}), quenching rate constant (k{sub q}) and association constants (K) were obtained from fluorescence quenching data. The interaction of anthraquinone dyes with QDs occurs through static quenching was confirmed by unaltered fluorescence lifetime. The occurrence of electron transfer quenching mechanism has been proved by the negative free energy change ({Delta}G{sub et}) obtained as per the Rehm-Weller equation.
Tuberculin skin testing: Spectrum of adverse reactions.
Praveen, Ramar; Bahuguna, Amit; Dhadwal, Bhumesh Singh
2015-01-01
Tuberculin skin testing (TST) is one of the primary diagnostic modalities recommended by the World Health Organization (WHO) and the National Institute for Health and Care Excellence (NICE) study conducted in the United Kingdom (UK) for diagnosing tuberculosis (TB). Even after acceptance as a diagnostic modality and stern standardization, TST has its own flaws that include a spectrum of adverse reactions. We report a series of cases with a spectrum of adverse reactions occurring with a higher frequency than present in the available evidence. The study has some demerits such as being a retrospective one with interobserver variation and lack of histopathological confirmation. The observation is presented to accentuate the fact that adverse reactions are not a rarity and that further studies are required to establish the cause and exact incidence of the same.
Mes, Ron; Schuckard, Rot
1976-01-01
The foraging activity of Common Tern Sterna hirundo and Arctic Tern Sterna paradisaea was studied on the low sandy island of Engelsmanplaat in the Dutch Waddensea area (53°28’N – 06°30’E). The foraging activity was measured by counting birds carrying food to the colony and birds flying towards the
VizieR Online Data Catalog: Identifications of Sonneberg variables (Kinnunen+, 1999-2000)
Kinnunen, T.; Skiff, B. A.
2002-09-01
The list below is a continuation of a series providing accurate positions and identifications for variables appearing on the MVS charts (Hoffmeister, 1957, Mitt. Verdander. Sterne, No. 245). The variables here were first described by Hoffmeister (1949, Astron. Abh. Ergaenzungshefte z.d. Astron. Nach., 12, no. 1, A3) in the difficult-to-find ``Ergaenzungshefte'' to the Astronomische Nachrichten, and are the first group from a collection of some 1440 variables from this publication. Details about the identification procedure and table layout are contained in the first report of our series (Kinnunen & Skiff, 2000IBVS.4862....1K). We are grateful to librarians Antoinette Beiser (Lowell) and Brenda Corbin (U. S. Naval Observatory, Washington) for providing a photocopy of the Hoffmeister survey; ``bibliothecaire extraordinaire'' Suzanne Laloe (Obs. Paris-Meudon) advised on how this obscure journal should be cited. (3 data files).
Consumer behaviour and the environment
DEFF Research Database (Denmark)
Thøgersen, John
2005-01-01
-style are not easily achieved, however. In a report issued by United Na-tions Secretary-General Kofi Annan in preparation for the Johannesburg Summit it was concluded that "Progress towards the goals established at Rio has been slower than anticipated and in some respects conditions are worse than they were ten years...... ago." It continues to be true that a funda-mental requirement for success in this endeavour is consumers' active support and willing participation (Norwegian Ministry of Environment, 1994). Information is an important tool in this connection. Not only for marshalling public support......, that information alone is usually not sufficient to change behaviour (Stern, 1999). My aim here is to present a broad-brush overview of some of the most important roles that information has been found to play as a tool for pro-moting environmentally responsible consumer behaviour. Because this publication...
Development and validation of the 3-D CFD model for CANDU-6 moderator temperature predictions
International Nuclear Information System (INIS)
Yoon, Churl; Rhee, Bo Wook; Min, Byung Joo
2003-03-01
A computational fluid dynamics model for predicting the moderator circulation inside the CANada Deuterium Uranium (CANDU) reactor vessel has been developed to estimate the local subcooling of the moderator in the vicinity of the Calandria tubes. The buoyancy effect induced by internal heating is accounted for by Boussinesq approximation. The standard κ-ε turbulence model associated with logarithmic wall treatment is applied to predict the turbulent jet flows from the inlet nozzles. The matrix of the Calandria tubes in the core region is simplified to porous media, in which an-isotropic hydraulic impedance is modeled using an empirical correlation of the frictional pressure loss. The governing equations are solved by CFX-4.4, a commercial CFD code developed by AEA technology. The CFD model has been successfully verified and validated against experimental data obtained in the Stern Laboratories Inc. (SLI) in Hamilton, Ontario
Wang, Li; Zhao, Hui; Chen, Yong; Sun, Ruimin; Han, Bing
2016-07-01
A high efficient homogeneous system for hydrogen production from water consisting of Eosin Y as a photosensitizer, methyl viologen (MV2+) as an electron transfer mediator, triethanolamine (TEOA) as a sacrificial electron donor and colloid Pt as a catalyst, has been systemicly studied. The initial system pH and the concentration of Eosin Y have remarkable effects on the rate of hydrogen evolution. The optimal pH and concentration of Eosin Y are 9 and 7.2×10-5 M. Triethanolamine (TEOA) as an electron donor, can reductively quench the oxidized Eosin Y and the quenching is well modeled by the Stern-Volmer equation. The optimal concentration of TEOA and the concentration of MV2+ are 0.3 M and 3.1×10-4 M, respectively. In addition, the role of colloid Pt has been investigated.
