Zn-10.2% Fe coating over carbon steel atmospheric corrosion resistance. Comparison with zinc coating
International Nuclear Information System (INIS)
Arnau, G.; Gimenez, E.; Rubio, M.V.; Saura, J.J.; Suay, J.J.
1998-01-01
Zn-10.2% Fe galvanized coating versus hot galvanized coating over carbon steel corrosion performance has been studied. Different periods of atmospheric exposures in various Valencia Community sites, and salt spray accelerated test have been done. Carbon steel test samples have been used simultaneously in order to classify exposure atmosphere corrosivity, and environmental exposure atmosphere characteristics have been analyzed. Corrosion Velocity versus environmental parameters has been obtained. (Author) 17 refs
Tank 241-AY-102 Secondary Liner Corrosion Evaluation - 14191
International Nuclear Information System (INIS)
Boomer, Kayle D.; Washenfelder, Dennis J.; Johnson, Jeremy M.
2014-01-01
In October 2012, Washington River Protection Solutions, LLC (WRPS) determined that the primary tank of 241-AY-102 (AY-102) was leaking. A number of evaluations were performed after discovery of the leak which identified corrosion from storage of waste at the high waste temperatures as one of the major contributing factors in the failure of the tank. The propensity for corrosion of the waste on the annulus floor will be investigated to determine if it is corrosive and must be promptly removed or if it is benign and may remain in the annulus. The chemical composition of waste, the temperature and the character of the steel are important factors in assessing the propensity for corrosion. Unfortunately, the temperatures of the wastes in contact with the secondary steel liner are not known; they are estimated to range from 45 deg C to 60 deg C. It is also notable that most corrosion tests have been carried out with un-welded, stress-relieved steels, but the secondary liner in tank AY-102 was not stress-relieved. In addition, the cold weather fabrication and welding led to many problems, which required repeated softening of the metal to flatten secondary bottom during its construction. This flame treatment may have altered the microstructure of the steel
Energy Technology Data Exchange (ETDEWEB)
WYRWAS RB; DUNCAN JB
2008-11-20
This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.
Directory of Open Access Journals (Sweden)
Jabłońska M.B.
2014-10-01
Full Text Available Since few years many research centres conducting research on the development of high-manganese steels for manufacturing of parts for automotive and railway industry. Some of these steels belong to the group of AHS possessing together with high strength a great plastic elongation, and an ideal uniform work hardening behavior. The article presents the dynamic mechanical properties of two types of high manganese austenitic steel with using a flywheel machine at room temperature with strain rates between 5×102÷3.5×103s?–1. It was found that the both studied steels exhibit a high sensitivity Rm to the strain rate. With increasing the strain rate from 5×102 to 3.5×103s?–1 the hardening dominates the process. The fracture analysis indicate that after dynamic test both steel is characterized by ductile fracture surfaces which indicate good plasticity of investigated steels.
TANK 241-AN-102 MULTI-PROBE CORROSION MONITORING SYSTEM PROJECT LESSONS LEARNED
International Nuclear Information System (INIS)
TAYLOR T; HAGENSEN A; KIRCH NW
2008-01-01
During 2007 and 2008, a new Multi-Probe Corrosion Monitoring System (MPCMS) was designed and fabricated for use in double-shell tank 241-AN-102. The system was successfully installed in the tank on May 1, 2008. The 241-AN-102 MPCMS consists of one 'fixed' in-tank probe containing primary and secondary reference electrodes, tank material electrodes, Electrical Resistance (ER) sensors, and stressed and unstressed corrosion coupons. In addition to the fixed probe, the 241-AN-102 MPCMS also contains four standalone coupon racks, or 'removable' probes. Each rack contains stressed and unstressed coupons made of American Society of Testing and Materials A537 CL1 steel, heat-treated to closely match the chemical and mechanical characteristics of the 241-AN-102 tank wall. These coupon racks can be removed periodically to facilitate examination of the attached coupons for corrosion damage. Along the way to successful system deployment and operation, the system design, fabrication, and testing activities presented a number of challenges. This document discusses these challenges and lessons learned, which when applied to future efforts, should improve overall project efficiency
Corrosion resistance of hsla steel after various surface treatments in chloride environment
Czech Academy of Sciences Publication Activity Database
Borko, K.; Pastorek, F.; Fintová, Stanislava; Hadzima, B.
2016-01-01
Roč. 18, č. 4 (2016), s. 99-102 ISSN 1335-4205 Institutional support: RVO:68081723 Keywords : Corrosion properties * Iron phosphating * S355J steel Subject RIV: JK - Corrosion ; Surface Treatment of Materials
Nondestructive evaluation of low carbon steel by magnetic adaptive testing
Czech Academy of Sciences Publication Activity Database
Vértesy, G.; Tomáš, Ivan; Kobayashi, S.
2010-01-01
Roč. 25, č. 2 (2010), s. 125-132 ISSN 1058-9759 R&D Projects: GA ČR GA102/06/0866; GA AV ČR 1QS100100508 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnetic NDE * magnetic adaptive testing * steel * magnetic hysteresis Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.771, year: 2010
Texture evolution in Fe-3% Si steel treated under unconventional annealing conditions
Czech Academy of Sciences Publication Activity Database
Stoyka, V.; Kováč, F.; Stupakov, Oleksandr; Petryshynets, I.
2010-01-01
Roč. 61, č. 11 (2010), 1066-1073 ISSN 1044-5803 R&D Projects: GA ČR GP102/09/P108 Institutional research plan: CEZ:AV0Z10100520 Keywords : grain oriented steels * annealing * abnormal grain growth * crystallographic texture * hysteresis losses * electron backscattering Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.496, year: 2010
Nanostructure and mechanical properties of heavily cold-drawn steel wires
International Nuclear Information System (INIS)
Yang, Y.S.; Bae, J.G.; Park, C.G.
2009-01-01
The effects of microstructure on the mechanical properties of the high-carbon steel wires were investigated. The wires were fabricated with carbon content of 0.82 and 1.02 wt.% and drawing strain from 4.12 to 4.32. The bending fatigue resistance and torsion ductility were measured by a Hunter fatigue tester and a torsion tester specially designed for fine wires. As the carbon content and drawing strain increased, the fatigue resistance and the torsional ductility of the steel wires decreased, and the tensile strength increased. To elucidate the causes of these behaviors, the microstructure in terms of lamellar spacing (λ P ), cementite thickness (t C ) and morphology of cementite was observed using transmission electron microscopy (TEM) and 3-dimensional atom probe (3-DAP).
Design review report, 241-S-102 cover plate review; TOPICAL
International Nuclear Information System (INIS)
ADAMS, M.R.
1998-01-01
The design for the cover plate and lead plate for shielding on 241-S-102 was reviewed on 10/21/98. All Review Comment Record comments were resolved to the satisfaction of the reviewers. Additional comments were taken during the meeting and were also resolved. A design calculation for the Radiological Design Review Screening was presented as criteria for the use of 1 inch lead plate. The review concluded that the use of 2 inch steel plate and 1 inch lead plate provided the required safety function required by HNF-SD-WM-810-001, 5.3.2.20, Basis for Interim Operation. The design was approved with the incorporated comments as recorded on RCR's and meeting minutes
Kim, Gi Hyun; Sohn, Il
2016-06-01
The kinetics of the high-temperature reaction between high-Al- and -Mn-containing steels and synthesized molten calcium silicate-based fluxes from 1623 K to 1643 K (1350 °C to 1370 °C) was studied. Cylindrical steel rods were rotated in the molten fluxes for 300 to 1200 seconds at various temperatures below the melting point of the steels. The rods were connected to a rheometer, and the initial reaction rates were estimated from the torque variations. The dissolution of the steel into the molten slag was correlated to the variation in torque. The kinetics of the reaction between the rods and the slag estimated from the torque and subsequently from the viscosity were confirmed from the mass balance and from the variation in the chemical compositions of the rods and the molten slags, respectively. The liquid-phase mass transfer coefficient of Al2O3 was calculated to be 1.14 × 10-2 cm/s at 1623 K (1350 °C) and 1.52 × 10-2 cm/s at 1633 K (1360 °C). The kinetics calculated assuming liquid-phase mass transfer control was observed to be similar to the aforementioned kinetics determined from the dynamic viscosity variations. On the basis of dimensionless analysis of the Sherwood number (Sh = 0.05·Re0.65Sc0.31), liquid-phase mass transfer from the metal/flux interface was observed to be the rate-controlling step.
Detection of tightly closed flaws by nondestructive testing (NDT) methods in steel and titanium
Rummel, W. D.; Rathke, R. A.; Todd, P. H., Jr.; Tedrow, T. L.; Mullen, S. J.
1976-01-01
X-radiographic, liquid penetrant, ultrasonic, eddy current and magnetic particle testing techniques were optimized and applied to the evaluation of 4340 steel (180 KSI-UTS) and 6Al-4V titanium (STA) alloy specimens. Sixty steel specimens containing a total of 176 fatigue cracks and 60 titanium specimens containing a total of 135 fatigue cracks were evaluated. The cracks ranged in length from .043 cm (0.017 inch) to 1.02 cm (.400 inch) and in depth from .005 cm (.002 inch) to .239 cm (.094 inch) for steel specimens. Lengths ranged from .048 cm (0.019 inch) to 1.03 cm (.407 inch) and depths from 0.010 cm (.004 inch) to .261 cm (0.103 inch) for titanium specimens. Specimen thicknesses were nominally .152 cm (0.060 inch) and 0.635 cm (0.250 inch) and surface finishes were nominally 125 rms. Specimens were evaluated in the "as machined" surface condition, after etch surface and after proof loading in a randomized inspection sequence.
49 CFR 1014.102 - Application.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Application. 1014.102 Section 1014.102 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE SURFACE TRANSPORTATION BOARD § 1014.102 Application...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...
45 CFR 2104.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...
29 CFR 1615.102 - Application.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Application. 1615.102 Section 1615.102 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON... COMMISSION AND IN ACCESSIBILITY OF COMMISSION ELECTRONIC AND INFORMATION TECHNOLOGY § 1615.102 Application...
45 CFR 1706.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...
7 CFR 959.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 959.102 Section 959.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulations General § 959.102 Communications. Unless otherwise provided in the order, or by specific direction...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Management. 541.102 Section 541.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND... Executive Employees § 541.102 Management. Generally, “management” includes, but is not limited to...
2010-10-01
... 46 Shipping 9 2010-10-01 2010-10-01 false Application. 507.102 Section 507.102 Shipping FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE FEDERAL MARITIME COMMISSION § 507.102 Application. This...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 16.102 Section 16.102 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.102 Application. This regulation (§§ 16...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 36.102 Section 36.102... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General § 36.102 Application. (a) General. This part applies to any... courses related to applications, licensing, certification, or credentialing for secondary or postsecondary...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application. 550.102 Section 550.102 Wildlife and Fisheries MARINE MAMMAL COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.102 Application. This part...
45 CFR 1214.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...
16 CFR 1028.102 - Definitions.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Definitions. 1028.102 Section 1028.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROTECTION OF HUMAN SUBJECTS § 1028.102... investigator and subject. “Private information” includes information about behavior that occurs in a context in...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Application. 28.102 Section 28.102 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.102 Application. This part...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 39.102 Section 39.102 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.102 Application. This part applies to...
45 CFR 2490.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 35.102 Section 35.102 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE BASIS OF DISABILITY IN STATE AND LOCAL GOVERNMENT SERVICES General § 35.102 Application. (a) Except as provided in paragraph (b) of this...
45 CFR 2301.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...
2010-01-01
... ASSISTANCE TO HIGH ENERGY COST COMMUNITIES RUS High Energy Cost Grant Program § 1709.102 Policy. (a) All high... 7 Agriculture 11 2010-01-01 2010-01-01 false Policy. 1709.102 Section 1709.102 Agriculture...). (b) RUS may give priority consideration to projects that benefit smaller rural communities...
2010-01-01
... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...
7 CFR 948.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 948.102 Section 948.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations General § 948.102 Communications. Unless otherwise provided in §§ 948.1 to 948.92...
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application. 410.102 Section 410.102 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.102 Application...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false State. 102.7 Section 102.7 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.7 State. The term State as used herein shall include the District of Columbia and all States, Territories, and possessions...
2010-01-01
...) NOTIFICATION OF POST-EMPLOYMENT RESTRICTIONS § 730.102 Definitions. Agency means an Executive agency as defined in 5 U.S.C. 105, but does not include the General Accounting Office. Senior executive means a member... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 730.102 Section 730.102...
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Discovery. 509.102 Section 509.102 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.102 Discovery. (a) In general. A party may take the deposition of an...
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Information. 935.102 Section 935.102 National... WAKE ISLAND CODE Criminal Actions § 935.102 Information. (a) Any offense may be prosecuted by a written information signed by the Island Attorney. However, if the offense is one for which issue of a citation is...
5 CFR 430.102 - Performance management.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Performance management. 430.102 Section 430.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Management § 430.102 Performance management. (a) Performance management is the...
48 CFR 4.102 - Contractor's signature.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor's signature. 4.102 Section 4.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.102 Contractor's signature. (a) Individuals. A contract with an...
Magnetic permeability of stainless steel for use in accelerator beam transport systems
International Nuclear Information System (INIS)
Wilson, N.G.; Bunch, P.
1991-01-01
High-vacuum beam transport tubes are being designed for use in an accelerator under development at Los Alamos. In areas such as weld-heat-affected zones, the tubes will require localized magnetic permeability of less than 1.02. Seven austenitic stainless steel candidates, 304L, 310, 316L, 317LN, 20Cb-3, Nitronic 33, and Nitronic 40, have been evaluated to determine their permeability in cold-worked, annealed, and weld-affected zones. 310 and 20Cb-3 showed permeability after welding of less than 1.01. 1 ref., 1 fig., 1 tab
5 CFR 847.102 - Regulatory structure.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 847.102 Section 847.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... INSTRUMENTALITIES General Provisions § 847.102 Regulatory structure. (a)(1) Subpart A of this part contains...
23 CFR 810.102 - Eligible projects.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...
5 CFR 10.2 - Accountability systems.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...
42 CFR 422.102 - Supplemental benefits.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...
7 CFR 1900.102 - Applicable law.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Trust fund. 280.102 Section 280.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) TECHNICAL STANDARDS AND CORRECTIVE ACTION REQUIREMENTS FOR OWNERS AND OPERATORS OF UNDERGROUND STORAGE TANKS (UST) Financial Responsibility § 280.102 Trust...
41 CFR 51-10.102 - Application.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...
20 CFR 653.102 - Job information.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job information. 653.102 Section 653.102... SERVICE SYSTEM Services for Migrant and Seasonal Farmworkers (MSFWs) § 653.102 Job information. All State agencies shall make job order information conspicuous and available to MSFWs in all local offices. This...
19 CFR 360.102 - Online registration.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Online registration. 360.102 Section 360.102... ANALYSIS SYSTEM § 360.102 Online registration. (a) In general. (1) Any importer, importing company, customs.... boxes will not be accepted. A user identification number will be issued within two business days...
22 CFR 102.8 - Reporting accidents.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting accidents. 102.8 Section 102.8... Accidents Abroad § 102.8 Reporting accidents. (a) To airline and Civil Aeronautics Administration... probably be the first to be informed of the accident, in which event he will be expected to report the...
21 CFR 102.5 - General principles.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false General principles. 102.5 Section 102.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION COMMON OR USUAL NAME FOR NONSTANDARDIZED FOODS General Provisions § 102.5 General principles. (a...
39 CFR 10.2 - Advisory service.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...
29 CFR 102.70 - Runoff election.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...
29 CFR 102.4 - Region; subregion.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Region; subregion. 102.4 Section 102.4 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.4 Region; subregion. The term region as used herein shall mean that part of the United States or any Territory thereof...
Sattari, Behnoosh; Shamanian, Morteza; Salimijazi, Farshid; Salehi, Mehdi
2018-02-01
A low-carbon steel sheet with a thickness of 5 mm was subjected to friction stir processing (FSP) by one to four different passes. The microstructures of different regions were characterized using the optical microscopy and electron backscatter diffraction. The Vickers micro-harness was measured at the distance of 200 μm below the processed surfaces. The influence of pass numbers (PNs) on wear resistance was studied in terms of coefficients of friction (CoFs), weight losses and wear rates. SEM topographies of the worn surfaces were also studied to evaluate the wear mechanisms. Microstructure observations showed that Widmänstatten ferrite plates were formed in stir zones (SZs) and heat affected zones. As PN increased, these grains were widened due to the increment of the carbon diffusivity and lengthened because of the high heat input and microstructure anisotropy. Besides, increasing the PN causes increasing of the hardness and wear resistance, simultaneously. Specifically, the wear rate in the SZ was reduced from 2.8 × 10-2 mm3 m-1 in base metal to 0.3 × 10-2 mm3 m-1 in sample which was subjected to 4 FSP passes. However, variation in PN had no considerable effect on CoFs. Oxidative wear mechanism was observed on the worn surface of the steel and the FSPed samples while more debris was formed by increasing the PNs.