Technical training - Places available
2012-01-01
If you would like more information on a course, or for any other inquiry/suggestions, please contact Technical.Training@cern.ch Valeria Perez Reale, Learning Specialist, Technical Programme Coordinator (Tel.: 62424) Eva Stern and Elise Romero, Technical Training Administration (Tel.: 74924) Electronics design Next Session Duration Language Availability Certified LabVIEW Associate Developer (CLAD) 06-Dec-12 to 06-Dec-12 1 hour English One more place available Compatibilité électromagnetique (CEM): Applications 23-Nov-12 to 23-Nov-12 3.5 hours English 3 places available Compatibilité électromagnétique (CEM): Introduction 23-Nov-12 to 23-Nov-12 3 hours English 43 places available Effets des Radiations sur les composants et systèmes électroniques 11-Dec-12 to 12-Dec-12 1 day 4 hours French 9 places available LabVIEW for beginners ...
The effect of recasting on corrosion of DUCINOX prosthetic alloy
Directory of Open Access Journals (Sweden)
L. Klimek
2009-07-01
Full Text Available The effect of recasting, up to two times, Ni-Cr (DUCINOX prosthetic alloy on its corrosion properties was carried out. The corrosion measurements were done in deoxygenated Fusayama Meyer artificial saliva solution at temperature of 37°C. In the study following electrochemical methods were used: measurement of free corrosion potential Ecor in open circuit, measurement of polarization resistance according to Stern-Geary's method and measurement of potentiodynamic characteristic in wide range of anodic polarization. In general, it can be stated that casting number weakly influence on corrosion properties of investigated alloy. At free corrosion potential there is no monotonic dependence of corrosion parameters versus casting number. However, at extreme anodic potentials monotonic changes of corrosion parameters with increasing casting number is observed. Obtained results and drawn conclusions are partially compatible with literature data.
Problematic aspects of the economic value added measure in environment of the Czech Republic
Directory of Open Access Journals (Sweden)
Michaela Beranová
2010-01-01
Full Text Available The EVA indicator has been constructed in the recent past as a reaction to requirements of the new economic environment. As the EVA indicator has been introduced by Stewart Stern & Co. in the early nineties, past two decades many economists have been discussing the pros and cons of EVA application as well as various adjustments needed to calculate some relevant result. A range of attitudes to the adjustments to accounting data towards economic data exist there. As the indicator of economic value added is considered to be a criterion of company’s real economic performance it is necessary to be very careful at applying encouraged adjustments. In this article, the authors compare and discuss these adjustments advised in order to reach some ideal number. Accounting differences of US GAAP, IFRS and Czech Accounting Standards are taken into consideration.
Poisson-Boltzmann versus Size-Modified Poisson-Boltzmann Electrostatics Applied to Lipid Bilayers.
Wang, Nuo; Zhou, Shenggao; Kekenes-Huskey, Peter M; Li, Bo; McCammon, J Andrew
2014-12-26
Mean-field methods, such as the Poisson-Boltzmann equation (PBE), are often used to calculate the electrostatic properties of molecular systems. In the past two decades, an enhancement of the PBE, the size-modified Poisson-Boltzmann equation (SMPBE), has been reported. Here, the PBE and the SMPBE are reevaluated for realistic molecular systems, namely, lipid bilayers, under eight different sets of input parameters. The SMPBE appears to reproduce the molecular dynamics simulation results better than the PBE only under specific parameter sets, but in general, it performs no better than the Stern layer correction of the PBE. These results emphasize the need for careful discussions of the accuracy of mean-field calculations on realistic systems with respect to the choice of parameters and call for reconsideration of the cost-efficiency and the significance of the current SMPBE formulation.
Wu, Ruixiang; Chen, Ruiyun; Zhou, Haitao; Qin, Yaqiang; Zhang, Guofeng; Qin, Chengbing; Gao, Yan; Gao, Yajun; Xiao, Liantuan; Jia, Suotang
2018-01-01
We present a sensitive method for detection of ultra-low oxygen concentrations based on the fluorescence blinking dynamics of single molecules. The relationship between the oxygen concentration and the fraction of time spent in the off-state, stemming from the population and depopulation of triplet states and radical cationic states, can be fitted with a two-site quenching model in the Stern-Volmer plot. The oxygen sensitivity is up to 43.42 kPa-1 in the oxygen partial pressure region as low as 0.01-0.25 kPa, which is seven times higher than that of the fluorescence intensity indicator. This method avoids the limitation of the sharp and non-ignorable fluctuations that occur during the measurement of fluorescence intensity, providing potential applications in the field of low oxygen-concentration monitoring in life science and industry.
Report:L’INCONSCIO, IL TEMPO, IL SUONO. SU PSICOANALISI E MUSICA
Directory of Open Access Journals (Sweden)
Gardini, Michele
2015-06-01
Full Text Available The system of classical psychoanalysis, as built by Freud, grants almost no space to the phenomenon of sound and music. Indeed, many aspects of music, though not all, appear incompatible with his conception of the unconscious. Only slowly and painfully, through the reflection and the analytical and aesthetic categories worked out by figures such as Melanie Klein, Donald Winnicott, Daniel Stern, Didier Anzieu and Michel Imberty, music has finally found its rightful place in the vast map of psychoanalytic science. Many metapsychological categories first elaborated by Freud appear now, retrospectively, as limited on the one hand to the iconic and linguistic dimension, on the other to specifically pathological situations and finally, from the musical point of view, to the "new music", testimony of the world in “era of the technique” and subject of the masterly analysis by Theodor Adorno.