16 CFR 1034.102 - Application.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Application. 1034.102 Section 1034.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... Application. This part applies to all programs or activities conducted by the agency. ...
47 CFR 25.102 - Station authorization required.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station authorization required. 25.102 Section 25.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS General § 25.102 Station authorization required. (a) No person shall use or operate...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 26.102 Section 26.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA...) Human subject means a living individual about whom an investigator (whether professional or student...
18 CFR 376.102 - Organization.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Organization. 376.102... OF ENERGY REVISED GENERAL RULES ORGANIZATION, MISSION, AND FUNCTIONS; OPERATIONS DURING EMERGENCY CONDITIONS Organization, Mission, and Functions § 376.102 Organization. The Commission is established as an...
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...
42 CFR 93.102 - Applicability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
42 CFR 102.74 - Disapproval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 185.102 Section 185.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., or accounting or bookkeeping entry made: (a) With respect to a claim or to obtain the approval or...
41 CFR 109-27.102-1 - Applicability.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...
41 CFR 109-27.102-51 - Policy.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...
7 CFR 3560.102 - Housing project management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Housing project management. 3560.102 Section 3560.102... § 3560.102 Housing project management. (a) General. Borrowers hold final responsibility for housing project management and must ensure that operations comply with the terms of all loan or grant documents...
29 CFR 102.104 - Withdrawal of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Withdrawal of petition. 102.104 Section 102.104 Labor... Orders and Advisory Opinions Regarding Board Jurisdiction § 102.104 Withdrawal of petition. The petitioner may withdraw his petition at any time prior to issuance of the Board's advisory opinion. ...
29 CFR 784.102 - General legislative history.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...
41 CFR 101-27.102-2 - Guidelines.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...
Mansouri, Hamidreza; Alavi, Seyed Abolhasan; Fotovat, Meysam
2015-07-01
The microbial corrosion behavior of three important steels (carbon steel, stainless steel, and Corten steel) was investigated in semi petroleum medium. This work was done in modified nutrient broth (2 g nutrient broth in 1 L oily wastewater) in the presence of Pseudomonas aeruginosa and mixed culture (as a biotic media) and an abiotic medium for 2 weeks. The behavior of corrosion was analyzed by spectrophotometric and electrochemical methods and at the end was confirmed by scanning electron microscopy. The results show that the degree of corrosion of Corten steel in mixed culture, unlike carbon steel and stainless steel, is less than P. aeruginosa inoculated medium because some bacteria affect Corten steel less than other steels. According to the experiments, carbon steel had less resistance than Corten steel and stainless steel. Furthermore, biofilm inhibits separated particles of those steels to spread to the medium; in other words, particles get trapped between biofilm and steel.
EDF program on SCC initiation of cold-worked stainless steels in primary water
Energy Technology Data Exchange (ETDEWEB)
Huguenin, P.; Vaillant, F.; Couvant, T. [Electricite de France (EDF/RD), Site des Renardieres, 77 - Moret sur loing (France); Buisse, L. [EDF UTO, 93 - Noisy-Le-Grand (France); Huguenin, P.; Crepin, J.; Duhamel, C.; Proudhon, H. [MINES ParisTech, Centre des Materiaux, 91 - Evry (France); Ilevbare, G. [EPRI California (United States)
2009-07-01
A few cases of Intergranular Stress Corrosion Cracking (IGSCC) on cold-worked austenitic stainless steels in primary water have been detected in French Pressurized Water Reactors (PWRs). A previous program launched in the early 2000's identified the required conditions for SCC of cold-worked stainless steels. It was found that a high strain hardening coupled with cyclic loading favoured SCC, whereas cracking under static conditions appeared to be difficult. A propagation model was also proposed. The first available results of the present study demonstrate the strong influence of a trapezoidal cyclic loading on the creep of 304L austenitic stainless steel. While no creep was detected under a pure static loading, the creep rate was increased by a factor 102 under a trapezoidal cyclic loading. The first results of SCC initiation performed on notched specimens under a trapezoidal cyclic loading at low frequency are presented. The present study aims at developing an engineering model for IGSCC initiation of 304L, 316L and weld 308L stainless steels. The effect of the pre-straining on the SCC mechanisms is more specifically studied. Such a model will be based on (i) SCC initiation tests on notched and smooth specimens under 'trapezoidal' cyclic loading and, (ii) constant strain rate SCC initiation tests. The influence of stress level, cold-work level, strain path, surface roughness and temperature is particularly investigated. (authors)
29 CFR 102.116 - Signature of orders.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Signature of orders. 102.116 Section 102.116 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Certification and Signature of Documents § 102.116 Signature of orders. The executive secretary or the associate executive...
28 CFR 34.102 - Peer review procedures.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Peer review procedures. 34.102 Section 34.102 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.102 Peer review procedures. The OJJDP peer review process is contained in an OJJDP “Peer...
42 CFR 413.102 - Compensation of owners.
2010-10-01
...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...
29 CFR 102.138 - Definition of meeting.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 17.102 Section 17.102 Money and Finance: Treasury Office of the Secretary of the Treasury ENFORCEMENT OF NONDISCRIMINATION ON... Application. This part applies to all programs or activities conducted by the agency, except for programs or...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 901.102 Section... REGULATIONS SYSTEM Purpose, Authority, Issuance 901.102 Authority. The DEAR and amendments thereto are issued... the authority of section 644 of the Department of Energy Organization Act (42 U.S.C. 7254), section...
Energy Technology Data Exchange (ETDEWEB)
Lima, M.N.S.; Andrade, C.D.; Abreu, H.F.G. de; Klug, J.; Masoumi, M., E-mail: mohammad@alu.ufc.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Depto. de Engenharia Metalurgica e de Materiais; Ferreira, W.M. [Universidade Federal do Piaui (UFPI), Teresina, PI (Brazil). Curso de Engenharia Mecanica
2016-07-01
Microstructure and texture evolution were studied in two different austenitic high manganese cast steels in each processing condition. Special attention was paid to the effects of hot deformation and subsequent treatment on grain orientation behavior. The roles of Mn and C elements as well as heat treatment processes were investigated by Thermo-Calc. The texture evolutions in the as-cast, solution heat treatment, as-rolled and subsequent treatment were explored via orientation distribution function. The results showed that face-centred cube austenite was developed in steels. Strong {110}<115> texture component was characterized in as-cast in both alloys. Then, the inhomogeneity microstructure and the pronounced microsegregations were removed by annealing and Brass {110}<112>, {110}<111> and {221}<102> components were formed. Finally, cube {001}<100> component was developed during hot rolling in samples. (author)
International Nuclear Information System (INIS)
Lima, M.N.S.; Andrade, C.D.; Abreu, H.F.G. de; Klug, J.; Masoumi, M.; Ferreira, W.M.
2016-01-01
Microstructure and texture evolution were studied in two different austenitic high manganese cast steels in each processing condition. Special attention was paid to the effects of hot deformation and subsequent treatment on grain orientation behavior. The roles of Mn and C elements as well as heat treatment processes were investigated by Thermo-Calc. The texture evolutions in the as-cast, solution heat treatment, as-rolled and subsequent treatment were explored via orientation distribution function. The results showed that face-centred cube austenite was developed in steels. Strong {110}<115> texture component was characterized in as-cast in both alloys. Then, the inhomogeneity microstructure and the pronounced microsegregations were removed by annealing and Brass {110}<112>, {110}<111> and {221}<102> components were formed. Finally, cube {001}<100> component was developed during hot rolling in samples. (author)
29 CFR 1650.102 - Delegation of authority.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Delegation of authority. 1650.102 Section 1650.102 Labor... for the Collection of Debts by Salary Offset § 1650.102 Delegation of authority. The Chair delegated to the Chief Human Capital Officer the authority to collect debts owed by current EEOC employees, and...
10 CFR 611.102 - Eligible project costs.
2010-01-01
... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...
2009-02-19
component usage. PH 13-8Mo is a precipitation-hardenable martensitic stainless steel combining excellent corrosion resistance with strength. Custom 465 is...a martensitic , age-hardenable stainless steel capable of about 1,724 MPa (250 ksi) UTS when peak-aged (H900 condition). Especially, this steel can...NOTES 14. ABSTRACT Five high strength steels (4340, 300M, AerMet 100, Ferrium S53, and Hy-Tuf) and four stainless steels (High Nitrogen, 13
Chakrabarti, A K
2014-01-01
"Steel Making" is designed to give students a strong grounding in the theory and state-of-the-art practice of production of steels. This book is primarily focused to meet the needs of undergraduate metallurgical students and candidates for associate membership examinations of professional bodies (AMIIM, AMIE). Besides, for all engineering professionals working in steel plants who need to understand the basic principles of steel making, the text provides a sound introduction to the subject.Beginning with a brief introduction to the historical perspective and current status of steel making together with the reasons for obsolescence of Bessemer converter and open hearth processes, the book moves on to: elaborate the physiochemical principles involved in steel making; explain the operational principles and practices of the modern processes of primary steel making (LD converter, Q-BOP process, and electric furnace process); provide a summary of the developments in secondary refining of steels; discuss principles a...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Policy. 0.102 Section 0.102 Money and Finance: Treasury Office of the Secretary of the Treasury DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF... is not limited to: (1) Reassignment of work duties; (2) Disqualification from a particular assignment...
42 CFR 102.73 - Approval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...
Dynamic Strain Aging Phenomena and Tensile Response of Medium-Mn TRIP Steel
Field, Daniel M.; Van Aken, David C.
2018-04-01
Dynamic strain aging (DSA) and rapid work hardening are typical behaviors observed in medium-Mn transformation-induced plasticity (TRIP) steel. Three alloys with manganese ranging from 10.2 to 13.8 wt pct with calculated room temperature stacking fault energies varying from - 2.1 to 0.7 mJ/m2 were investigated. Significant serrations were observed in the stress-strain behavior for two of the steels and the addition of 4.6 wt pct chromium was effective in significantly reducing the occurrence of DSA. Addition of chromium to the alloy reduced DSA by precipitation of M23(C,N)6 during batch annealing at 873 K (600 °C) for 20 hours. Three distinct DSA mechanisms were identified: one related to manganese ordering in stacking faults associated with ɛ-martensite and austenite interface, with activation energies for the onset and termination of DSA being 145 and 277 kJ/mol. A second mechanism was associated with carbon diffusion in γ-austenite where Mn-C bonding added to the total binding energy, and activation energies of 88 and 155 kJ/mol were measured for the onset and termination of DSA. A third mechanism was attributed to dislocation pinning and unpinning by nitrogen in α-ferrite with activation energies of 64 and 123 kJ/mol being identified. Tensile behaviors of the three medium manganese steels were studied in both the hot band and batch annealed after cold working conditions. Ultimate tensile strengths ranged from 1310 to 1404 MPa with total elongation of 24.1 to 34.1 pct. X-ray diffraction (XRD) was used to determine the transformation response of the steels using interrupted tensile tests at room temperature. All three of the processed steels showed evidence of two-stage TRIP where γ-austenite first transformed to ɛ-martensite, and subsequently transformed to α-martensite.
2010-04-01
... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
20 CFR 655.102 - Special procedures.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Special procedures. 655.102 Section 655.102 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF... in force until modified by the Administrator. ...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire protection engineering? 102-80.90 Section 102-80.90 Public Contracts and Property Management Federal Property Management Regulations System...
Energy Technology Data Exchange (ETDEWEB)
Hansen, E
2005-03-31
The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).
47 CFR 32.102 - Nonregulated investments.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.102 Section 32.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... investments. Nonregulated investments shall include the investment in nonregulated activities that are...
5 CFR 880.102 - Regulatory structure.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 880.102 Section 880.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... Regulatory structure. (a) This part contains the following subparts: (1) Subpart A contains general...
38 CFR 13.102 - Accountability of legal custodians.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Accountability of legal custodians. 13.102 Section 13.102 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS VETERANS BENEFITS ADMINISTRATION, FIDUCIARY ACTIVITIES § 13.102 Accountability of legal custodians. (a...
18 CFR 284.102 - Transportation by interstate pipelines.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Transportation by interstate pipelines. 284.102 Section 284.102 Conservation of Power and Water Resources FEDERAL ENERGY... 1978 AND RELATED AUTHORITIES Certain Transportation by Interstate Pipelines § 284.102 Transportation by...
Effects of irradiation on tungsten stabilized martensitic steels*1
Gelles, D. S.; Hsu, C. Y.; Lechtenberg, T. A.
1988-07-01
Tungsten stabilized martensitic stainless steels are being developed for fusion reactor first wall applications in order to lower retained radioactivity so as to permit shallow land burial after reactor decommissioning. Two such alloys have been designed, fabricated, fast neutron irradiated in FFTF and examined by transmission electron microscopy. The two compositions were Fe-7.5Cr-2.0W-0.17 C and Fe-10.2Cr-1.7W-0.3V-0.02C. Conditions examined included irradiation temperatures of 365, 426, 520 and 600°C to doses as high as 34 dpa. Small amounts of void swelling are found at the two lowest temperatures. It is demonstrated that levels of tungsten on the order of 2 wt% do not result in excessive intermetallic precipitation under these irradiation conditions.
29 CFR 1918.102 - Respiratory protection.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Respiratory protection. 1918.102 Section 1918.102 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... Respiratory protection. (See § 1918.1(b)(8)). [65 FR 40946, June 30, 2000] ...
24 CFR 984.102 - Program objectives.
2010-04-01
... education, employment, and business and social skills necessary to achieve self-sufficiency, as defined in... 984.102 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... SECTION 8 AND PUBLIC HOUSING FAMILY SELF-SUFFICIENCY PROGRAM General § 984.102 Program objectives. The...
13 CFR 102.41 - Other provisions.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Other provisions. 102.41 Section 102.41 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... the preservation of the constitutional principles of federalism and separation of powers. (d) Medical...
48 CFR 22.102-2 - Administration.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Administration. 22.102-2 Section 22.102-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION SOCIOECONOMIC... facilities, including requirements for workers in all occupations and skills from local labor market areas or...
Directory of Open Access Journals (Sweden)
Abida Begum
2008-01-01
Full Text Available The inhibition efficiency and synergistic behaviour of 10-4 M Atropine methochloride was carried out using mass loss and polarisation methods in the presence of (i metal ions, Ni2+ and Cu2+ between 10-2 M to 10-6 M concentrations, (ii different concentrations of metal ions and 10-3 M I-, 10-3 M Cl- and 10-3 M Br- solutions and (iii different metal ions, 10-3M I- and at three different temperatures. The analysis reveals that the inhibition efficiency of Atropine methochloride was maximum at 10-2 M in 5 hours of immersion period. Halides decreased the corrosion rate of mild steel in Sulphuric acid. The decrease is maximum with 10-3 M I-. As the temperature increased from 298K to 308K, the inhibition efficiency gradually decreased. The inhibitor was found to be effective up to 303K
41 CFR 109-27.102-50 - Systems contracting.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-50 Systems contracting. Systems contracting may... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Systems contracting. 109-27.102-50 Section 109-27.102-50 Public Contracts and Property Management Federal Property Management...
42 CFR 102.80 - Calculation of medical benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of medical benefits. 102.80 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.80 Calculation of medical benefits. In calculating medical benefits, the Secretary will take into consideration all reasonable costs for those...
37 CFR 102.9 - Business Information.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Business Information. 102.9... COMMERCE ADMINISTRATION DISCLOSURE OF GOVERNMENT INFORMATION Freedom of Information Act § 102.9 Business Information. (a) In general. Business information obtained by USPTO from a submitter will be disclosed under...
41 CFR 102-117.200 - What is HAZMAT?
2010-07-01
... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...
26 CFR 1.102-1 - Gifts and inheritances.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Gifts and inheritances. 1.102-1 Section 1.102-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Items Specifically Excluded from Gross Income § 1.102-1 Gifts and inheritances...
42 CFR 102.82 - Calculation of death benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Calculation of death benefits. 102.82 Section 102... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.82 Calculation of death benefits. (a... paragraph (d) of this section for the death benefit available to dependents. (2) Deceased person means an...
Directory of Open Access Journals (Sweden)
Arnau, G.
1998-05-01
Full Text Available Zn-10.2 % Fe galvanized coating versus hot galvanized coating over carbon steel corrosion performance has been studied. Different periods of atmospheric exposures in various Valencia Community sites, and salt spray accelerated test have been done. Carbon steel test samples have been used simultaneously in order to classify exposure atmosphere corrosivity, and environmental exposure atmosphere characteristics have been analyzed. Corrosion velocity versus environmental parameters has been obtained.
Se estudia el comportamiento a la corrosión atmosférica de un recubrimiento Zn-10,2 % Fe galvanizado en caliente, comparándolo con el comportamiento ofrecido por la chapa galvanizada, habiéndose aplicado ambos recubrimientos sobre chapa de acero de embutición. Se han realizado ensayos de exposición atmosférica en distintas atmósferas de la Comunidad Valenciana y ensayos acelerados de laboratorio en cámara de niebla salina. Se han empleado simultáneamente probetas testigo de acero con el fin de clasificar la corrosividad de las atmósferas, y se han estudiado las características medioambientales de las atmósferas donde se han llevado a cabo los ensayos. Mediante estos estudios se han obtenido las velocidades de corrosión y se han analizado en función de los parámetros ambientales.
9 CFR 3.102 - Facilities, indoor.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Facilities, indoor. 3.102 Section 3... Marine Mammals Facilities and Operating Standards § 3.102 Facilities, indoor. (a) Ambient temperature. The air and water temperatures in indoor facilities shall be sufficiently regulated by heating or...
42 CFR 102.33 - Death benefits.
2010-10-01
... PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM... are described in § 102.82. As provided in § 102.84, the Secretary retains the right to recover death... secondary to disability benefits under the PSOB Program. Any death benefit paid under the standard...
Zhou, Ling-ling; Zhang, Yong-ji; Li, Xing; Li, Gui-bai
2008-12-01
Two rotating annular bioreactors (RABs) with copper and stainless steel pipe materials were adopted in the study, the effects of these two pipe materials and chloramines disinfection on biofilms formation in drinking water distribution system were evaluated. The maximum viable bacterial number in biofilm of copper and stainless steel reached 5.5 x 10(3) CFU/cm2 and 2.5 x 10(5) CFU/cm2 at 18th and 21st day without chloramines, and the viable bacterial number at the apparent steady state was 1.0 x 10(3) CFU/cm2 and 1.3 x 10(5) CFU/cm2 respectively. It was obvious that the biomass on copper materials was lower than that of the stainless steel. The maximum viable bacterial on copper and stainless steel under chloramines was 5.0 x 10(2) CFU/cm2 and 5.0 x 10(4) CFU/cm2, which was one order of magnitude lower than that of without chloramines, and its number was 10 CFU/cm2 and 3.5 x 10(4) CFU/cm2 at the steady state. These results illustrated that chloramines had apparent ability in controlling biomass when the biofilm was on steady states, especially for copper material. There was exponential relationship between biomass in biofilm and residue chloramines, which meant less biomass with more chloramines, synergistic effects were observed between chloramines and copper materials on biomass in biofilms inactivation.
19 CFR 102.23 - Origin and Manufacturer Identification
2010-04-01
... Section 102.23 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY... address of the entity performing the origin-conferring operations pursuant to § 102.21 or § 102.22, as... product from CBP custody will be denied until a determination of the country of origin is made based upon...
42 CFR 102.83 - Payment of all benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Payment of all benefits. 102.83 Section 102.83... COMPENSATION PROGRAM Calculation and Payment of Benefits § 102.83 Payment of all benefits. (a) The Secretary may pay any benefits under this Program through lump-sum payments. If the Secretary determines that...
12 CFR 263.102 - Prevailing party.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...
40 CFR 133.102 - Secondary treatment.
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Secondary treatment. 133.102 Section... TREATMENT REGULATION § 133.102 Secondary treatment. The following paragraphs describe the minimum level of effluent quality attainable by secondary treatment in terms of the parameters—BOD5, SS and pH. All...
27 CFR 44.102 - Change in trade name.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in trade name. 44.102 Section 44.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Warehouse Proprietors Changes in Name § 44.102 Change in trade name. Where there is a change in, or an...
29 CFR 1926.102 - Eye and face protection.
2010-07-01
... spectacles, when required by this regulation to wear eye protection, shall be protected by goggles or... 29 Labor 8 2010-07-01 2010-07-01 false Eye and face protection. 1926.102 Section 1926.102 Labor... § 1926.102 Eye and face protection. (a) General. (1) Employees shall be provided with eye and face...
42 CFR 84.102 - Man test 6; requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test 6; requirements. 84.102 Section 84.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Self-Contained Breathing Apparatus § 84.102 Man test 6; requirements....
Energy Technology Data Exchange (ETDEWEB)
Choi, So Young; Kim, Jong Do [Korea Maritime and Ocean University, Busan (Korea, Republic of); Kim, Jong Su [Korea Institute of Machinery and Materials, Daejeon (Korea, Republic of)
2015-01-15
This study was conducted to compare the laser weldability of boron steel and hot-stamped steel. In general, boron steel is used in the hot-stamping process. Hot-stamping is a method for simultaneously forming and cooling boron steel in a press die after heating it to the austenitizing temperature. Hot-stamped steel has a strength of 1500 MPa or more. Thus, in this study, the laser weldability of boron steel and that of hot-stamped steel were investigated and compared. A continuous wave disk laser was used to produce butt and lap joints. In the butt welding, the critical cooling speed at which full penetration was obtained in the hot-stamped steel was lower than that of boron steel. In the lap welding, the joint widths were similar regardless of the welding speed when full penetration was obtained.
International Nuclear Information System (INIS)
Choi, So Young; Kim, Jong Do; Kim, Jong Su
2015-01-01
This study was conducted to compare the laser weldability of boron steel and hot-stamped steel. In general, boron steel is used in the hot-stamping process. Hot-stamping is a method for simultaneously forming and cooling boron steel in a press die after heating it to the austenitizing temperature. Hot-stamped steel has a strength of 1500 MPa or more. Thus, in this study, the laser weldability of boron steel and that of hot-stamped steel were investigated and compared. A continuous wave disk laser was used to produce butt and lap joints. In the butt welding, the critical cooling speed at which full penetration was obtained in the hot-stamped steel was lower than that of boron steel. In the lap welding, the joint widths were similar regardless of the welding speed when full penetration was obtained
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public Index. 102.9 Section 102.9 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY Disclosure of... latest edition of SOP 40 03 from SBA's Online Reading Room at http://www.sba.gov/library or by requesting...
Connections: Superplasticity, Damascus Steels, Laminated Steels, and Carbon Dating
Wadsworth, Jeffrey
2016-12-01
In this paper, a description is given of the connections that evolved from the initial development of a family of superplastic plain carbon steels that came to be known as Ultra-High Carbon Steels (UHCS). It was observed that their very high carbon contents were similar, if not identical, to those of Damascus steels. There followed a series of attempts to rediscover how the famous patterns found on Damascus steels blades were formed. At the same time, in order to improve the toughness at room temperature of the newly-developed UHCS, laminated composites were made of alternating layers of UHCS and mild steel (and subsequently other steels and other metals). This led to a study of ancient laminated composites, the motives for their manufacture, and the plausibility of some of the claims relating to the number of layers in the final blades. One apparently ancient laminated composite, recovered in 1837 from the great pyramid of Giza which was constructed in about 2750 B.C., stimulated a carbon dating study of ancient steels. The modern interest in "Bladesmithing" has connections back to many of these ancient weapons.
33 CFR 401.102 - Civil penalty.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Civil penalty. 401.102 Section... TRANSPORTATION SEAWAY REGULATIONS AND RULES Penalties-Violations of Seaway Regulations § 401.102 Civil penalty. (a) A person, as described in § 401.101(b), who violates a regulation is liable to a civil penalty of...
48 CFR 232.102 - Description of contract financing methods.
2010-10-01
... financing methods. 232.102 Section 232.102 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 232.102 Description of contract financing methods. (e)(2) Progress payments...
Current status of stainless steel industry and development of stainless steel
International Nuclear Information System (INIS)
Lee, Yong Deuk; Lee, Chan Soo; Kim Kwang Tae
2000-01-01
Stainless steel is not only clean and smooth in its surface, but also it is superior in quality in terms of corrosion resistance and strength. So that, it is widely in use in the field of construction, chemical installations, and other industries. Growth of stainless steel industry started since the steel technology was developed for mass production in 1960s. Since then stainless steel industry grew rapidly on account of diversified development in this field and growth rate went up to 5.8% per year comparable to 2.3% of steel growth. The rapid growth is attributed to significant industry developments in Europe and Japan in the years of 1970s and 1980s. In addition to these the expansion of stainless steel industry in Korea and Taiwan. Presently Korea produces about 120,000 tons of stainless steel and occupies about 8% of international market. This means Korea become the second largest single country in world in stainless steel production. Moreover Korea is to reinforce its domestic production line by affiliating production companies, increasing of production capability, and specializing in types of stainless steel. This paper is to describe activity of material development, and types of stainless steel for industry use. (Hong, J. S.)
48 CFR 1432.102 - Description of contract financing methods.
2010-10-01
... financing methods. 1432.102 Section 1432.102 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 1432.102 Description of contract financing methods. Use of progress payments based on a percentage or stage...
48 CFR 932.102 - Description of contract financing methods.
2010-10-01
... financing methods. 932.102 Section 932.102 Federal Acquisition Regulations System DEPARTMENT OF ENERGY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 932.102 Description of contract financing methods. (e)(2) Progress payments based on a percentage or stage of...
48 CFR 1532.102 - Description of contract financing methods.
2010-10-01
... financing methods. 1532.102 Section 1532.102 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING General 1532.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are authorized for use as...
48 CFR 432.102 - Description of contract financing methods.
2010-10-01
... financing methods. 432.102 Section 432.102 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.102 Description of contract financing methods. Progress payments based on a percentage or stage of completion are...
48 CFR 32.102 - Description of contract financing methods.
2010-10-01
... financing methods. 32.102 Section 32.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.102 Description of contract financing methods. (a) Advance payments are advances of money by the Government to a...
Li, Y H; Yu, S F; Gu, G Z; Chen, G S; Zhou, W H; Wu, H; Jiao, J
2016-02-20
To investigate the factors influencing the electrocardiogram results in the workers exposed to noise in steel-making and steel rolling workshops of an iron and steel plant. From September to December, 2013, cluster sampling was used to select 3 150 workers exposed to noise in the steel-making and steel-rolling workshops of an iron and steel plant, and a questionnaire survey and physical examinations were performed. The number of valid workers was 2 915, consisting of 1 606 workers in the steel-rolling workshop and 1 309 in the steel-making workshop. The electrocardiogram results of the workers in steel-making and steel-rolling workshops were analyzed. The overall abnormal rate of electrocardiogram was 26.35%, and the workers in the steel-making workshop had a significantly higher abnormal rate of electrocardiogram than those in the steel-rolling workshop(32.24% vs 21.54%, Pelectrocardiogram than female workers(27.59% vs 18.61%, Pelectrocardiogram than those who did not drink(28.17% vs 23.75%, Pelectrocardiogram than those who were not exposed to high temperature(29.43% vs 20.14%, Pelectrocardiogram in the workers with cumulative noise exposure levels of electrocardiogram results. High cumulative noise exposure, alcohol consumption, and high temperature may affect the abnormal rate of electrocardiogram in the workers exposed to noise in steel-making and steel-rolling workshops.
Compactibility of atomized high-speed steel and steel 3 powders
International Nuclear Information System (INIS)
Kulak, L.D.; Gavrilenko, A.P.; Pikozh, A.P.; Kuz'menko, N.N.
1985-01-01
Spherical powders and powders of lammellar-scaly shape of high-speed R6M5K5 steel and steel 3 produced by the method of centrifugal atomization of a rotating billet under conditions of cold pressing in steel moulds are studied for thier compactability. Compacting pressure dependnences are establsihed for density of cold-pressed compacts of spherical and scaly powders. The powders of lammellar-scaly shape both of high-speed steel and steel 3 are found to possess better compactibility within a wide range of pressures as compared to powders of spherical shape. Compacts of the lammellar-scaly powders possess also higher mechanical strength
41 CFR 102-76.50 - What is sustainable development?
2010-07-01
... and Construction Sustainable Development § 102-76.50 What is sustainable development? Sustainable... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is sustainable development? 102-76.50 Section 102-76.50 Public Contracts and Property Management Federal Property Management...
Aslani, Farhad; Nejadi, Shami
2012-09-01
Steel fiber reinforced self-compacting concrete (SFRSCC) is a relatively new composite material which congregates the benefits of the self-compacting concrete (SCC) technology with the profits derived from the fiber addition to a brittle cementitious matrix. Steel fibers improve many of the properties of SCC elements including tensile strength, ductility, toughness, energy absorption capacity, fracture toughness and cracking. Although the available research regarding the influence of steel fibers on the properties of SFRSCC is limited, this paper investigates the bond characteristics between steel fiber and SCC firstly. Based on the available experimental results, the current analytical steel fiber pullout model (Dubey 1999) is modified by considering the different SCC properties and different fiber types (smooth, hooked) and inclination. In order to take into account the effect of fiber inclination in the pullout model, apparent shear strengths ( τ ( app)) and slip coefficient ( β) are incorporated to express the variation of pullout peak load and the augmentation of peak slip as the inclined angle increases. These variables are expressed as functions of the inclined angle ( ϕ). Furthurmore, steel-concrete composite floors, reinforced concrete floors supported by columns or walls and floors on an elastic foundations belong to the category of structural elements in which the conventional steel reinforcement can be partially replaced by the use of steel fibers. When discussing deformation capacity of structural elements or civil engineering structures manufactured using SFRSCC, one must be able to describe thoroughly both the behavior of the concrete matrix reinforced with steel fibers and the interaction between this composite matrix and discrete steel reinforcement of the conventional type. However, even though the knowledge on bond behavior is essential for evaluating the overall behavior of structural components containing reinforcement and steel fibers
International Nuclear Information System (INIS)
Zubchenko, A.S.; Borisov, V.P.; Latyshev, V.B.
1980-01-01
Corrosion resistant steel for production of sheets and tubes containing C, Mn, Cr, Si, Fe is suggested. It is alloyed with vanadium and cerium for improving tensile properties and ductility. The steel can be melted by a conventional method in electric-arc or induction furnaces. The mentioned steel is intended to be used as a substitute for nickel-bearing austenitic steels
41 CFR 102-117.5 - What is transportation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is transportation management? 102-117.5 Section 102-117.5 Public Contracts and Property Management Federal Property Management... General § 102-117.5 What is transportation management? Transportation management is agency oversight of...
41 CFR 109-27.102 - Economic order quantity principle.
2010-07-01
... PROCUREMENT 27-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102 Economic order quantity principle. ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Economic order quantity principle. 109-27.102 Section 109-27.102 Public Contracts and Property Management Federal Property...
25 CFR 39.102 - What is academic base funding?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What is academic base funding? 39.102 Section 39.102... PROGRAM Indian School Equalization Formula Base and Supplemental Funding § 39.102 What is academic base funding? Academic base funding is the ADM times the weighted student unit. ...
41 CFR 102-74.40 - What are concession services?
2010-07-01
... Management Concession Services § 102-74.40 What are concession services? Concession services are any food or... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are concession services? 102-74.40 Section 102-74.40 Public Contracts and Property Management Federal Property Management...
21 CFR 640.102 - Manufacture of Immune Globulin (Human).
2010-04-01
... 21 Food and Drugs 7 2010-04-01 2010-04-01 false Manufacture of Immune Globulin (Human). 640.102 Section 640.102 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES....102 Manufacture of Immune Globulin (Human). (a) Processing method. The processing method shall be one...
41 CFR 101-27.102-1 - Applicability.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Applicability. 101-27.102-1 Section 101-27.102-1 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 27-INVENTORY MANAGEMENT 27.1...
5 CFR 179.102 - Delegation of authority.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Delegation of authority. 179.102 Section... COLLECTION STANDARDS General Provisions and Administration § 179.102 Delegation of authority. (a) The Chief... Disability Fund, the Employees' Life Insurance Fund, the Retired Federal Employees Health Benefits Act (74...
5 CFR 6201.102 - Prohibited financial interests.
2010-01-01
... Section 6201.102 Administrative Personnel EXPORT-IMPORT BANK OF THE UNITED STATES SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE EXPORT-IMPORT BANK OF THE UNITED STATES § 6201.102 Prohibited...) All exporters that, during the preceding two fiscal years, exported an aggregate dollar volume of...
30 CFR 219.102 - Method of payment.
2010-07-01
... writing to the Minerals Management Service, Minerals Revenue Management, P.O. Box 5760, Denver, Colorado... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 219.102 Section 219.102 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT...
Pauliuk, Stefan; Milford, Rachel L; Müller, Daniel B; Allwood, Julian M
2013-04-02
Steel production accounts for 25% of industrial carbon emissions. Long-term forecasts of steel demand and scrap supply are needed to develop strategies for how the steel industry could respond to industrialization and urbanization in the developing world while simultaneously reducing its environmental impact, and in particular, its carbon footprint. We developed a dynamic stock model to estimate future final demand for steel and the available scrap for 10 world regions. Based on evidence from developed countries, we assumed that per capita in-use stocks will saturate eventually. We determined the response of the entire steel cycle to stock saturation, in particular the future split between primary and secondary steel production. During the 21st century, steel demand may peak in the developed world, China, the Middle East, Latin America, and India. As China completes its industrialization, global primary steel production may peak between 2020 and 2030 and decline thereafter. We developed a capacity model to show how extensive trade of finished steel could prolong the lifetime of the Chinese steelmaking assets. Secondary steel production will more than double by 2050, and it may surpass primary production between 2050 and 2060: the late 21st century can become the steel scrap age.