The HERMES polarized hydrogen and deuterium gas target in the HERA electron storage ring
International Nuclear Information System (INIS)
Airapetian, A.; Akopov, N.; Akopov, Z.
2005-01-01
The HERMES hydrogen and deuterium nuclear-polarized gas targets have been in use since 1996 with the polarized electron beam of HERA at DESY to study the spin structure of the nucleon. Polarized atoms from a Stern-Gerlach Atomic Beam Source are injected into a storage cell internal to the HERA electron ring. Atoms diffusing from the center of the storage cell into a side tube are analyzed to determine the atomic fraction and the atomic polarizations. The atoms have a nuclear polarization, the axis of which is defined by an external magnetic holding field. The holding field was longitudinal during 1996-2000, and was changed to transverse in 2001. The design of the target is described, the method for analyzing the target polarization is outlined, and the performance of the target in the various running periods is presented
The HERMES polarized hydrogen and deuterium gas target in the HERA electron storage ring
International Nuclear Information System (INIS)
Airapetian, A.; Akopov, N.; Akopov, Z.; Peking University, Beijing
2004-08-01
The HERMES hydrogen and deuterium nuclear-polarized gas targets have been in use since 1996 with the polarized electron beam of HERA at DESY to study the spin structure of the nucleon. Polarized atoms from a Stern-Gerlach Atomic Beam Source are injected into a storage cell internal to the HERA electron ring. Atoms diffusing from the center of the storage cell into a side tube are analyzed to determine the atomic fraction and the atomic polarizations. The atoms have a nuclear polarization, the axis of which is defined by an external magnetic holding field. The holding field was longitudinal during 1996-2000, and was changed to transverse in 2001. The design of the target is described, the method for analyzing the target polarization is outlined, and the performance of the target in the various running periods is presented. (orig.)
Quantum theory as plausible reasoning applied to data obtained by robust experiments.
De Raedt, H; Katsnelson, M I; Michielsen, K
2016-05-28
We review recent work that employs the framework of logical inference to establish a bridge between data gathered through experiments and their objective description in terms of human-made concepts. It is shown that logical inference applied to experiments for which the observed events are independent and for which the frequency distribution of these events is robust with respect to small changes of the conditions under which the experiments are carried out yields, without introducing any concept of quantum theory, the quantum theoretical description in terms of the Schrödinger or the Pauli equation, the Stern-Gerlach or Einstein-Podolsky-Rosen-Bohm experiments. The extraordinary descriptive power of quantum theory then follows from the fact that it is plausible reasoning, that is common sense, applied to reproducible and robust experimental data. © 2016 The Author(s).
Jarius, Sven; Wildemann, Brigitte
2017-01-01
The concept of classical conditioning (CC), strongly connected with the name and work of the Russian physiologist Ivan Petrovich Pavlov (1849-1936), has become the foundation of the modern science of learning and, in particular, of the influential theories of Watson and Skinner and the entire school of behaviourism. In this paper, we give a number of forgotten accounts of CC in the English, French, and German classic literature that pre-date Pavlov's reports by decades or even centuries. These instances are taken from works of the 16th, 18th, and 19th centuries - authored by some of the finest writers of England (Sterne, Locke), France (Rabelais), and Germany (Jean Paul) - and indicate that the psychological mechanisms now described as CC were known long before Pavlov and his successors elaborated on them in a systematic way. © 2017 S. Karger AG, Basel.
The incidence of chemically peculiar stars in open clusters
Energy Technology Data Exchange (ETDEWEB)
Netopil, M.
2013-07-01
astrophysikalischer Sicht sind diese Objekte von großem Interesse, da sie zahlreiche besondere Eigenschaften in sich vereinen. Diese Dissertation widmet sich der Untersuchung einer Untergruppe der CP Sterne, die neben Überhäufigkeiten von Elementen der Eisengruppe (zB. Chrom) und seltenen Erden wie Europium, auch starke Magnetfelder und eine langsame Rotation aufweisen. Basierend auf einer Auswahl von gut untersuchten nahen Feldsternen wird der mögliche Zusammenhang zwischen diesen Eigenschaften betrachtet. Das Hauptaugenmerk galt jedoch der Untersuchung einer möglichen Abhängigkeit zwischen der Anzahl von CP Sternen und deren Alter. Für diesen Zweck wurden die Ergebnisse von mehreren Delta-a Studien in Sternhaufen herangezogen. Dieses fotometrische Filtersystem ermöglicht eine effiziente und zeitsparende Detektion der magnetischen CP Sterne auf Grund einer charakteristischen Flussdepression bei 520 nm. Im Vergleich zu Feldsternen bieten offene Sternhaufen den großen Vorteil, dass zum Beispiel das Alter und die Entfernung statistisch gesehen genauer bestimmt werden können. Der Grund dafür liegt in der mehr oder weniger gleichzeitigen Entstehung aller Mitglieder aus einer einzigen Molekülwolke. Nach der Analyse der Mitgliedswahrscheinlichkeit aller mittels Delta-a untersuchten Objekte und der Bestimmung der jeweiligen Sternhaufenparameter konnte gezeigt werden, dass eine Abhängigkeit zwischen der Anzahl von CP Sternen und deren Alter besteht. Allerdings konnte dies durch die allgemeine Sternentwicklung erklärt werden. Das würde unter anderem bedeuten, dass CP Sterne spätestens beim Erreichen der Hauptreihe bereits ihre typischen Eigenschaften zeigen. Des Weiteren konnte zumindest ein Vertreter dieser Gruppe gefunden werden, der sich vermutlich noch auf der Vorhauptreihe befindet. (author)
The Economic Value of Climate Science
Wielicki, B. A.; Cooke, R.; Young, D. F.; Mlynczak, M. G.