29 CFR 102.115 - Certification of papers and documents.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Certification of papers and documents. 102.115 Section 102... Certification and Signature of Documents § 102.115 Certification of papers and documents. The executive... Board in his place and stead shall certify copies of all papers and documents which are a part of any of...
Preparation and characterization of 304 stainless steel/Q235 carbon steel composite material
Directory of Open Access Journals (Sweden)
Wenning Shen
Full Text Available The composite material of 304 stainless steel reinforced Q235 carbon steel has been prepared by modified hot-rolling process. The resulted material was characterized by scanning electron microscope, three-electrode method, fault current impact method, electrochemical potentiodynamic polarization curve measurement and electrochemical impedance spectroscopy. The results showed that metallurgical bond between the stainless steel layer and carbon steel substrate has been formed. The composite material exhibited good electrical conductivity and thermal stability. The average grounding resistance of the composite material was about 13/20 of dip galvanized steel. There has no surface crack and bubbling formed after fault current impact. The composite material led to a significant decrease in the corrosion current density in soil solution, compared with that of hot dip galvanized steel and bare carbon steel. On the basis polarization curve and EIS analyses, it can be concluded that the composite material showed improved anti-corrosion property than hot-dip galvanized steel. Keywords: Stainless steel, Carbon steel, Anti-corrosion, Conductivity, Electrochemical, EIS
48 CFR 1.102-3 - Acquisition team.
2010-10-01
... service. By identifying the team members in this manner, teamwork, unity of purpose, and open... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Acquisition team. 1.102-3... ACQUISITION REGULATIONS SYSTEM Purpose, Authority, Issuance 1.102-3 Acquisition team. The purpose of defining...
Difference in Neutropenia due to Administration Schedule of TAS-102
Directory of Open Access Journals (Sweden)
Yoichiro Yoshida
2017-03-01
Full Text Available TAS-102 significantly improves overall survival in patients with metastatic colorectal cancer. The most common adverse event of TAS-102 is bone marrow suppression, which leads to neutropenia. The incidence of neutropenia is high, and there is no known effective prevention method. Furthermore, the administration method of TAS-102 is complicated. We reported that neutropenia could be avoided by changing to a simple administration method of TAS-102.
Ji, L. K.; Xu, T.; Zhang, J. M.; Wang, H. T.; Tong, M. X.; Zhu, R. H.; Zhou, G. S.
2017-07-01
Tensile properties of the high-deformability dual-phase ferrite-bainite X70 pipeline steel have been investigated at room temperature under the strain rates of 2.5 × 10-5, 1.25 × 10-4, 2.5 × 10-3, and 1.25 × 10-2 s-1. The microstructures at different amount of plastic deformation were examined by using scanning and transmission electron microscopy. Generally, the ductility of typical body-centered cubic steels is reduced when its stain rate increases. However, we observed a different ductility dependence on strain rates in the dual-phase X70 pipeline steel. The uniform elongation (UEL%) and elongation to fracture (EL%) at the strain rate of 2.5 × 10-3 s-1 increase about 54 and 74%, respectively, compared to those at 2.5 × 10-5 s-1. The UEL% and EL% reach to their maximum at the strain rate of 2.5 × 10-3 s-1. This phenomenon was explained by the observed grain structures and dislocation configurations. Whether or not the ductility can be enhanced with increasing strain rates depends on the competition between the homogenization of plastic deformation among the microconstituents (ultra-fine ferrite grains, relatively coarse ferrite grains as well as bainite) and the progress of cracks formed as a consequence of localized inconsistent plastic deformation.
49 CFR 24.102 - Basic acquisition policies.
2010-10-01
... valuation only if the offer to acquire the property is $10,000, or less. (See appendix A, § 24.102(n).) [70... Transportation Office of the Secretary of Transportation UNIFORM RELOCATION ASSISTANCE AND REAL PROPERTY ACQUISITION FOR FEDERAL AND FEDERALLY-ASSISTED PROGRAMS Real Property Acquisition § 24.102 Basic acquisition...
13 CFR 102.2 - Public reading rooms.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Public reading rooms. 102.2 Section 102.2 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE AND PRIVACY... described in paragraph (a) of this section are available in the SBA Online Reading Room at http://www.sba...
Aghajani, Hossein
2017-01-01
This book focuses on the effect of plasma nitriding on the properties of steels. Parameters of different grades of steels are considered, such as structural and constructional steels, stainless steels and tools steels. The reader will find within the text an introduction to nitriding treatment, the basis of plasma and its roll in nitriding. The authors also address the advantages and disadvantages of plasma nitriding in comparison with other nitriding methods. .
42 CFR 489.102 - Requirements for providers.
2010-10-01
..., nursing facilities, home health agencies, providers of home health care (and for Medicaid purposes... individual's admission as a resident. (3)(i) In the case of a home health agency, in advance of the... 42 Public Health 5 2010-10-01 2010-10-01 false Requirements for providers. 489.102 Section 489.102...
22 CFR 102.25 - Submission of comments.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Submission of comments. 102.25 Section 102.25 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION Recommendations to the... confidential in the interest of national defense or foreign policy, are to be placed in a public docket and...
International Nuclear Information System (INIS)
Zorev, N.N.; Astafiev, A.A.; Loboda, A.S.; Savukov, V.P.; Runov, A.E.; Belov, V.A.; Sobolev, J.V.; Sobolev, V.V.; Pavlov, N.M.; Paton, B.E.
1977-01-01
Steels also containing Al, N and arsenic, are suitable for the construction of large components for high-power nuclear reactors due to their good mechanical properties such as good through-hardening, sufficiently low brittleness conversion temperature and slight displacement of the latter with neutron irradiation. Defined steels and their properties are described. (IHOE) [de
DEFF Research Database (Denmark)
Højerslev, C.
2001-01-01
On designing a tool steel, its composition and heat treatment parameters are chosen to provide a hardened and tempered martensitic matrix in which carbides are evenly distributed. In this condition the matrix has an optimum combination of hardness andtoughness, the primary carbides provide...... resistance against abrasive wear and secondary carbides (if any) increase the resistance against plastic deformation. Tool steels are alloyed with carbide forming elements (Typically: vanadium, tungsten, molybdenumand chromium) furthermore some steel types contains cobalt. Addition of alloying elements...... serves primarily two purpose (i) to improve the hardenabillity and (ii) to provide harder and thermally more stable carbides than cementite. Assuming proper heattreatment, the properties of a tool steel depends on the which alloying elements are added and their respective concentrations....
Spectroscopy of the odd-odd chiral candidate nucleus 102Rh
Directory of Open Access Journals (Sweden)
Yavahchova M.S.
2014-03-01
Full Text Available Excited states in 102Rh were populated in the fusion-evaporation reaction 94Zr(11B, 3n102Rh at a beam energy of 36 MeV, using the INGA spectrometer at IUAC, New Delhi. The angular correlations and the electromagnetic character of some of the 03B3-ray transitions observed in 102Rh were investigated in detail. A new candidate for achiral twin band was identified in 102Rh for the first time.
29 CFR 102.125 - Action on petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Action on petition. 102.125 Section 102.125 Labor....125 Action on petition. Upon the filing of such petition, the Board shall consider the same and may thereupon either grant or deny the petition in whole or in part, conduct an appropriate hearing thereon, or...
Substitution of modified 9 Cr-1 Mo steel for austentic stainless steels
International Nuclear Information System (INIS)
Sikka, V.K.
1982-04-01
This report describes the current program to develop a high-strength ferritic-martensitic steel. The alloy is essentially Fe-9% Cr-1% Mo with small additions of V and Nb and is known as modifed 9 Cr-1 Mo steel. Its elevated-temperature properties and design allowable stresses match those of type 304 stainless steel for temperatures up to 600 0 C and exceed those of other ferritic steels by factors of 2 to 3. The improved strength of this alloy permits its use in place of stainless steels for many applications
Weldability of Stainless Steels
International Nuclear Information System (INIS)
Saida, Kazuyoshi
2010-01-01
It gives an outline of metallographic properties of welding zone of stainless steels, generation and mechanisms of welding crack and decreasing of corrosion resistance of welding zone. It consists of seven chapters such as introduction, some kinds of stainless steels and properties, metallographic properties of welding zone, weld crack, toughness of welding zone, corrosion resistance and summary. The solidification modes of stainless steels, each solidification mode on the cross section of Fe-Cr-Ni alloy phase diagram, each solidification mode of weld stainless steels metal by electron beam welding, segregation state of alloy elements at each solidification mode, Schaeffler diagram, Delong diagram, effects of (P + S) mass content in % and Cr/Ni equivalent on solidification cracking of weld stainless steels metal, solidification crack susceptibility of weld high purity stainless steels metal, effects of trace impurity elements on solidification crack susceptibility of weld high purity stainless steels metal, ductile fracture susceptibility of weld austenitic stainless steels metal, effects of H2 and ferrite content on generation of crack of weld 25Cr-5N duplex stainless steels, effects of O and N content on toughness of weld SUS 447J1 metals, effect of ferrite content on aging toughness of weld austenitic stainless steel metal, corrosion morphology of welding zone of stainless steels, generation mechanism of knife line attack phenomenon, and corrosion potential of some kinds of metals in seawater at room temperature are illustrated. (S.Y.)
24 CFR 1000.102 - What are eligible affordable housing activities?
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false What are eligible affordable housing activities? 1000.102 Section 1000.102 Housing and Urban Development Regulations Relating to... § 1000.102 What are eligible affordable housing activities? Eligible affordable housing activities are...
International Nuclear Information System (INIS)
Dhua, S.K.; Sen, S.K.
2011-01-01
Highlights: → Direct-quenched and tempered (DQT) steels gives better mechanical properties. → Fine Cu and Nb (C, N) precipitates enhance matrix strengthening and tempering resistance. → Boron promotes hardenability, but low temperature Charpy impact toughness gets affected. → Mechanical properties equivalent to HSLA-100 steel is achieved by directly quenched leaner chemistry alloys. - Abstract: The influence of direct quenching on structure-property behavior of lean chemistry HSLA-100 steels was studied. Two laboratory heats, one containing Cu and Nb (C:0.052, Mn:0.99, Cu:1.08, Nb:0.043, Cr:0.57, Ni:1.76, Mo:0.55 pct) and the other containing Cu, Nb and B (C:0.04, Mn:1.02, Cu:1.06, Nb:0.036, Cr:0.87, Ni:1.32, Mo:0.41, B:0.002 percent) were hot-rolled into 25 and 12.5 mm thick plates by varying finish-rolling temperatures. The plates were heat-treated by conventional reheat quenching and tempering (RQT), as well as by direct quenching and tempering (DQT) techniques. In general, direct-quench and tempered plates of Nb-Cu heat exhibited good strength (yield strength ∼ 900 MPa) and low-temperature impact toughness (average: 74 J at -85 deg. C); the Charpy V-notch impact energies were marginally lower than conventional HSLA-100 steel. In Nb-Cu-B heat, impact toughness at low-temperature was inferior owing to boron segregation at grain boundaries. Transmission electron microscopy (TEM) and scanning auger microprobe (SAM) analysis confirmed existence of borocarbides at grain boundaries in this steel. In general, for both the steels, the mechanical properties of the direct-quench and tempered plates were found to be superior to reheat quench and tempered plates. A detailed transmission electron microscopy study revealed presence of fine Cu and Nb (C, N) precipitates in these steels. It was also observed that smaller martensite inter-lath spacing, finer grains and precipitates in direct-quench and tempered plates compared to the reheat quench and tempered plates
41 CFR 102-79.105 - What is the Integrated Workplace?
2010-07-01
... changing needs of the occupants and the organization. Integrated Workplace concepts support the objectives... Workplace? 102-79.105 Section 102-79.105 Public Contracts and Property Management Federal Property... UTILIZATION OF SPACE Assignment and Utilization of Space Integrated Workplace § 102-79.105 What is the...
27 CFR 24.102 - Premises established for taxpaid wine operations.
2010-04-01
... taxpaid wine operations. 24.102 Section 24.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Premises and Operations § 24.102 Premises established for taxpaid wine operations. A person desiring to bottle...
Preparation and characterization of 304 stainless steel/Q235 carbon steel composite material
Shen, Wenning; Feng, Lajun; Feng, Hui; Cao, Ying; Liu, Lei; Cao, Mo; Ge, Yanfeng
The composite material of 304 stainless steel reinforced Q235 carbon steel has been prepared by modified hot-rolling process. The resulted material was characterized by scanning electron microscope, three-electrode method, fault current impact method, electrochemical potentiodynamic polarization curve measurement and electrochemical impedance spectroscopy. The results showed that metallurgical bond between the stainless steel layer and carbon steel substrate has been formed. The composite material exhibited good electrical conductivity and thermal stability. The average grounding resistance of the composite material was about 13/20 of dip galvanized steel. There has no surface crack and bubbling formed after fault current impact. The composite material led to a significant decrease in the corrosion current density in soil solution, compared with that of hot dip galvanized steel and bare carbon steel. On the basis polarization curve and EIS analyses, it can be concluded that the composite material showed improved anti-corrosion property than hot-dip galvanized steel.
Compresibility and sinterability of HCx PM steel diluted with stainless steels
Directory of Open Access Journals (Sweden)
Elena Gordo
2003-12-01
Full Text Available HCx powder metallurgy steel contains in its composition high contents of Cr and C, and significant quantities of alloy elements typical of tool steels (Mo, V, W, to provide the corrosion resistance of stainless steel with wear resistance of tool steels. HCx appears to be a suitable material for applications in aggressive environments, as valve seat inserts in automotive engines. However, this steel presents a low compressibility leading to high production costs. In this work, some results carried out to improve the compressibility of HCx are presented. The way to attempt this improvement is the dilution of base material with two stainless steels, the ferritic 430LHC and the austenitic 316L. The powder mixes prepared were uniaxially pressed to study the compressibility. The sinterability was study by determining of density, hardness, transverse rupture strength (TRS and microstructural evolution after vacuum sintering at different temperatures. As a result, better compressibility is observed in the mixes although not all of them present the properties required.
Packaging design criteria, transfer and disposal of 102-AP mixer pump
International Nuclear Information System (INIS)
Carlstrom, R.F.
1994-01-01
A mixer pump installed in storage tank 241-AP-102 (102-AP) has failed. This pump is referred to as the 102-AP mixer pump (APMP). The APMP will be removed from 102-AP 1 and a new pump will be installed. The main purpose of the Packaging Design Criteria (PDC) is to establish criteria necessary to design and fabricate a shipping container for the transfer and storage of the APMP from 102-AP. The PDC will be used as a guide to develop a Safety Evaluation for Packaging (SEP)
18 CFR 375.102 - Custody and authentication of Commission records.
2010-04-01
... authentication of Commission records. 375.102 Section 375.102 Conservation of Power and Water Resources FEDERAL... Provisions § 375.102 Custody and authentication of Commission records. (a) Custody of official records. (1...) Authentication of Commission action. All orders and other actions of the Commission shall be authenticated or...
41 CFR 102-72.40 - What are facility management delegations?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are facility management delegations? 102-72.40 Section 102-72.40 Public Contracts and Property Management Federal Property... AUTHORITY Delegation of Authority § 102-72.40 What are facility management delegations? Facility management...
Boron Steel: An Alternative for Costlier Nickel and Molybdenum Alloyed Steel for Transmission Gears
Directory of Open Access Journals (Sweden)
A. Verma
2010-06-01
Full Text Available Case Carburized (CC low carbon steels containing Ni, Cr and Mo alloying elements are widely used for transmission gears in automobile, as it possesses desired mechanical properties. In order to cut cost and save scarce materials like Ni and Mo for strategic applications, steel alloyed with Boron has been developed, which gives properties comparable to Ni-Cr-Mo alloyed steel. In the process of steel development, care was taken to ensure precipitation of boron which results in precipitation hardening. The characterization of the developed boron steel had exhibited properties comparable to Ni-Cr-Mo alloyed steel and superior to conventional boron steel.
Interaction model of steel ladle of continuous caster in steel works
Directory of Open Access Journals (Sweden)
Huang Bang Fu
2016-01-01
Full Text Available For further research on the precondition and interoperability model of interaction ladles among continuous caster, this article takes steel ladle of Y steel works as the object of research. On the basis of turnover number calculation model of single cast steel ladle, the relationship between cast number and the turnover number and turnover times and last turnover number are further analyzed. The simulation of steel ladle turnover rules was taken on the 2 continuous casters with Gantt chart. After that, the relationships between turnover number and last turnover number and non-turnover number are researched deeply. Combining with the Gantt chart, the expressions of start casting time and empty ladle ending time and heavy ladle starting time were put forward. The precondition of steel ladle interaction is obtained, which means the exchange ladle should not undertaking transport task in first stop continuous caster, and the empty ladle end time of exchange ladle of first stop continuous caster should early than the heavy ladle start time of last stop continuous caster. After applying the model to practice, 3 steel ladles of No.2 continuous caster can be reduced. This research results is supplying theoretical basis for steel ladle controlling and production organization optimization, and enriches the theory and method of metallurgical process integration.
41 CFR 102-192.10 - What authority governs this part?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.10 What authority governs this part? This part is governed by... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What authority governs this part? 102-192.10 Section 102-192.10 Public Contracts and Property Management Federal Property...
14 CFR 221.102 - Accessibility of tariffs to the public.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221.102 Section 221.102 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in complete...
Directory of Open Access Journals (Sweden)
Marcisz J.
2017-12-01
Full Text Available Changes in the microstructure of nanostructured bainitic steel induced by quasi-static and dynamic deformation have been shown in the article. The method of deformation and strain rate have important impact on the microstructure changes especially due to strain localization. Microstructure of nanostructured steel Fe-0.6%C-1.9Mn-1.8Si-1.3Cr-0.7Mo consists of nanometer size carbide-free bainite laths and 20-30% volume fraction of retained austenite. Quasi-static and dynamic (strain rate up to 2×102 s−1 compression tests were realized using Gleeble simulator. Dynamic deformation at the strain rate up to 9×103 s−1 was realized by the Split Hopkinson Pressure Bar method (SHPB. Moreover high energy firing tests of plates made of the nanostructured bainitic steel were carried out to produce dynamically deformed material for investigation. Adiabatic shear bands were found as a result of localization of deformation in dynamic compression tests and in firing tests. Microstructure of the bands was examined and hardness changes in the vicinity of the bands were determined. The TEM examination of the ASBs showed the change from the internal shear band structure to the matrix structure to be gradual. This study clearly resolved that the interior (core of the band has an extremely fine grained structure with grain diameter ranging from 100 nm to 200 nm. Martensitic twins were found within the grains. No austenite and carbide reflections were detected in the diffraction patterns taken from the core of the band. Hardness of the core of the ASBs for examined variants of isothermal heat treatment was higher about 300 HV referring to steel matrix hardness.
Tank 241-AZ-102 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters
7 CFR 330.102 - Basis for certain regulations.
2010-01-01
... of the Plant Protection Act, the Secretary may prohibit or restrict the importation, entry... 7 Agriculture 5 2010-01-01 2010-01-01 false Basis for certain regulations. 330.102 Section 330.102 Agriculture Regulations of the Department of Agriculture (Continued) ANIMAL AND PLANT HEALTH INSPECTION...
Age-hardening susceptibility of high-Cr ODS ferritic steels and SUS430 ferritic steel
Energy Technology Data Exchange (ETDEWEB)
Chen, Dongsheng, E-mail: chen.dongsheng85@gmail.com [Graduate School of Energy Science, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan); Kimura, Akihiko; Han, Wentuo; Je, Hwanil [Institute of Advanced Energy, Kyoto University, Gokasho, Uji, Kyoto 611-0011 (Japan)
2015-10-15
Highlights: • The role of oxide particles in α/α′ phase decomposition behavior; microstructure of phase decomposition observed by TEM. • The characteristics of ductility loss caused by age-hardening. • Correlation of phase decomposition and age-hardening explained by dispersion strengthened models. • Age-hardening susceptibility of ODS steels and SUS430 steel. - Abstract: The effect of aging on high-Cr ferritic steels was investigated with focusing on the role of oxide particles in α/α′ phase decomposition behavior. 12Cr-oxide dispersion strengthened (ODS) steel, 15Cr-ODS steel and commercial SUS430 steel were isothermally aged at 475 °C for up to 10,000 h. Thermal aging caused a larger hardening in SUS430 than 15Cr-ODS, while 12Cr-ODS showed almost no hardening. A characteristic of the ODS steels is that the hardening was not accompanied by the significant loss of ductility that was observed in SUS430 steel. After aging for 2000 h, SUS430 steel shows a larger ductile–brittle transition temperature (DBTT) shift than 15Cr-ODS steel, which suggests that the age-hardening susceptibility is lower in 15Cr-ODS steel than in conventional SUS430 steel. Thermal aging leaded to a large number of Cr-rich α′ precipitates, which were confirmed by transmission electron microscopy (TEM). Correlation of age-hardening and phase decomposition was interpreted by Orowan type strengthening model. Results indicate that oxide particles cannot only suppress ductility loss, but also may influence α/α′ phase decomposition kinetics.
32 CFR 644.102 - Examples of involuntary acquisitions.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Examples of involuntary acquisitions. 644.102... PROPERTY REAL ESTATE HANDBOOK Acquisition Involuntary Acquisition by the United States § 644.102 Examples... property, as prescribed by Pub. L. 91-646. Examples of involuntary acquisition are: (a) Damage to real...
45 CFR 96.102 - Carryover of unobligated funds.
2010-10-01
... reason or if the State has determined that program objectives would be better served by deferring... 45 Public Welfare 1 2010-10-01 2010-10-01 false Carryover of unobligated funds. 96.102 Section 96.102 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION BLOCK GRANTS Primary...
Redemption of asthma pharmaceuticals among stainless steel and mild steel welders
DEFF Research Database (Denmark)
Kristiansen, Pernille; Jørgensen, Kristian Tore; Hansen, Johnni
2015-01-01
PURPOSE: The purpose was to examine bronchial asthma according to cumulative exposure to fume particulates conferred by stainless steel and mild steel welding through a proxy of redeemed prescribed asthma pharmaceuticals. METHODS: A Danish national company-based historical cohort of 5,303 male ever...... was estimated by combining questionnaire data on welding work with a welding exposure matrix. The estimated exposure accounted for calendar time, welding intermittence, type of steel, welding methods, local exhaustion and welding in confined spaces. Hazard ratios (HRs) with 95 % confidence intervals (CIs) were...... nonsignificant increased rate of redemption of asthma medicine was observed among high-level exposed stainless steel welders in comparison with low-level exposed welders (HR 1.54, 95 % CI 0.76-3.13). This risk increase was driven by an increase risk among non-smoking stainless steel welders (HR 1.46, 95 % CI 1...
International Nuclear Information System (INIS)
Wehrle, A.E.; Cohen, M.
1989-01-01
The object CTA 102, a low-frequency variable quasar, was observed with a VLBI Global Array in 1987.5 and 1988.5 at 5.0 GHz. The structure is complex, with three compact components along a line at PA = 157 deg, and several extended, ill-defined components east of the southernmost compact component. The components have no detectable relative motions, with mu less than 0.5 mas/yr along the main axis. This contrasts with the observation reported by Baath (1987), who found mu = 0.65 + or - 0.15 mas/yr at 932 MHz, which is exceptionally high. The new upper limit allows CTA 102 to be in the normal range of superluminal sources. 11 refs
26 CFR 509.102 - Applicable provisions of law.
2010-04-01
... 26 Internal Revenue 19 2010-04-01 2010-04-01 false Applicable provisions of law. 509.102 Section... UNDER TAX CONVENTIONS SWITZERLAND General Income Tax § 509.102 Applicable provisions of law. (a) General... reason of any alteration of law in relation to internal revenue. (b) Retroactivity of regulations or...
22 CFR 41.102 - Personal appearance of applicant.
2010-04-01
... interview. (d) Cases in which personal appearance may not be waived. A consular officer or the Deputy... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Personal appearance of applicant. 41.102... IMMIGRATION AND NATIONALITY ACT, AS AMENDED Application for Nonimmigrant Visa § 41.102 Personal appearance of...
41 CFR 102-192.120 - Must we have an agency mail manager?
2010-07-01
... mail manager? 102-192.120 Section 102-192.120 Public Contracts and Property Management Federal Property... MANAGEMENT Agency Mail Manager Requirements § 102-192.120 Must we have an agency mail manager? Yes, every Federal agency as defined in § 102-192.35 must have an agency mail manager. Agencies that are not “large...
Nitrogen-alloyed martensitic steels
International Nuclear Information System (INIS)
Berns, H.
1988-01-01
A report is presented on initial results with pressure-nitrided martensitic steels. In heat-resistant steels, thermal stability and toughness are raised by nitrogen. In cold work steel, there is a more favourable corrosion behaviour. (orig./MM) [de
MICROALLOYED STEELS FOR THE AUTOMOTIVE INDUSTRY
Directory of Open Access Journals (Sweden)
Debanshu Bhattacharya
2014-12-01
Full Text Available Two major drivers for the use of newer steels in the automotive industry are fuel efficiency and increased safety performance. Fuel efficiency is mainly a function of weight of steel parts, which in turn, is controlled by gauge and design. Safety is determined by the energy absorbing capacity of the steel used to make the part. All of these factors are incentives for the U.S. automakers to use both Highly Formable and Advanced High Strength Steels (AHSS to replace the conventional steels used to manufacture automotive parts in the past. AHSS is a general term used to describe various families of steels. The most common AHSS is the dual-phase steel that consists of a ferrite-martensite microstructure. These steels are characterized by high strength, good ductility, low tensile to yield strength ratio and high bake hardenability. Another class of AHSS is the complex-phase or multi-phase steel which has a complex microstructure consisting of various phase constituents and a high yield to tensile strength ratio. Transformation Induced Plasticity (TRIP steels is another class of AHSS steels finding interest among the U.S. automakers. These steels consist of a ferrite-bainite microstructure with significant amount of retained austenite phase and show the highest combination of strength and elongation, so far, among the AHSS in use. High level of energy absorbing capacity combined with a sustained level of high n value up to the limit of uniform elongation as well as high bake hardenability make these steels particularly attractive for safety critical parts and parts needing complex forming. A relatively new class of AHSS is the Quenching and Partitioning (Q&P steels. These steels seem to offer higher ductility than the dual-phase steels of similar strengths or similar ductility as the TRIP steels at higher strengths. Finally, martensitic steels with very high strengths are also in use for certain parts. The most recent initiative in the area of AHSS
Notch aspects of RSP steel microstructure
Directory of Open Access Journals (Sweden)
Michal Černý
2012-01-01
Full Text Available For a rather long time, basic research projects have been focused on examinations of mechanical properties for Rapid Solidification Powder (RSP steels. These state-of-art steels are commonly known as “powdered steels“. In fact, they combine distinctive attributes of conventional steel alloys with unusual resistance of construction material manufactured by so called “pseudo-powdered” metallurgy.Choice of suitable materials for experimental verification was carried out based on characteristic application of so called “modern steel”. First, groups of stainless and tool steel types (steel grades ČSN 17 and 19 were selected. These provided representative specimens for the actual comparison experiment. For stainless steel type, two steel types were chosen: hardenable X47Cr14 (ČSN 17 029 stainless steel and non-hardenable X2CrNiMo18-14-3 (ČSN 17 350 steel. They are suitable e.g. for surgical tools and replacements (respectively. For tooling materials, C80U (ČSN 19 152 carbon steel and American D2 highly-alloyed steel (ČSN “equivalent” being 19 572 steel were chosen for the project. Finally, the M390 Böhler steel was chosen as representative of powdered (atomized steels. The goal of this paper is to discuss structural aspects of modern stainless and tool steel types and to compare them against the steel made by the RSP method. Based on the paper's results, impact of powdered steel structural characteristics on the resistance to crack initiation shall be evaluated.
Tank characterization report for double-shell tank 241-AN-102
International Nuclear Information System (INIS)
Jo, J.
1996-01-01
This characterization report summarizes the available information on the historical uses, current status, and sampling and analysis results of waste stored in double-shell underground storage tank 241- AN-102. This report supports the requirements of the Hanford Federal Facility Agreement and Consent Order, Milestone M-44-09 (Ecology et al. 1996). Tank 241-AN-102 is one of seven double-shell tanks located in the AN Tank Farm in the Hanford Site 200 East Area. The tank was hydrotested in 1981, and when the water was removed, a 6-inch heel was left. Tank 241-AN-102 began receiving waste from tank 241-SY-102 beginning in 1982. The tank was nearly emptied in the third quarter of 1983, leaving only 125 kL (33 kgal) of waste. Between the fourth quarter of 1983 and the first quarter of 1984, tank 241-AN-102 received waste from tanks 241-AY-102, 241-SY-102, 241-AW-105, and 241- AN-101. The tank was nearly emptied in the second quarter of 1984, leaving a heel of 129 kL (34 kgal). During the second and third quarters of 1984, the tank was filled with concentrated complexant waste from tank 241-AW-101. Since that time, only minor amounts of Plutonium-Uranium Extraction (PUREX) Plant miscellaneous waste and water have been received; there have been no waste transfer to or from the tank since 1992. Therefore, the waste currently in the tank is considered to be concentrated complexant waste. Tank 241-AN-102 is sound and is not included on any of the Watch Lists
Study of variation of materials patients room's door related of neutron flux iradiation
Nirmalasari, Yuliana Dian; Suparmi, A.; Sardjono, Y.
2017-08-01
The treatment chamber of patients has been simulating with MCNPX Code. Optimation of simulation design of Irradiation chamber is corresponding to ISO standards for 30 MeV cyclotron generator. The simulation has used the variation of door's materials that was applied at treatment room's door. The variation of materials was Stainless Steel 202 and Pb, the thickness Pb and stainless steel 202 with the thickness were 2 cm, respectively. Neutron flux that was radiated to stainless steel 202 in the sequence was 3.34195 × 105 n . Cm-2 s-1 and 8.41568 × 104 n . Cm-2 s-1, while for Pb was 4.01349 × 105 n . Cm-2 s-1 and 2.58058 × 104 n . Cm-2 s-1. The further, neutron flux that was radiated to Pb and stainless steel 202 with the thickness were 4 cm in sequence was 4.00601 × 105 n . Cm-2 s-1 and 1.71713 × 104 n . Cm-2 s-1 for Pb, while for SS 202 was 3.09925 × 105 n . Cm-2 s-1. From this ratio we concluded that material Pb absorbed higher neutron flux than material Stainless Steel 202. On the other hand, the cost of Pb was more expensive than Stainless Steel 202. In addition, the material Stainless Steel 202 was obtaine more easily than the material Pb. There fore to overcome the economics problem, can try to build the door with stainless still 202 sheet and Pb sheet together. The further, the neutron dose with 2 cm of thickness was 7.69603 × 10-2 Gy and 2.10623 × 10-2 Gy for SS 202, while for Pb was 4.19444 × 10-2 Gy and 1.50581 × 10-2 Gy. While the neutron dose with 4 cm of thickness for SS 202 was 9.39602 × 10-2 Gy and for Pb was 4.46541 × 10-2 Gy and 1.50502 × 10-2 Gy. We recommend that this simulation should be further optimized.
Comparison of bipolar electrocautry and cold steel dissection methods for tonsillectomy
International Nuclear Information System (INIS)
Ali, M.; Rafique, A.; Dastgir, M.; Rashid, M.; Maqbool, M.; Maqbool, S.; Bashir, S.
2014-01-01
To compare the efficacy and post-operative morbidity of bipolar electrocautry and cold steel dissection methods for tonsillectomy in pediatric population, in terms of operating time, peri-operative blood loss, post-operative pain and frequency of secondary hemorrhage. Study Design: Randomized controlled trial. Place and Duration: This study was conducted at department of ENT, Combined Military Hospital Kharian and Lahore between Jan 2009 to Jan 2012. Patients and Methods: Total 146 patients between age 6 to 12 years were enrolled in this study but only 102 patients who fulfilled the desired criteria and had regular follow up were placed in two groups. They were divided into two equal groups of 51 each labeled as A and B. Patients in group A were operated for tonsillectomy by bipolar electrocautry while group B underwent tonsillectomy by cold steel dissection method. All patients in both groups were assessed for operating time, peri-operative blood loss, secondary hemorrhage and postoperative pain on Visual Analogue Score. Results: In group A there were 27 males and 24 females while group B had 28 females and 23 males. Mean age of patients was 9.4 (SD +- 2.67) years. Patients in groups A had statistically significant lower operative time and blood loss than group B. While initial post-operative pain was not different in two groups. However late onset pain (pain on 7th and 14th day) and frequency of secondary hemorrhage was significantly higher in group A. Conclusion: Bipolar electrocautry dissection method of tonsillectomy is better than cold steel dissection method in terms of operating time and peri-operative blood loss. Although initial post-operative pain was not much significant in two groups but incidence of late onset pain and secondary hemorrhage is higher in bipolar electrocautry group. (author)
10 CFR 2.102 - Administrative review of application.
2010-01-01
... proceeding to confer with the NRC staff informally. In the case of docketed application for a limited work... 10 Energy 1 2010-01-01 2010-01-01 false Administrative review of application. 2.102 Section 2.102... ORDERS Procedure for Issuance, Amendment, Transfer, or Renewal of a License, and Standard Design Approval...
7 CFR 61.102 - Determination of quantity index.
2010-01-01
... the quantity index shall equal four times percentage of oil plus six times percentage of ammonia, plus 5. (b) For American Pima cottonseed the quantity index shall equal four times percentage of oil... 7 Agriculture 3 2010-01-01 2010-01-01 false Determination of quantity index. 61.102 Section 61.102...
Steel-reinforced concrete-filled steel tubular columns under axial and lateral cyclic loading
Farajpourbonab, Ebrahim; Kute, Sunil Y.; Inamdar, Vilas M.