2012-12-01
While demonstrating the economic value of science is challenging, it can be more direct for some Earth observations. For example, suppose a climate science mission can yield decisive information on climate change within a shortened time frame. How much should society be willing to pay for this knowledge today? The US interagency memo on the social cost of carbon (SCC) provides a standard for valuing damages from carbon emissions. We illustrate how value of information (VOI) calculations can be used to monetize the relative value of different climate observations. We follow the SCC, stipulating uncertainty in climate sensitivity, using discount rates of 2.5%, 3% and 5%, and using one of the Integrated Assessment Models sanctioned in SCC (DICE, Nordhaus 2008). We consider three mitigation scenarios: Business as Usual (BAU), a moderate response (DICE Optimal), and a strong response (Stern). To illustrate results, suppose that we would switch from BAU to the Stern emissions path if we learn with 90% confidence that the decadal rate of temperature change reaches or exceeds 0.2 C/decade. Under the SCC assumptions, the year in which this happens, if it happens, depends on uncertain climate sensitivity and on the emissions path. The year in which we become 90% certain also depends on our Earth observations, their accuracy, and their completeness. The resolving power of a climate observing system cannot exceed climate system natural variability. All climate observations add noise to natural variability caused by observing limitations, including calibration errors and space/time sampling uncertainty. The basic concept is that more accurate observations can advance the time for societal decisions. The economic value of the resulting averted damages depends on the discount rate, and the years in which the damages occur. A new climate observation would be economically justified if the net present value (NPV) of the difference in averted damages, relative to the existing systems
Young surface of Pluto's Sputnik Planitia caused by viscous relaxation
Wei, Q.; Hu, Y.; Liu, Y.; Lin, D. N. C.; Yang, J.; Showman, A. P.
2017-12-01
The young surface of Pluto's Sputnik Planitia (SP) is one of the most prominent features observed by the New Horizon mission (Moore et al., 2016; Stern et al., 2015). No crater has been confirmed on the heart-shaped SP basin, in contrast to more than 5000 identified over comparable areas elsewhere (Robbins et al., 2016). The SP basin is filled with mostly N2 ice and small amount of CH4 and CO ice (Protopapa et al., 2017). Previous studies suggested that the SP surface might be renewed through vigorous thermal convection (McKinnon et al., 2016), and that the surface age may be as young as 500,000 years. In this paper, we present numerical simulations demonstrating that craters can be removed by rapid viscous relaxation of N2 ice over much shorter timescales. The crater retention age is less than 1000 years if the N2-ice thickness is several kilometers. McKinnon, W. B., Nimmo, F., Wong, T., Schenk, P. M., White, O. L., Roberts, J., . . . Umurhan, O. (2016). Convection in a volatile nitrogen-ice-rich layer drives Pluto's geological vigour. Nature, 534(7605), 82-85. Moore, J. M., McKinnon, W. B., Spencer, J. R., Howard, A. D., Schenk, P. M., Beyer, R. A., . . . White, O. L. (2016). The geology of Pluto and Charon through the eyes of New Horizons. Science, 351(6279), 1284-1293. Protopapa, S., Grundy, W. M., Reuter, D. C., Hamilton, D. P., Dalle Ore, C. M., Cook, J. C., . . . Young, L. A. (2017). Pluto's global surface composition through pixel-by-pixel Hapke modeling of New Horizons Ralph/LEISA data. Icarus, Volume 287, 218-228. doi:http://dx.doi.org/10.1016/j.icarus.2016.11.028Robbins, S. J., Singer, K. N., Bray, V. J., Schenk, P., Lauer, T. R., Weaver, H. A., . . . Porter, S. (2016). Craters of the Pluto-Charon system. Icarus. Stern, S. A., Bagenal, F., Ennico, K., Gladstone, G. R., Grundy, W. M., McKinnon, W. B., . . . Zirnstein, E. (2015). The Pluto system: Initial results from its exploration by New Horizons. Science, 350(6258), aad1815.
Directory of Open Access Journals (Sweden)
Rodolfo Notario
2011-08-01
Full Text Available Se compararon 8 aislamientos de Campylobacter jejuni provenientes de humanos con enfermedad diarreica aguda, con 23 aislamientos de cloaca de gallinas y pollos obtenidos de zonas próximas a la ciudad de Rosario, todos resistentes a la ciprofloxacina. Las muestras se sembraron en agar selectivo y se incubaron en microaerofilia a 42 °C. Las colonias se identificaron con el método tradicional. Los aislamientos se conservaron a -70 °C en caldo cerebro corazón con 17% v/v de glicerina. La clonalidad se determinó por RAPD-PCR, utilizando el primer 1254 (Stern NJ. Se interpretaron los aislamientos como clones distintos cuando diferían en una banda de amplificación. Se obtuvieron 5 clones diferentes. Los patrones I, II y V fueron aislados en criaderos industriales de pollos y en humanos (el II también en un establecimiento de gallinas ponedoras de huevos. En un gallinero familiar se obtuvo el patrón I. El patrón III sólo se obtuvo de humanos. El patrón IV se halló en uno de los criaderos pero no en humanos. Se pudo determinar que 93.5% de las cepas se aislaron tanto de animales como de humanos, por lo que se considera posible que la colonización de criaderos con cepas resistentes a los antimicrobianos pudiera ser el origen de la infección de humanos.Eight quinolone resistant Campylobacter jejuni strains isolated from humans with diarrheal disease were compared with 23 isolates from chicken and from laying hens. Samples were cultured on selective agar in microaerophilia, identified by conventional tests, and conserved in 17% glycerol at -70 °C. Clones were determined by RAPD-PCR employing the 1254 primer (Stern NJ. Five patterns were obtained. Patterns I, II, and V were found in both poultry and human isolates. Pattern I was obtained from poultry in a domestic henhouse. Pattern III was only obtained from humans whereas pattern IV was only obtained from poultry. A 95.3% of clones were found in both, humans and poultry. According to these
Using Mixed Methods and Collaboration to Evaluate an Education and Public Outreach Program (Invited)
Shebby, S.; Shipp, S. S.