2018-03-01
SRCFT columns are formed by inserting a steel section into a concrete-filled steel tube. These types of columns are named steel-reinforced concrete-filled steel tubular (SRCFT) columns. The current study aims at investigating the various types of reinforcing steel section to improve the strength and hysteresis behavior of SRCFT columns under axial and lateral cyclic loading. To attain this objective, a numerical study has been conducted on a series of composite columns. First, FEM procedure has been verified by the use of available experimental studies. Next, eight composite columns having different types of cross sections were analyzed. For comparison purpose, the base model was a CFT column used as a benchmark specimen. Nevertheless, the other specimens were SRCFT types. The results indicate that reinforcement of a CFT column through this method leads to enhancement in load-carrying capacity, enhancement in lateral drift ratio, ductility, preventing of local buckling in steel shell, and enhancement in energy absorption capacity. Under cyclic displacement history, it was observed that the use of cross-shaped reinforcing steel section causes a higher level of energy dissipation and the moment of inertia of the reinforcing steel sections was found to be the most significant parameter affecting the hysteresis behavior of SRCFT columns.
International Nuclear Information System (INIS)
Lu, Z.P.; Liu, C.T.; Porter, W.D.; Thompson, J.R.
2004-01-01
Recent advancement in bulk metallic glasses, whose properties are usually superior to their crystalline counterparts, has stimulated great interest in fabricating bulk amorphous steels. While a great deal of effort has been devoted to this field, the fabrication of structural amorphous steels with large cross sections has remained an alchemist's dream because of the limited glass-forming ability (GFA) of these materials. Here we report the discovery of structural amorphous steels that can be cast into glasses with large cross-section sizes using conventional drop-casting methods. These new steels showed interesting physical, magnetic, and mechanical properties, along with high thermal stability. The underlying mechanisms for the superior GFA of these materials are discussed
9 CFR 93.102 - Ports designated for the importation of birds.
2010-01-01
... of birds. 93.102 Section 93.102 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Birds § 93.102 Ports designated for...
41 CFR Appendix A to Part 102 - 37-Miscellaneous Donation Statutes
2010-07-01
... Donation Statutes A Appendix A to Part 102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Pt. 102-37, App. A Appendix A to Part 102-37—Miscellaneous Donation Statutes The...
Recombinant protective antigen 102 (rPA102): profile of a second-generation anthrax vaccine.
Keitel, Wendy A
2006-08-01
Recent terrorist attacks involving the use of Bacillus anthracis spores have stimulated interest in the development of new vaccines for anthrax prevention. Studies of the pathogenesis of anthrax and of the immune responses following infection and immunization underscore the pivotal role that antibodies to the protective antigen play in protection. The most promising vaccine candidates contain purified recombinant protective antigen. Clinical trials of one of these, recombinant protective antigen (rPA)102, are underway. Initial results suggest that rPA102 is well tolerated and immunogenic. Additional trials are necessary to identify optimal formulations and immunization regimens for pre- and postexposure prophylaxis. Future licensure of these and other candidate vaccines will depend on their safety and immunogenicity profiles in humans, and their ability to confer protection in animal models of inhalational anthrax.
Prospects of structural steels
International Nuclear Information System (INIS)
Bannykh, O.A.
2012-01-01
The current state of world steel production is considered as well as the development strategy of metallurgy industry in the Russian Federation through to 2020. The main factors determining the conservation of steel as perspective material for industry are given: energy expenses on production, the well-proven recirculation technology, the capability of changing steel properties in wide range, temperature range of operation. The conclusion is made that in the immediate future steel will not lose its importance [ru
31 CFR 800.102 - Effect on other law.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Effect on other law. 800.102 Section... TAKEOVERS BY FOREIGN PERSONS General § 800.102 Effect on other law. Nothing in this part shall be construed..., or review provided by or established under any other provision of federal law, including the...
International Nuclear Information System (INIS)
Nakaji, Eiji; Ikeda, Soichi; Kim, You-Chul; Nakatsuji, Yoshihiro; Horikawa, Kosuke.
1997-01-01
The dissimilar materials welded joints of high manganese non-magnetic steel/carbon steel (hereafter referred to as DMW joints), in which weld defects such as hot crack or blowhole are not found, were the good quality. Tensile strength of DMW joints was 10% higher than that of the base metal of carbon steel. In the bend tests, the DMW joints showed the good ductility without crack. Charpy absorbed energy at 0(degC) of the DMW joints was over 120(J) in the bond where it seems to be the lowest. Large hardening or softening was not detected in the heat affected zone. Fatigue strength of the DMW joints is almost the same with that of the welded joints of carbon steel/carbon steel. As the fatigue strength of the DMW joints exceeds the fatigue design standard curve of JSSC for carbon steel welded joints, the DMW joints can be treated the same as the welded joints of carbon steel/carbon steel of which strength is lower than that of high manganese non-magnetic steel, from the viewpoint of the fatigue design. (author)
Damascus steel ledeburite class
Sukhanov, D. A.; Arkhangelsky, L. B.; Plotnikova, N. V.
2017-02-01
Discovered that some of blades Damascus steel has an unusual nature of origin of the excess cementite, which different from the redundant phases of secondary cementite, cementite of ledeburite and primary cementite in iron-carbon alloys. It is revealed that the morphological features of separate particles of cementite in Damascus steels lies in the abnormal size of excess carbides having the shape of irregular prisms. Considered three hypotheses for the formation of excess cementite in the form of faceted prismatic of excess carbides. The first hypothesis is based on thermal fission of cementite of a few isolated grains. The second hypothesis is based on the process of fragmentation cementite during deformation to the separate the pieces. The third hypothesis is based on the transformation of metastable cementite in the stable of angular eutectic carbide. It is shown that the angular carbides are formed within the original metastable colony ledeburite, so they are called “eutectic carbide”. It is established that high-purity white cast iron is converted into of Damascus steel during isothermal soaking at the annealing. It was revealed that some of blades Damascus steel ledeburite class do not contain in its microstructure of crushed ledeburite. It is shown that the pattern of carbide heterogeneity of Damascus steel consists entirely of angular eutectic carbides. Believe that Damascus steel refers to non-heat-resistant steel of ledeburite class, which have similar structural characteristics with semi-heat-resistant die steel or heat-resistant high speed steel, differing from them only in the nature of excess carbide phase.
Directory of Open Access Journals (Sweden)
Juliane Lauks
Full Text Available Neurobeachin (Nbea is a multidomain scaffold protein abundant in the brain, where it is highly expressed during development. Nbea-null mice have severe defects in neuromuscular synaptic transmission resulting in lethal paralysis of the newborns. Recently, it became clear that Nbea is important also for the functioning of central synapses, where it is suggested to play a role in trafficking membrane proteins to both, the pre- and post-synaptic sites. So far, only few binding partners of Nbea have been found and the precise mechanism of their trafficking remains unclear. Here, we used mass spectrometry to identify SAP102, a MAGUK protein implicated in trafficking of the ionotropic glutamate AMPA- and NMDA-type receptors during synaptogenesis, as a novel Nbea interacting protein in mouse brain. Experiments in heterologous cells confirmed this interaction and revealed that SAP102 binds to the C-terminal part of Nbea that contains the DUF, PH, BEACH and WD40 domains. Furthermore, we discovered that introducing a mutation in Nbea's PH domain, which disrupts its interaction with the BEACH domain, abolishes this binding, thereby creating an excellent starting point to further investigate Nbea-SAP102 function in the central nervous system.
2010-10-01
... DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY General 245.102 Policy. (1) Mapping, charting, and geodesy property. All Government-furnished mapping, charting, and geodesy (MC&G) property is under the control of...
Micro-Abrasion Wear Resistance of Borided 316L Stainless Steel and AISI 1018 Steel
Reséndiz-Calderon, C. D.; Rodríguez-Castro, G. A.; Meneses-Amador, A.; Campos-Silva, I. E.; Andraca-Adame, J.; Palomar-Pardavé, M. E.; Gallardo-Hernández, E. A.
2017-11-01
The 316L stainless steel has high corrosion resistance but low tribological performance. In different industrial sectors (biomedical, chemical, petrochemical, and nuclear engineering), improvement upon wear resistance of 316L stainless steel components using accessible and inexpensive methods is critical. The AISI 1018 steel is widely used in industry, but its tribological performance is not the best among steels. Therefore, in this study the behavior of the borided 316L stainless steel and 1018 steel is evaluated under micro-abrasion wear. The boriding was carried out at 1223 K over 6 h of exposure time, resulting in a biphase layer composed of FeB/Fe2B phases. In order to evaluate Fe2B phase with no influence from FeB phase, AISI 1018 steel samples were borided at 1273 K for over 20 min and then diffusion annealed at 1273 K over 2 h to obtain a Fe2B mono-phase layer. Micro-abrasion wear resistance was evaluated by a commercial micro-abrasion testing rig using a mix of F-1200 SiC particles with deionized water as abrasive slurry. The obtained wear rates for FeB and Fe2B phases and for the 316L stainless steel were compared. Wear resistance of 316L stainless steel increases after boriding. The wear mechanisms for both phases and for the stainless steel were identified. Also, transient conditions for rolling and grooving abrasion were determined for the FeB and Fe2B phases.
27 CFR 31.102 - Addition of partners or incorporation of partnership.
2010-04-01
... incorporation of partnership. 31.102 Section 31.102 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS ALCOHOL BEVERAGE DEALERS Partnerships § 31.102 Addition of partners or incorporation of partnership. Where a number of persons who have filed a...
41 CFR 102-34.330 - What is the Federal Fleet Report?
2010-07-01
... Fleet Report? 102-34.330 Section 102-34.330 Public Contracts and Property Management Federal Property... MANAGEMENT Federal Fleet Report § 102-34.330 What is the Federal Fleet Report? The Federal Fleet Report (FFR..., in evaluating the effectiveness of the operation and management of individual fleets to determine...
48 CFR 2953.102 - Quotation for Simplified Acquisitions DL 1-2078.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Quotation for Simplified Acquisitions DL 1-2078. 2953.102 Section 2953.102 Federal Acquisition Regulations System DEPARTMENT OF LABOR CLAUSE AND FORMS FORMS General 2953.102 Quotation for Simplified Acquisitions DL 1-2078. The following...
Double Shell Tank AY-102 Radioactive Waste Leak Investigation
International Nuclear Information System (INIS)
Washenfelder, Dennis J.
2014-01-01
PowerPoint. The objectives of this presentation are to: Describe Effort to Determine Whether Tank AY-102 Leaked; Review Probable Causes of the Tank AY-102 Leak; and, Discuss Influence of Leak on Hanford's Double-Shell Tank Integrity Program
Wegst, W S
2016-01-01
The Key to Steel (Stahlschlüssel/Stahlschluessel) cross reference book will help you to decode / decipher steel designations and find equivalent materials worldwide. The 2016 edition includes more than 70,000 standard designations and trade names from approximately 300 steelmakers and suppliers. Presentation is trilingual: English, French, and German. Materials covered include structural steels, tool steels, valve steels, high temperature steels and alloys, stainless and heat-resisting steels, and more. Standards and designations from 25 countries are cross-referenced.
Pečoler, Primož
2014-01-01
The following work presents processes of steel forming, challenges when forging steel, forming machines suitable for forging and which choice of machine is most suitable for forging. We can separate steel forming to free forging and drop forging. Free forging can be divided to hand forging and machine forging. The correct choice of furnaces is also very important. We must reach correct temperature in the furnace for raw steel to melt with less scalings. In diploma I mentioned some machine...
16 CFR 502.102 - “Economy size.”
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false âEconomy size.â 502.102 Section 502.102 Commercial Practices FEDERAL TRADE COMMISSION RULES, REGULATIONS, STATEMENT OF GENERAL POLICY OR INTERPRETATION AND EXEMPTIONS UNDER THE FAIR PACKAGING AND LABELING ACT REGULATIONS UNDER SECTION 5(C) OF THE FAIR PACKAGING AND LABELING ACT Retail Sale...
41 CFR 102-74.395 - What is the policy concerning gambling?
2010-07-01
... concerning gambling? 102-74.395 Section 102-74.395 Public Contracts and Property Management Federal Property... Conduct on Federal Property Gambling § 102-74.395 What is the policy concerning gambling? (a) Except for... games for money or other personal property; (2) Operating gambling devices; (3) Conducting a lottery or...
International Nuclear Information System (INIS)
Gurrappa, I.; Malakondaiah, G.
2005-01-01
In the present paper, a systematic corrosion study has been carried out on DMR-1700 steel to understand the protective nature of oxide scale that forms on its surface under marine environmental conditions. Further, the studies related to oxide scales as well as pitting and crevice corrosion resistance of both stainless steels and widely used low alloy steel EN24 in marine environment have been studied for comparison purpose. The surface morphologies of corroded steels have been observed under scanning electron microscope (SEM) in order to understand the nature of corrosion. A high performance protective coating that has been developed for protection of low alloy steels DMR-1700 and EN24 against corrosion is presented after stressing the importance of surface engineering in enhancing the life of steels. Based on the studies with different techniques, DMR-1700 steel has been recommended for manufacture of components used in aerospace systems in association with appropriate protective coating for improving their efficiency
Characterization of D2 tool steel friction surfaced coatings over low carbon steel
International Nuclear Information System (INIS)
Sekharbabu, R.; Rafi, H. Khalid; Rao, K. Prasad
2013-01-01
Highlights: • Solid state coating by friction surfacing method. • D2 tool steel is coated over relatively softer low carbon steel. • Defect free interface between tool steel coating and low carbon steel substrate. • D2 coatings exhibited higher hardness and good wear resistance. • Highly refined martensitic microstructure in the coating. - Abstract: In this work D2 tool steel coating is produced over a low carbon steel substrate using friction surfacing process. The process parameters are optimized to get a defect free coating. Microstructural characterization is carried out using optical microscopy, scanning electron microscopy and X-ray diffraction. Infrared thermography is used to measure the thermal profile during friction surfacing of D2 steel. Wear performance of the coating is studied using Pin-on-Disk wear tests. A lower rotational speed of the consumable rod and higher translational speed of the substrate is found to result in thinner coatings. Friction surfaced D2 steel coating showed fine-grained martensitic microstructure compared to the as-received consumable rod which showed predominantly ferrite microstructure. Refinement of carbides in the coating is observed due to the stirring action of the process. The infrared thermography studies showed the peak temperature attained by the D2 coating to be about 1200 °C. The combined effect of martensitic microstructure and refined carbides resulted in higher hardness and wear resistance of the coating
41 CFR 102-35.25 - What management reports must we provide?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What management reports must we provide? 102-35.25 Section 102-35.25 Public Contracts and Property Management Federal Property... PERSONAL PROPERTY § 102-35.25 What management reports must we provide? (a) There are three reports that...
41 CFR 102-83.85 - What is a central business area?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a central business area? 102-83.85 Section 102-83.85 Public Contracts and Property Management Federal Property... Location of Space Urban Areas § 102-83.85 What is a central business area? Central business area (CBA...
41 CFR 102-85.95 - Who pays for the TI allowance?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who pays for the TI allowance? 102-85.95 Section 102-85.95 Public Contracts and Property Management Federal Property Management... GSA SPACE Tenant Improvement Allowance § 102-85.95 Who pays for the TI allowance? The customer agency...
Methods of making bainitic steel materials
Bakas, Michael Paul; Chu, Henry Shiu-Hung; Zagula, Thomas Andrew; Langhorst, Benjamin Robert
2018-01-16
Methods of making bainitic steels may involve austenitizing a quantity of steel by exposing the quantity of steel to a first temperature. A composition of the quantity of steel may be configured to impede formation of non-bainite ferrite, pearlite, and Widmanstatten ferrite. The quantity of steel may be heat-treated to form bainite by exposing the quantity of steel to a second, lower temperature. The second, lower temperature may be stabilized by exposing the quantity of steel to the second, lower temperature in the presence of a thermal ballast.
Milled Die Steel Surface Roughness Correlation with Steel Sheet Friction
DEFF Research Database (Denmark)
Berglund, J.; Brown, C.A.; Rosén, B.-G.
2010-01-01
This work investigates correlations between the surface topography ofmilled steel dies and friction with steel sheet. Several die surfaces were prepared by milling. Friction was measured in bending under tension testing. Linear regression coefficients (R2) between the friction and texture...
41 CFR 102-192.25 - Does this part apply to me?
2010-07-01
... MANAGEMENT Introduction to this Part § 102-192.25 Does this part apply to me? Yes, this part applies to you... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Does this part apply to me? 102-192.25 Section 102-192.25 Public Contracts and Property Management Federal Property...
7 CFR 91.102 - Form of official identification symbols.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Form of official identification symbols. 91.102... LABORATORY TESTING PROGRAMS SERVICES AND GENERAL INFORMATION Designation of Approved Symbols for Identification of Commodities Officially Tested By AMS § 91.102 Form of official identification symbols. Two...
41 CFR 101-1.102 - Federal Property Management Regulations.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Federal Property Management Regulations. 101-1.102 Section 101-1.102 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation...