2013-12-01
Traditional indicators (such as the number of participants or Likert-type ratings of participant perceptions) are often used to provide stakeholders with basic information about program outputs and to justify funding decisions. However, use of qualitative methods can strengthen the reliability of these data and provide stakeholders with more meaningful information about program challenges, successes, and ultimate impacts (Stern, Stame, Mayne, Forss, David & Befani, 2012). In this session, presenters will discuss how they used a mixed methods evaluation to determine the impact of an education and public outreach (EPO) program. EPO efforts were intended to foster more effective, sustainable, and efficient utilization of science discoveries and learning experiences through three main goals 1) increase engagement and support by leveraging of resources, expertise, and best practices; 2) organize a portfolio of resources for accessibility, connectivity, and strategic growth; and 3) develop an infrastructure to support coordination. The evaluation team used a mixed methods design to conduct the evaluation. Presenters will first discuss five potential benefits of mixed methods designs: triangulation of findings, development, complementarity, initiation, and value diversity (Greene, Caracelli & Graham, 2005). They will next demonstrate how a 'mix' of methods, including artifact collection, surveys, interviews, focus groups, and vignettes, was included in the EPO project's evaluation design, providing specific examples of how alignment between the program theory and the evaluation plan was best achieved with a mixed methods approach. The presentation will also include an overview of different mixed methods approaches and information about important considerations when using a mixed methods design, such as selection of data collection methods and sources, and the timing and weighting of quantitative and qualitative methods (Creswell, 2003). Ultimately, this presentation will
The search for Ar in the lunar atmosphere using the Lunar Reconnaissance Orbiter's LAMP instrument.
Cook, J. C.; Stern, S. A.; Feldman, P. D.; Gladstone, R.; Retherford, K. D.; Greathouse, T. K.; Grava, C.
2014-12-01
The Apollo 17 mass spectrometer, LACE, first measured mass 40 particles in the lunar atmosphere, and over a nine-month period, detected variations correlated with the lunar day (Hoffman et al., 1973, LPSC, 4, 2865). LACE detected a high particle density at dusk (0.6-1.0x104 cm-3), decreasing through the lunar night to a few hundred cm-3, then increasing rapidly before dawn to levels 2-4 times greater than at dusk. No daytime measurements were made due to instrument saturation. Given the LACE measurements' periodic nature, and the Ar abundance in lunar regolith samples (Kaiser, 1972, EPSL, 13, 387), it was concluded that mass 40 was likely due to Ar. Benna et al. (2014, LPSC, 45, 1535) recently reported that the Neutral Mass Spectrometer (NMS) aboard LADEE also detected Ar (mass 40) with similar diurnal profiles. We report on UV spectra of the lunar atmosphere as obtained by the Lunar Reconnaissance Orbiter (LRO). Aboard LRO is the UV-spectrograph, LAMP (Lyman Alpha Mapping Project), spanning the spectral range 575 to 1965 Å. LAMP is typically oriented toward the surface and has been mapping the Moon since September 2009. LAMP also observes the tenuous lunar atmosphere when the surface is in darkness, but the atmospheric column below LRO is illuminated. We have previously used nadir oriented twilight observations to examine the sparse lunar atmosphere (Feldman et al., 2012, Icarus, 221, 854; Cook et al., 2013, Icarus, 225, 681; Stern et al., 2013, Icarus, 226, 1210; Cook & Stern 2014, Icarus, 236, 48). In Cook et al., 2013, we reported an upper limit for Ar of 2.3x104 cm-3. Since then, we have collected additional data and refined our search method by focusing on the regions (near equator) and local times (dawn and dusk) where Ar has been reported previously. We have carefully considered effective area calibration and g-factor accuracies and find these to be unlikely explanations for the order of magnitude differences. We will report new results, which provide much
Generalized uncertainty principle and quantum gravity phenomenology
Bosso, Pasquale
The fundamental physical description of Nature is based on two mutually incompatible theories: Quantum Mechanics and General Relativity. Their unification in a theory of Quantum Gravity (QG) remains one of the main challenges of theoretical physics. Quantum Gravity Phenomenology (QGP) studies QG effects in low-energy systems. The basis of one such phenomenological model is the Generalized Uncertainty Principle (GUP), which is a modified Heisenberg uncertainty relation and predicts a deformed canonical commutator. In this thesis, we compute Planck-scale corrections to angular momentum eigenvalues, the hydrogen atom spectrum, the Stern-Gerlach experiment, and the Clebsch-Gordan coefficients. We then rigorously analyze the GUP-perturbed harmonic oscillator and study new coherent and squeezed states. Furthermore, we introduce a scheme for increasing the sensitivity of optomechanical experiments for testing QG effects. Finally, we suggest future projects that may potentially test QG effects in the laboratory.