20 CFR 220.102 - Non-severe impairment(s), defined.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Non-severe impairment(s), defined. 220.102 Section 220.102 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT... these include— (1) Physical functions such as walking, standing, sitting, lifting, pushing, pulling...
Steels from materials science to structural engineering
Sha, Wei
2013-01-01
Steels and computer-based modelling are fast growing fields in materials science as well as structural engineering, demonstrated by the large amount of recent literature. Steels: From Materials Science to Structural Engineering combines steels research and model development, including the application of modelling techniques in steels. The latest research includes structural engineering modelling, and novel, prototype alloy steels such as heat-resistant steel, nitride-strengthened ferritic/martensitic steel and low nickel maraging steel. Researchers studying steels will find the topics vital to their work. Materials experts will be able to learn about steels used in structural engineering as well as modelling and apply this increasingly important technique in their steel materials research and development.
International Nuclear Information System (INIS)
Tewary, N.K.; Kundu, A.; Nandi, R.; Saha, J.K.; Ghosh, S.K.
2016-01-01
Highlights: • Microstructure and corrosion performance are compared for two structural steels. • Microstructure evolution shows primarily ferrite-pearlite in both the steels. • Steels show higher corrosion rate in 1% HCl solution than in 3.5% NaCl solution. • The corrosion products show the presence of oxide, hydroxide and oxy-hydroxides. • The corroded surface reveals morphologies like flowery, cotton balls and rosette. - Abstract: A comparison on microstructure and corrosion performance has been made between the two structural steels used in old railway girder bridge (Sample A) and modern grades of weathering structural steel (Sample B). The microstructures, viewed under optical microscope and scanning electron microscope (SEM), show mainly ferrite-pearlite phase constituents in both the steels, A and B. The phase fraction analysis shows higher amount of pearlite in steel A compared to that of steel B. The grain size of steel A is larger than that of steel B under identical processing condition. The immersion corrosion test in 3.5% NaCl shows that the corrosion rate of steel A increases with time, while the same for steel B decreases with time. On the other hand, corrosion test in 1% HCl shows that the corrosion rate of both steel A and B is higher as compared to that of NaCl which always decreases with time. The XRD analysis of corrosion products show the presence of many oxides, hydroxide and oxy-hydroxide like Lepidocrocite (γ-FeOOH), Goethite (α-FeOOH), Akaganeite (β-FeOOH), Magnetite (Fe_3O_4) and Maghemite (γ-Fe_2O_3) in both the steels. The SEM images of corroded surfaces reveal different morphologies like flowery, cotton balls and rosette etc. which indicate that the corrosion products primarily contain Lepidocrocite (γ-FeOOH), Goethite (α-FeOOH) and Akaganeite (β-FeOOH).
2010-01-01
... INFORMATION Introduction § 1201.102 Functions. In order to carry out the purpose of the Act, NASA is... utilization of the scientific and engineering resources of the United States with other nations engaged in...
5 CFR 5001.102 - Prohibited financial interests in for-hire transportation companies.
2010-01-01
...-hire transportation companies. 5001.102 Section 5001.102 Administrative Personnel INTERSTATE COMMERCE COMMISSION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE INTERSTATE COMMERCE COMMISSION § 5001.102 Prohibited financial interests in for-hire transportation companies. (a) General prohibition...
International Nuclear Information System (INIS)
Jafarzadegan, M.; Feng, A.H.; Abdollah-zadeh, A.; Saeid, T.; Shen, J.; Assadi, H.
2012-01-01
In the present study, 3 mm-thick plates of 304 stainless steel and st37 steel were welded together by friction stir welding at a welding speed of 50 mm/min and tool rotational speed of 400 and 800 rpm. X-ray diffraction test was carried out to study the phases which might be formed in the welds. Metallographic examinations, and tensile and microhardness tests were used to analyze the microstructure and mechanical properties of the joint. Four different zones were found in the weld area except the base metals. In the stir zone of the 304 stainless steel, a refined grain structure with some features of dynamic recrystallization was evidenced. A thermomechanically-affected zone was characterized on the 304 steel side with features of dynamic recovery. In the other side of the stir zone, the hot deformation of the st37 steel in the austenite region produced small austenite grains and these grains transformed to fine ferrite and pearlite and some products of displacive transformations such as Widmanstatten ferrite and martensite by cooling the material after friction stir welding. The heat-affected zone in the st37 steel side showed partially and fully refined microstructures like fusion welding processes. The recrystallization in the 304 steel and the transformations in the st37 steel enhanced the hardness of the weld area and therefore, improved the tensile properties of the joint. - Highlights: ► FSW produced sound welds between st37 low carbon steel and 304 stainless steel. ► The SZ of the st37 steel contained some products of allotropic transformation. ► The material in the SZ of the 304 steel showed features of dynamic recrystallization. ► The finer microstructure in the SZ increased the hardness and tensile strength.
41 CFR 102-33.65 - What is the process for acquiring Government aircraft?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the process for acquiring Government aircraft? 102-33.65 Section 102-33.65 Public Contracts and Property Management Federal... process; planning, budgeting, and contracting, as described in §§ 102-33.70 through 102-33.105. Planning...
12 CFR 1806.102 - Relationship to other Community Development Financial Institutions Programs.
2010-01-01
... Financial Institutions Programs. 1806.102 Section 1806.102 Banks and Banking COMMUNITY DEVELOPMENT FINANCIAL INSTITUTIONS FUND, DEPARTMENT OF THE TREASURY BANK ENTERPRISE AWARD PROGRAM General Provisions § 1806.102 Relationship to other Community Development Financial Institutions Programs. Prohibition against double funding...
41 CFR 102-117.110 - What is satisfactory service?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is satisfactory service? 102-117.110 Section 102-117.110 Public Contracts and Property Management Federal Property... satisfactory service? You should consider the following factors in assessing whether a TSP offers satisfactory...
Comparison of the performance of concrete-filled steel tubular and hollow steel diagrid buildings
Peter, Minu Ann; S, Sajith A.; Nagarajan, Praveen
2018-03-01
In the recent construction scenario, diagrid structures are becoming a popular high-rise building structural system. Diagrid structures consist of diagonals in the perimeter and an interior core. The corner and interior vertical columns are not required due to the structural efficiency of diagrid structural systems. Steel and concrete are commonly used material for diagrid. An alternate material for diagrid is concrete-filled steel tube (CFST). CFST incorporates the advantages of both steel and concrete. In CFST, the inward buckling of the steel tube is effectively prevented by the filled concrete. The compressive strength of concrete increases due to the tri-axial state of stress in concrete induced by the steel tube. The longitudinal as well as lateral reinforcement to the concrete core is also provided by the steel tube. This paper compares the performance of CFST and steel diagrid buildings using linear static analysis. For this purpose, a 12 storey and 36 storey building are analysed using finite element method and CFST diagrid building is found to perform better.
Hydrogen gas embrittlement of stainless steels mainly austenitic steels. Volumes 1 and 2
International Nuclear Information System (INIS)
Azou, P.
1988-01-01
Steel behavior in regard to hydrogen is examined especially austenitic steels. Gamma steels are studied particularly the series 300 with various stabilities and gamma steels with improved elasticity limit for intermetallic phase precipitation and nitrogen additions. A two-phase structure γ + α' is also studied. All the samples are tested for mechanical behavior in gaseous hydrogen. Influence of metallurgical effects and of testing conditions on hydrogen embrittlement are evidenced. Microstructure resulting from mechanical or heat treatments, dislocation motion during plastic deformation and influence of deformation rate are studied in detail [fr
Some comments about the situation of the Steel Industry in the Arab Countries (Arab Steel Summit)
International Nuclear Information System (INIS)
Haidar, Y.; Astier, J.
2009-01-01
The Arab Steel Summit, that convened in Abu Dhabi in April, gave us another opportunity to review the situation of the Arab Iron and Steel Industry, with regard to the present World economic context. We will address: - the World situation of steel production, focusing on the Arab Countries; - the related situation of steel consumption; - the steel trade, including imports, exports and prices; - the consequences for technology and economy. (authors)
41 CFR 102-80.30 - What are Federal agencies' responsibilities concerning lead?
2010-07-01
... agencies' responsibilities concerning lead? 102-80.30 Section 102-80.30 Public Contracts and Property... PROPERTY 80-SAFETY AND ENVIRONMENTAL MANAGEMENT Safety and Environmental Management Lead § 102-80.30 What are Federal agencies' responsibilities concerning lead? Federal agencies have the following...
Challenges in Special Steel Making
Balachandran, G.
2018-02-01
Special bar quality [SBQ] is a long steel product where an assured quality is delivered by the steel mill to its customer. The bars have enhanced tolerance to higher stress application and it is demanded for specialised component making. The SBQ bars are sought for component making processing units such as closed die hot forging, hot extrusion, cold forging, machining, heat treatment, welding operations. The final component quality of the secondary processing units depends on the quality maintained at the steel maker end along with quality maintained at the fabricator end. Thus, quality control is ensured at every unit process stages. The various market segments catered to by SBQ steel segment is ever growing and is reviewed. Steel mills need adequate infrastructure and technological capability to make these higher quality steels. Some of the critical stages of processing SBQ and the critical quality maintenance parameters at the steel mill in the manufacture has been brought out.
International Nuclear Information System (INIS)
Anon.
1980-01-01
Dual phase steels, composite products, and microalloyed steels are making inroads in the automotive industry applications for bumpers, automotive parts, bodies, mechanical parts, suspension and steering equipment and truck bumpers. New steels are also used to support solar mirrors and cells, in corrosive environments in the oil and gas industry, fusion reactors, and pressure vessels in nuclear power plants
Analysis of the Behaviour of Composite Steel and Steel Fiber Reinforced Concrete Slabs
Directory of Open Access Journals (Sweden)
Mindaugas Petkevičius
2011-04-01
Full Text Available There was a pending influence of steel fiber on the strength and stiffness of composite steel–concrete slabs under statical short–time load. Steel profiled sheeting and steel fiber reinforced concrete were used for specimens. Four composite slabs were made. Experimental investigations into the behaviour and influence of steel fiber reinforced concrete in composite slabs were conducted. Transverse, longitudinal, shear deformation and deflection of the slab were measured. The results indicated that the use of steel fiber in composite slabs was effective: strength was 20–24 % higher and the meanings of deflections under the action of the bending moment were 0,6MR (where MR is the bending moment at failure of the slabs and were 16–18 % lower for slabs with usual concrete. Article in Lithuanian
42 CFR 102.32 - Benefits for lost employment income.
2010-10-01
... 102.32 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... pay for lost employment income or to provide disability or retirement benefits to the requester. As provided in § 102.84, the Secretary retains the right to recover benefits for lost employment income paid...
49 CFR 236.102 - Semaphore or searchlight signal mechanism.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Semaphore or searchlight signal mechanism. 236.102... Instructions: All Systems Inspections and Tests; All Systems § 236.102 Semaphore or searchlight signal mechanism. (a) Semaphore signal mechanism shall be inspected at least once every six months, and tests of...
41 CFR 102-74.10 - What is the basic facility management policy?
2010-07-01
... facility management policy? 102-74.10 Section 102-74.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 74-FACILITY MANAGEMENT General Provisions § 102-74.10 What is the basic facility management policy? Executive agencies...
Energy Technology Data Exchange (ETDEWEB)
Yushchenko, K.A.; Voronin, S.A.; Pustovit, A.I.; Shavel' , A.V.
The effect of the type of welding and fillers on crack resistance of welded joints high-strength steel EhP810 and its various compounds with steels EhP666, 08Kh18N10T has been studied. For the welding of steel EhP810 with steels EhP810, EhP666, 08Kh18N10T electron-beam, automatic, argon tungsten arc with non-consumable electrode with various fillers, as well as argon metal-arc welding with consumable electrode, were used. It is shown, that for a joint, made by electron-beam welding, parameters sigmasub(u), Ksub(IcJ), KCV are higher than for a joint of a similar phase structure made using filler wire EhP659-VI. It is explained by the fact, that during electron-beam welding joint metal refining takes place, which removes gases. In welded joints of chP810 steel, having joints with austenitic structure, characteristic of crack resistance Ssub(c) increases by more than 0.2 mm in contrast to two-phase joints, which conventional yield strength at 77 K exceeds 1000 MPa. It is worth mentioning, that for other classes of steels formation of two-phase structure of joint increases welded joint resistance to brittle fracture. It is possible to obtain the required structure of joint with assigned level of resistance to brittle fracture by means of the use of different fillers, optimum and welding procedure, regulating the part of the basic metal in joint content.
14 CFR 1221.102 - Establishment of the NASA Seal.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Establishment of the NASA Seal. 1221.102 Section 1221.102 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA...
29 CFR 102.132 - Reporting of prohibited communications; penalties.
2010-07-01
... communication shall place or cause to be placed on the public record of the proceeding: (1) The communication... 29 Labor 2 2010-07-01 2010-07-01 false Reporting of prohibited communications; penalties. 102.132 Section 102.132 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS...
19 CFR 122.102 - Inspection of baggage in transit.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Inspection of baggage in transit. 122.102 Section... OF THE TREASURY AIR COMMERCE REGULATIONS Accompanied Baggage in Transit § 122.102 Inspection of baggage in transit. (a) General baggage in transit may be inspected upon arrival, while in transit, and...
13 CFR 102.36 - Privacy Act standards of conduct.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Privacy Act standards of conduct. 102.36 Section 102.36 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD DISCLOSURE... existence or development of any system of records that is not the subject of a current or planned public...
22 CFR 102.15 - Protection and preservation of wreckage.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Protection and preservation of wreckage. 102.15 Section 102.15 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION United... constitutes a public hazard. When under the latter conditions the wreckage and contents of the aircraft must...
International Nuclear Information System (INIS)
Keller, C.M.
1997-01-01
This document provides supporting calculations and equipment dedication plans for portable exhausters and ductwork installed on tanks S-109, SX-102/103, BY-105/106, S-101/102, and S-107. The exhausters will ventilate the tanks during saltwell pumping to prevent the potential accumulation of flammable gases
2010-10-01
... contracts without requiring consideration to incorporate changes authorized by FASA or Clinger-Cohen Act... without requiring consideration to incorporate these new policies. The contract modification should be....102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT CONTRACT...
41 CFR 102-41.170 - Is unclaimed personal property available for donation?
2010-07-01
... property available for donation? 102-41.170 Section 102-41.170 Public Contracts and Property Management... Personal Property § 102-41.170 Is unclaimed personal property available for donation? No, unclaimed personal property is not available for donation because reimbursement at fair market value is required. ...
41 CFR 102-37.30 - When does property become available for donation?
2010-07-01
... become available for donation? 102-37.30 Section 102-37.30 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.30 When does property become available for donation? Excess personal property becomes available for donation the day...
49 CFR 179.102 - Special commodity requirements for pressure tank car tanks.
2010-10-01
... car tanks. 179.102 Section 179.102 Transportation Other Regulations Relating to Transportation... REGULATIONS SPECIFICATIONS FOR TANK CARS Specifications for Pressure Tank Car Tanks (Classes DOT-105, 109, 112, 114 and 120) § 179.102 Special commodity requirements for pressure tank car tanks. (a) In addition to...
41 CFR 102-77.15 - Who funds the Art-in-Architecture efforts?
2010-07-01
...-Architecture efforts? 102-77.15 Section 102-77.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION REAL PROPERTY 77-ART-IN-ARCHITECTURE Art-in-Architecture § 102-77.15 Who funds the Art-in-Architecture efforts? To the extent not...
Schmidtke, N. W.; Averill, D. W.
1978-01-01
Presents a literature review of wastes from steel industry, covering publications of 1976-77. This review covers: (1) coke production; (2) iron and steel production; (3) rolling operations; and (4) surface treatment. A list of 133 references is also presented. (NM)
Fatigue damage of steel components
DEFF Research Database (Denmark)
Fæster, Søren; Zhang, Xiaodan; Huang, Xiaoxu
2014-01-01
Railway rails and the inner ring in roller bearings in wind turbines are both experiencing steel-to-steel contact in small areas with huge loads resulting in extremely high stresses in the base materials......Railway rails and the inner ring in roller bearings in wind turbines are both experiencing steel-to-steel contact in small areas with huge loads resulting in extremely high stresses in the base materials...
Corrosion of mild steel and stainless steel by marine Vibrio sp.
Digital Repository Service at National Institute of Oceanography (India)
PrabhaDevi; Wagh, A.B.
Microbially induced corrosion (MIC) of stainless steel and mild steel coupons exposed to media with and without a bacterial culture Vibrio sp. was studied using Scanning Electron Microscope (SEM). Pitting type of corrosion was noticed which was more...
The Study for Recycling NORM - Contaminated Steel Scraps from Steel Industry
International Nuclear Information System (INIS)
Tsai, K. F.; Lee, Y. S.; Chao, H. E.