Directory of Open Access Journals (Sweden)
Wolfgang Weinlich
2017-09-01
Full Text Available Die Arbeit ist dem klassischen Parallelismus von steinzeitlichen Bildfunden und frühen Kinderzeichnungen gewidmet. Ist ein solcher heute noch möglich? Der prähistorische Anfang von Bildsprache dürfte neuesten Forschungen zufolge länger zurückliegen als bisher angenommen. Der erste Teil der Arbeit widmet sich hierzu etwas ausführlicher den Funden und Interpretationen. Auf der Suche nach einem möglichen theoretischen Kontext für besagten Parallelismus kommentiert die Arbeit sodann die Ausdruckssemiologie Arno Sterns und die evolutionstheoretischen Anstrengungen Irenäus Eibl-Eibesfeldts. Fündig wird sie allerdings erst bei den Ausführungen Susan Petrillis zur Ikonizität von Sprache. Bei gleichzeitiger Zurückweisung verfänglicher Biologismen bietet die Arbeit so eine Hermeneutik, die jenen klassischen Parallelismus immer noch ermöglicht, jedoch nur als emphatische Affirmation von Anfang, Setzung und Autonomie menschlicher Bildsprache.
Algunas Reflexiones sobre Política Económica, 2012
Directory of Open Access Journals (Sweden)
Marilyn Waring
2012-03-01
Full Text Available Este artículo se centra en la importancia de la preservación del medio ambiente y critica el Informe de Stern, reconociendo los límites de la economía desde una perspectiva ética. No obstante, no es suficiente puesto que implica una mayor manipulación del mercado y el triunfo de los principios económicos sobre la defensa del medioambiente. Por el contrario, Elnor Ostrom, premio Nobel de economía ha demostrado que la cooperación es fundamental para la gestión de los recursos “comunales”. Igualmente, los melanesios de Vanuatu han desarrollado prácticas de supervivencia increíbles durante centurias. En el presente, se puede decir que padecen crisis, pero no la crisis económica actual como el resto del mundo desde el año 2008.
Song, Kai; Mo, Jingang; Lu, Chengwen
2017-05-15
This paper reported two nanocomposite sensing platforms for Hg(II) detection with improved photostability, using two rhodamine derivatives as chemosensors and up-conversion nanocrystals as excitation host, respectively. There existed a secondary energy transfer from this excitation host to these chemosensors, which was confirmed by spectral analysis, energy transfer radius calculation and emission decay lifetime comparison. In this case, chemosensor photostability was greatly improved. Further analysis suggested that these chemosensors recognized Hg(II) following a simple binding stoichiometry of 1:1. Hg(II) sensing performance of these sensing platforms was analyzed through their emission spectra upon various Hg(II) concentrations. Emission spectral response, Stern-Volmer equation, emission stability and sensing selectivity were discussed in detail. It was finally concluded that these chemosensors showed emission turn on effect towards Hg(II), with high photostability, good selectivity and linear response. Copyright © 2017 Elsevier B.V. All rights reserved.
Fernholz, H. H.; Krause, E.
Papers are presented on recent research concerning three-dimensional turbulent boundary layers. Topics examined include experimental techniques in three-dimensional turbulent boundary layers, turbulence measurements in ship-model flow, measurements of Reynolds-stress profiles in the stern region of a ship model, the effects of crossflow on the vortex-layer-type three-dimensional flow separation, and wind tunnel investigations of some three-dimensional separated turbulent boundary layers. Also examined are three-dimensional boundary layers in turbomachines, the boundary layers on bodies of revolution spinning in axial flows, the effect on a developed turbulent boundary layer of a sudden local wall motion, three-dimensional turbulent boundary layer along a concave wall, the numerical computation of three-dimensional boundary layers, a numerical study of corner flows, three-dimensional boundary calculations in design aerodynamics, and turbulent boundary-layer calculations in design aerodynamics. For individual items see A83-47012 to A83-47036
The interactions between CdTe quantum dots and proteins: understanding nano-bio interface
Directory of Open Access Journals (Sweden)
Shreeram S. Joglekar
2017-01-01
Full Text Available Despite remarkable developments in the nanoscience, relatively little is known about the physical (electrostatic interactions of nanoparticles with bio macromolecules. These interactions can influence the properties of both nanoparticles and the bio-macromolecules. Understanding this bio-interface is a prerequisite to utilize both nanoparticles and biomolecules for bioengineering. In this study, luminescent, water soluble CdTe quantum dots (QDs capped with mercaptopropionic acid (MPA were synthesized by organometallic method and then interaction between nanoparticles (QDs and three different types of proteins (BSA, Lysozyme and Hemoglobin were investigated by fluorescence spectroscopy at pH= 7.4. Based on fluorescence quenching results, Stern-Volmer quenching constant (Ksv, binding constant (Kq and binding sites (n for proteins were calculated. The results show that protein structure (e.g.,globular, metalloprotein, etc. has a significant role in Protein-Quantum dots interactions and each type of protein influence physicochemical properties of Quantum dots differently.
Azab, Hassan A.; Khairy, Gasser M.; Kamel, Rasha M.
2015-09-01
This work describes the application of time resolved fluorescence in microtiter plates for investigating the interactions of europium-allyl-3-carboxycoumarin with pesticides chlorpyrifos, endosulfan and crotoxyphos. Stern-Volmer studies at different temperatures for chlorpyrifos and crotoxyphos shows dynamic and static quenching mechanisms respectively. Direct methods for the determination of the pesticides under investigation have been developed using the luminescence variations of the probe in solution. The detection limits are 6.53, 0.004, 3.72 μmol/L for chlorpyrifos, endosulfan, and crotoxyphos, respectively. The binding constants and thermodynamic parameters of the pesticides with probe were evaluated. A thermodynamic analysis showed that the reaction is spontaneous with negative ΔG. Effect of some relevant interferents on the detection of pesticides has been investigated. The new method was applied to the determination of the pesticides in different types of water samples (tap, mineral, and waste water).
Renilson, Martin
2015-01-01
This book adopts a practical approach and presents recent research together with applications in real submarine design and operation. Topics covered include hydrostatics, manoeuvring, resistance and propulsion of submarines. The author briefly reviews basic concepts in ship hydrodynamics and goes on to show how they are applied to submarines, including a look at the use of physical model experiments. The issues associated with manoeuvring in both the horizontal and vertical planes are explained, and readers will discover suggested criteria for stability, along with rudder and hydroplane effectiveness. The book includes a section on appendage design which includes information on sail design, different arrangements of bow planes and alternative stern configurations. Other themes explored in this book include hydro-acoustic performance, the components of resistance and the effect of hull shape. Readers will value the author’s applied experience as well as the empirical expressions that are presented for use a...
Directory of Open Access Journals (Sweden)
Sayed Yahya Kazemi
2012-01-01
Full Text Available The present work deals with an attempt to study the effect of human and bovine serum albumin on kinetic parameters of chemiluminescence of luminol-hydrogen peroxide system catalyzed by manganese tetrasulfonatophenyl porphyrin (MnTSPP. The investigated parameters involved pseudo-first-order rise and fall rate constant for the chemiluminescence burst, maximum level intensity, time to reach maximum intensity, total light yield, and values of the intensity at maximum CL which were evaluated by nonlinear least square program KINFIT. Because of interaction of metalloporphyrin with proteins, the CL parameters are drastically affected. The systems resulted in Stern-Volmer plots with values of 3.17×105 and 3.7×105M−1 in the quencher concentration range of 1.5×10−6 to 1.5×10−5 M for human serum albumin (HSA and bovine serum albumin (BSA, respectively.
Guo, Jun; Zhong, Ruibo; Li, Wanrong; Liu, Yushuang; Bai, Zhijun; Yin, Jun; Liu, Jingran; Gong, Pei; Zhao, Xinmin; Zhang, Feng
2015-12-01
The nanostructures formed by inorganic nanoparticles together with organic molecules especially biomolecules have attracted increasing attention from both industries and researching fields due to their unique hybrid properties. In this paper, we systemically studied the interactions between amphiphilic polymer coated silver nanoparticles and bovine serum albumins by employing the fluorescence quenching approach in combination with the Stern-Volmer and Hill equations. The binding affinity was determined to 1.30 × 107 M-1 and the interaction was spontaneously driven by mainly the van der Waals force and hydrogen-bond mediated interactions, and negatively cooperative from the point of view of thermodynamics. With the non-uniform coating of amphiphilic polymer, the silver nanoparticles can form protein coronas which can become discrete protein-nanoparticle conjugates when controlling their molar ratios of mixing. The protein's conformational changes upon binding nanoparticles was also studied by using the three-dimensional fluorescence spectroscopy.
Magnetic properties of free alkali and transition metal clusters
International Nuclear Information System (INIS)
Heer, W. de; Milani, P.; Chatelain, A.
1991-01-01
The Stern-Gerlach deflections of small alkali clusters (N<6) and iron clusters (10< N<500) show that the paramagnetic alkali clusters always have a nondeflecting component, while the iron clusters always deflect in the high field direction. Both of these effects appear to be related to spin relaxation however in the case of alkali clusters it is shown that they are in fact caused by avoided level crossing in the Zeeman diagram. For alkali clusters the relatively weak couplings cause reduced magnetic moments where levels cross. For iron clusters however the total spin is strongly coupled to the molecular framework. Consequently this coupling is responsible for avoided level crossing which ultimately cause the total energy of the cluster to decrease with increasing magnetic field so that the iron clusters will deflect in one direction when introduced in an inhomogeneous magnetic field. Experiment and theory are discussed for both cases. (orig.)
Modifications of Control Loop to Improve the Depth Response of Autonomous Underwater Vehicles
Directory of Open Access Journals (Sweden)
Sheng-Ping Hsu
2014-01-01
Full Text Available During a constant depth maneuver of an autonomous underwater vehicle (AUV, its pitch attitude and stern plane deflections create forces and moments to achieve equilibrium in the vertical plane. If an AUV has a proportional controller only in its depth control loop, then different weights or centers of gravity will cause different steady-state depth errors at trimmed conditions. In general, a steady-state depth error can be eliminated by adding an integral controller in the depth control loop. However, an improper integrator may lead to a bad transient response, even though the steady-state depth error can finally be eliminated. To remove the steady-state depth error, this study proposes methods that adjust the depth command and add a switching integral controller in the depth control loop. Simulation results demonstrate that the steady-state depth error can be eliminated and the transient response can be improved.
Yang, Xiaozhou; Li, Yanxiao
2016-01-15
This paper reported a diamine ligand and its Re(I) complex for potential application in oxygen sensing. The novelty of this diamine ligand localized at its increased conjugation chain which had a typical electron-withdrawing group of 1,3,4-oxadiazole. Electronic distribution of excited electrons and their lifetime were supposed to be increased, favoring oxygen sensing collision. This hypothesis was confirmed by single crystal analysis, theoretical calculation and photophysical measurement. It was found that this Re(I) complex had a long-lived emission peaking at 545 nm, favoring sensing application. By doping this complex into a silica matrix MCM-41, oxygen sensing performance and mechanism of the resulting composites were discussed in detail. Non-linear Stern-Volmer working curves were observed with maximum sensitivity of 5.54 and short response time of ~6 s. Copyright © 2015 Elsevier B.V. All rights reserved.
Y2O3: Eu,Zn nanocrystals as a fluorescent probe for the detection of biotin
International Nuclear Information System (INIS)
Ganjkhanlou, Y.; Hosseinnia, A.; Kazemzad, M.; Khanlarkhani, A.; Moghaddam, A.B.
2012-01-01
We report on the application of nanocrystals (NCs) of the type Y 2 O 3 : Eu,Zn as a probe for the fluorescent detection of biotin in aqueous solution. The NCs were dispersed in water in the presence of various surface modifiers including mercaptoethanol (ME), monoethanolamine and ethylene glycol. Both the absorbance of surfactant and the stability of the suspensions were investigated in order to optimize the experimental conditions. ME is found to be the most suitable surfactant for stabilization of the suspended NCs. Their photoluminescence intensity is found to be quenched by biotin. The Stern-Volmer constant for the quenching process is 7.6 x 10 3 M -1 . This NC probe can be applied to the detection of biotin in the 1-60 μM concentration range with detection limit of 1.89 μM. The possible mechanisms of quenching also are discussed. (author)
Salinas-Castillo, Alfonso; Morales, Diego P; Lapresta-Fernández, Alejandro; Ariza-Avidad, María; Castillo, Encarnación; Martínez-Olmos, Antonio; Palma, Alberto J; Capitan-Vallvey, Luis Fermin
2016-04-01
A portable reconfigurable platform for copper (Cu(II)) determination based on luminescent carbon dot (Cdots) quenching is described. The electronic setup consists of a light-emitting diode (LED) as the carbon dot optical exciter and a photodiode as a light-to-current converter integrated in the same instrument. Moreover, the overall analog conditioning is simply performed with one integrated solution, a field-programmable analog array (FPAA), which makes it possible to reconfigure the filter and gain stages in real time. This feature provides adaptability to use the platform as an analytical probe for carbon dots coming from different batches with some variations in luminescence characteristics. The calibration functions obtained that fit a modified Stern-Volmer equation were obtained using luminescence signals from Cdots quenching by Cu(II). The analytical applicability of the reconfigurable portable instrument for Cu(II) using Cdots has been successfully demonstrated in tap water analysis.
Directory of Open Access Journals (Sweden)
Hyoung Tae Kim
2016-01-01
Full Text Available The moderator system of CANDU, a prototype of PHWR (pressurized heavy-water reactor, has been modeled in multidimension for the computation based on CFD (computational fluid dynamics technique. Three CFD codes are tested in modeled hydrothermal systems of heavy-water reactors. Commercial codes, COMSOL Multiphysics and ANSYS-CFX with OpenFOAM, an open-source code, are introduced for the various simplified and practical problems. All the implemented computational codes are tested for a benchmark problem of STERN laboratory experiment with a precise modeling of tubes, compared with each other as well as the measured data and a porous model based on the experimental correlation of pressure drop. Also the effect of turbulence model is discussed for these low Reynolds number flows. As a result, they are shown to be successful for the analysis of three-dimensional numerical models related to the calandria system of CANDU reactors.
John Tyndall's religion: a fragment
Cantor, Geoffrey
2015-01-01
Both contemporaries and historians have focused on the high-profile 1874 Belfast Address in which John Tyndall was widely perceived as promulgating atheism. Although some historians have instead interpreted him as a pantheist or an agnostic, it is clear that any such labels do not accurately capture Tyndall's religious position throughout his life. By contrast, this paper seeks to chart Tyndall's religious journey from 1840 (when he was in his late teens) to the autumn of 1848 when he commenced his scientific studies at Marburg. Although he had been imbued with his father's stern conservative Irish Protestantism and opposition to Catholicism, as a youth he seems for a time to have been attracted to Methodism. Later, however, he questioned and rejected his father's religious views and was increasingly drawn to the more spiritual outlook of Ralph Waldo Emerson and Thomas Carlyle, along with a more radical attitude to politics.
Mentaliseringsbaseret behandling og musikterapi
Directory of Open Access Journals (Sweden)
Niels Hannibal
2013-06-01
Full Text Available Denne artikel behandler spørgsmålet, om mentaliseringsbaseret terapi er en metode der medfører et skift i terapeutisk forholdemåde for analytisk orienterede musikterapeuter i arbejde med patienter med personlighedsforstyrrelse. Artiklen skal ses om en del af den teoretiske integrationer af MBT i musikterapi med denne målgruppe. Artiklen ser på de forskrifter til mentaliseringsfremmende tiltag som Allan, Fonagy og Bateman (2010 beskriver. Artiklens konklusion er dels af MBT’s krav til forholdemåde og interventionsfokus er et skift i forhold til traditionel analytisk orienteret terapi, bl.a. i forhold til fokus på her og nu, og øget fokus på implicit relationel læring, men siger samtidig at musikterapi allerede lever op til og i forvejen anvender disse elementer i musikterapi qua ligheden mellem klinisk improvisation (Wigram 2004 og implicit relationel viden (Stern 2010.