2003-01-01
Since 1994, most of the major steel industries in Taiwan have installed portal monitor to detect the abnormal radiation in metal scrap feed. As a result, the discovery of NORM (Naturally Occurring Radioactive Material) has increased in recent years. In order to save the natural resources and promote radiation protection, an experimental melting process for the NORM contaminated steel scraps was carried out by the Institute of Nuclear Energy Research (INER) Taiwan, ROC. The experimental melting process has a pretreatment step that includes a series of cutting and removal of scales, sludge, as well as combustible and volatile materials on/in the steel scraps. After pretreatment the surface of the steel scraps are relatively clean. Then the scraps are melted by a pilot-type induction furnace. This experiment finally produced seven ingots with a total weight of 2,849 kg and 96.8% recovery. All of the surface dose rates are of the background values. The activity concentrations of these ingots are also below the regulatory criteria. Thus, these NORM-bearing steel scraps are ready for recycling. This study has been granted by the regulatory authority
Steel: Price and Policy Issues
National Research Council Canada - National Science Library
Cooney, Stephen
2006-01-01
Steel prices remain at historically elevated levels. The rapid growth of steel production and demand in China is widely considered as a major cause of the increases in both steel prices and the prices of steelmaking inputs...
41 CFR 102-192.170 - What are GSA's responsibilities in mail management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities in mail management? 102-192.170 Section 102-192.170 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT GSA's Responsibilities and Services § 102-192.170 What are GSA's...
15 CFR 270.102 - Conditions for establishment and deployment of a Team.
2010-01-01
... deployment of a Team. 270.102 Section 270.102 Commerce and Foreign Trade Regulations Relating to Commerce and... SAFETY TEAMS NATIONAL CONSTRUCTION SAFETY TEAMS Establishment and Deployment of Teams § 270.102 Conditions for establishment and deployment of a Team. (a) The Director may establish a Team for deployment...
49 CFR 230.102 - Tender plain bearing journal boxes.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Tender plain bearing journal boxes. 230.102... Locomotives and Tenders Running Gear § 230.102 Tender plain bearing journal boxes. Plain bearing journal boxes... expected to damage the bearing; or have a detrimental effect on the lubrication of the journal and bearing...
International Nuclear Information System (INIS)
Itty, Pierre-Adrien; Serdar, Marijana; Meral, Cagla; Parkinson, Dula; MacDowell, Alastair A.; Bjegović, Dubravka; Monteiro, Paulo J.M.
2014-01-01
Highlights: • The morphology of the corrosion of steel in cement paste was studied in situ. • During galvanostatic corrosion, carbon steel reinforcement corroded homogeneously. • On ferritic stainless steel, deep corrosion pits formed and caused wider cracks. • The measured rate of steel loss correlated well with Faraday’s law of electrolysis. - Abstract: In a X-ray microcomputed tomography study, active corrosion was induced by galvanostatically corroding steel embedded in cement paste. The results give insight into corrosion product build up, crack formation, leaching of products into the cracks and voids, and differences in morphology of corrosion attack in the case of carbon steel or stainless steel reinforcement. Carbon steel was homogeneously etched away with a homogeneous layer of corrosion products forming at the steel/cement paste interface. For ferritic stainless steel, pits were forming, concentrating the corrosion products locally, which led to more extensive damage on the cement paste cover
Fracture Mechanisms in Steel Castings
Directory of Open Access Journals (Sweden)
Stradomski Z.
2013-09-01
Full Text Available The investigations were inspired with the problem of cracking of steel castings during the production process. A single mechanism of decohesion - the intergranular one - occurs in the case of hot cracking, while a variety of structural factors is decisive for hot cracking initiation, depending on chemical composition of the cast steel. The low-carbon and low-alloyed steel castings crack due to the presence of the type II sulphides, the cause of cracking of the high-carbon tool cast steels is the net of secondary cementite and/or ledeburite precipitated along the boundaries of solidified grains. Also the brittle phosphor and carbide eutectics precipitated in the final stage solidification are responsible for cracking of castings made of Hadfield steel. The examination of mechanical properties at 1050°C revealed low or very low strength of high-carbon cast steels.
International Nuclear Information System (INIS)
Govorov, A.A.; Pan'shin, I.F.; Rakhmanov, V.I.
1978-01-01
For the purpose of developing a graphical method for choosing structural steels, a change in the propagation work of a crack and in the critical temperature of brittleness of 40, 40Kh, 40KhN, and 40KhNM steels, was examined depending on the hardness after hardening and tempering. A diagram enabling to choose the grade of steel for making an article of known dimensions according to the preset values of its mechanical properties has been plotted. The developed selection scheme takes into account the hardenability of steels and the influence of the hardness after thermal treatment on the cold-shortness of steel
Volatilization from PCA steel alloy
Energy Technology Data Exchange (ETDEWEB)
Hagrman, D.L.; Smolik, G.R.; McCarthy, K.A.; Petti, D.A.
1996-08-01
The mobilizations of key components from Primary Candidate Alloy (PCA) steel alloy have been measured with laboratory-scale experiments. The experiments indicate most of the mobilization from PCA steel is due to oxide formation and spalling but that the spalled particles are large enough to settle rapidly. Based on the experiments, models for the volatization of iron, manganese, and cobalt from PCA steel in steam and molybdenum from PCA steel in air have been derived.
41 CFR 102-2.5 - What is the Federal Management Regulation (FMR)?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Federal Management Regulation (FMR)? 102-2.5 Section 102-2.5 Public Contracts and Property Management Federal... MANAGEMENT REGULATION SYSTEM Regulation System General § 102-2.5 What is the Federal Management Regulation...
41 CFR 102-36.450 - Do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.450 Section 102-36.450 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.450 Do we report excess shelf-life items? (a) When there are quantities on hand, that...
Risk of lung cancer according to mild steel and stainless steel welding
DEFF Research Database (Denmark)
Sørensen, Anita Rath; Thulstrup, Ane Marie; Hansen, Johnni
2007-01-01
OBJECTIVES: Whether the elevated risk of lung cancer observed among welders is caused by welding emissions or by confounding from smoking or asbestos exposure is still not resolved. This question was addressed in a cohort with a long follow-up and quantified estimates of individual exposure.......06-1.70)]. Among the stainless steel welders, the risk increased significantly with increasing accumulative welding particulate exposure, while no exposure-response relation was found for mild steel welders, even after adjustment for tobacco smoking and asbestos exposure. CONCLUSIONS: The study corroborates...... earlier findings that welders have an increased risk of lung cancer. While exposure-response relations indicate carcinogenic effects related to stainless steel welding, it is still unresolved whether the mild steel welding process carries a carcinogenic risk....
Review on Cold-Formed Steel Connections
Tan, Cher Siang; Mohammad, Shahrin; Md Tahir, Mahmood; Shek, Poi Ngian
2014-01-01
The concept of cold-formed light steel framing construction has been widespread after understanding its structural characteristics with massive research works over the years. Connection serves as one of the important elements for light steel framing in order to achieve its structural stability. Compared to hot-rolled steel sections, cold-formed steel connections perform dissimilarity due to the thin-walled behaviour. This paper aims to review current researches on cold-formed steel connections, particularly for screw connections, storage rack connections, welded connections, and bolted connections. The performance of these connections in the design of cold-formed steel structures is discussed. PMID:24688448
International Nuclear Information System (INIS)
Koutsky, J.; Vacek, M.; Stoces, B.; Pav, T.; Otruba, J.; Novosad, P.; Brumovsky, M.
1982-01-01
The resistance was studied of Cr-Mo-V type steel 15Kh2MFA to radiation embrittlement at an irradiation temperature of around 288 degC. Studied was the steel used for the manufacture of the pressure vessel of the Paks nuclear reactor in Hungary. The obtained results of radiation embrittlement and hardening of steel 15Kh2MFA were compared with similar values of Mn-Ni-Mo type steels A 533-B and A 508 manufactured by leading western manufacturers within the international research programme coordinated by the IAEA. It was found that the resistance of steel 15Kh2MFA to radiation embrittlement is comparable with steels A 533-B and A 508 by western manufacturers. (author)
50 CFR 86.102 - How did the Service design the National Framework?
2010-10-01
... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false How did the Service design the National Framework? 86.102 Section 86.102 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT... INFRASTRUCTURE GRANT (BIG) PROGRAM Service Completion of the National Framework § 86.102 How did the Service...
International Nuclear Information System (INIS)
Klueh, R.L.; Grossbeck, M.L.
1984-01-01
The USSR steel EP-838 is a high-manganese, low-nickel steel that also has lower chromium and molybdenum than type 316 stainless steel. Tensile specimens of 20%-cold-worked EP-838 and type 316 stainless steel were irradiated in the High Flux Isotope Reactor (HFIR) at the coolant temperature (approx.=50 0 C). A displacement damage level of 5.2 dpa was reached for the EP-838 and up to 9.5 dpa for the type 316 stainless steel. Tensile tests at room temperature and 300 0 C on the two steels indicated that the irradiation led to increased strength and decreased ductility compared to the unirradiated steels. Although the 0.2% yield stress of the type 316 stainless steel in the unirradiated condition was greater than that for the EP-838, after irradiation there was essentially no difference between the strength or ductility of the two steels. The results indicate that the replacement of the majority of the nickel by manganese and a reduction of chromium and molybdenum in an austenitic stainless steel of composition near that for type 316 stainless steel has little effect on the irradiated and unirradiated tensile properties at low temperatures. (orig.)
Ductility of high chromium stainless steels
International Nuclear Information System (INIS)
Peretyat'ko, V.N.; Kazantsev, A.A.
1997-01-01
Aimed to optimize the hot working conditions for high chromium stainless steels the experiments were carried in the temperature range of 800-1300 deg C using hot torsion tests and cylindrical specimens of ferritic and ferritic-martensitic steels 08Kh13, 12Kh13, 20Kh13, 30Kh13 and 40Kh13. Testing results showed that steel plasticity varies in a wide range depending on carbon content. Steels of lesser carbon concentration (08Kh13 and 12Kh13) exhibit a sharp increase in plasticity with a temperature rise, especially in the interval of 1200-1250 deg C. Steels 20Kh13 and 30Kh13 display insignificant plasticity increasing, whereas plastic properties of steel 40Kh13 increase noticeably in the range of 1000-1300 deg C. It is shown that optimal hot working conditions for specific steel must be selected with account of steel phase composition at high temperatures
International Nuclear Information System (INIS)
Bohusova, O.; Brumovsky, M.; Cukr, B.; Hatle, Z.; Protiva, K.; Stefec, R.; Urban, A.; Zidek, M.
1976-01-01
The principles are listed of nuclear reactor operation and the reactors are classified by neutron energy, fuel and moderator designs, purpose and type of moderator. The trend and the development of light-water reactor applications are described. The fundamental operating parameters of the WWER type reactors are indicated. The effect is discussed of neutron radiation on reactor structural materials. The characteristics are described of steel corrosion due to the contact of the steel with steam or sodium in the primary coolant circuit. The reasons for stress corrosion are given and the effects of radiation on corrosion are listed. The requirements and criteria are given for the choice of low-alloy steel for the manufacture of pressure vessels, volume compensators, steam generators, cooling conduits and containment. A survey is given of most frequently used steels for pressure vessels and of the mechanical and structural properties thereof. The basic requirements for the properties of steel used in the primary coolant circuit are as follows: sufficient strength in operating temperature, toughness, good weldability, resistance to corrosion and low brittleness following neutron irradiation. The materials are listed used for the components of light-water and breeder reactors. The production of corrosion-resistant steels is discussed with a view to raw materials, technology, steel-making processes, melting processes, induction furnace steel-making, and to selected special problems of the chemical composition of steels. The effects are mainly discussed of lead, bismuth and tin as well as of some other elements on hot working of high-alloy steels and on their structure. The problems of corrosion-resistant steel welding and of pressure vessel cladding are summed up. Also discussed is the question of the concept and safeguards of the safety of nuclear installation operation and a list is presented of most commonly used nondestructive materials testing methods. The current
2010-10-01
... SUPPLEMENTARY REGULATIONS SIMPLIFIED ACQUISITION PROCEDURES FOR HEALTH-CARE RESOURCES 873.102 Definitions...-care providers include health-care plans and insurers and any organizations, institutions, or other entities or individuals who furnish health-care resources. (38 U.S.C. 8153) Health-care resource includes...
2010-10-01
..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS (CONTINUED) ENDANGERED AND THREATENED WILDLIFE AND PLANTS (CONTINUED) Manatee Protection Areas § 17.102... manatee refuge or a manatee sanctuary; Manatee refuge means an area in which the Director has determined...
29 CFR 102.39 - Rules of evidence controlling so far as practicable.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Rules of evidence controlling so far as practicable. 102.39 Section 102.39 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS... Hearings § 102.39 Rules of evidence controlling so far as practicable. Any such proceeding shall, so far as...
41 CFR 102-34.345 - What records do we need to keep?
2010-07-01
... MANAGEMENT Federal Fleet Report § 102-34.345 What records do we need to keep? You are responsible for... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What records do we need to keep? 102-34.345 Section 102-34.345 Public Contracts and Property Management Federal Property...
The industrial ecology of steel
Energy Technology Data Exchange (ETDEWEB)
Considine, Timothy J.; Jablonowski, Christopher; Considine, Donita M.M.; Rao, Prasad G.
2001-03-26
This study performs an integrated assessment of new technology adoption in the steel industry. New coke, iron, and steel production technologies are discussed, and their economic and environmental characteristics are compared. Based upon detailed plant level data on cost and physical input-output relations by process, this study develops a simple mathematical optimization model of steel process choice. This model is then expanded to a life cycle context, accounting for environmental emissions generated during the production and transportation of energy and material inputs into steelmaking. This life-cycle optimization model provides a basis for evaluating the environmental impacts of existing and new iron and steel technologies. Five different plant configurations are examined, from conventional integrated steel production to completely scrap-based operations. Two cost criteria are used to evaluate technology choice: private and social cost, with the latter including the environmental damages associated with emissions. While scrap-based technologies clearly generate lower emissions in mass terms, their emissions of sulfur dioxide and nitrogen oxides are significantly higher. Using conventional damage cost estimates reported in the literature suggests that the social costs associated with scrap-based steel production are slightly higher than with integrated steel production. This suggests that adopting a life-cycle viewpoint can substantially affect environmental assessment of new technologies. Finally, this study also examines the impacts of carbon taxes on steel production costs and technology choice.
41 CFR 102-118.10 - What is a transportation audit?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation audit? 102-118.10 Section 102-118.10 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-118.15 - What is a transportation payment?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is a transportation payment? 102-118.15 Section 102-118.15 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
DETERMINANTS OF RETAINED EARNINGS IN PROFITABLE STEEL COMPANIES IN INDIA: A STUDY OF STEEL SECTOR
Dr. Sohaib Masood
2018-01-01
In this paper an attempt has been made to identify the important determinants of retained earnings in profitable steel companies in steel sector of India and which have impact on the retention of earnings of steel companies under study. Multiple linear regression is used to identify the determinants of retained earnings for a period of sixteen years. Also the importance of retained earnings as a source of finance for steel sector companies is also studied in the paper.
Advanced cold rolled steels for automotive applications
Energy Technology Data Exchange (ETDEWEB)
Hofmann, Harald; Mattissen, Dorothea; Schaumann, Thomas Wilhelm [ThyssenKrupp Steel AG, Center of Materials Excellence, Dortmund (Germany)
2009-01-15
Advanced high-strength steels offer a great potential for the further development of automobile bodies-in-white due to their combined mechanical properties of high formability and strength. They represent the first choice in material selection for strength and crash-relevant parts with challenging geometries. The intensive development of multiphase steels by ThyssenKrupp Steel has led to hot dip galvanizing concepts with an outstanding forming potential. Hot rolled, hot dip galvanized complex-phase steels are currently produced in addition to cold rolled dual phase (DP) and retained austenite (RA) or transformation induced plasticity (TRIP) steels. New continuously annealed grades of steel are being developed with tensile strength levels of up to 1000 MPa in combination with sufficient ductility for the high demands of structural automobile components. These steels make use of the classic advantages of microalloying as well as the principles of DP steels and RA / TRIP steels. Further improvement of properties will be reached by the new class of high manganese alloyed steels. (orig.)
2010-10-01
... Section 570.102 Federal Acquisition Regulations System GENERAL SERVICES ADMINISTRATION SPECIAL CONTRACTING... lease, including option periods and excluding the cost of operational services. Small business means a..., principle, and substance of the FAR or GSAR provision or clause and related coverage on the subject matter. ...
2010-04-01
... (CONTINUED) DRAWBACK Internal Revenue Tax on Flavoring Extracts and Medicinal or Toilet Preparations (Including Perfumery) Manufactured From Domestic Tax-Paid Alcohol § 191.102 Procedure. (a) General. Other provisions of this part relating to direct identification drawback (see subpart B of this part) shall apply...
Gupta, Shubhank; Panda, Aditi; Naskar, Ruchira; Mishra, Dinesh Kumar; Pal, Snehanshu
2017-11-01
Steels are alloys of iron and carbon, widely used in construction and other applications. The evolution of steel microstructure through various heat treatment processes is an important factor in controlling properties and performance of steel. Extensive experimentations have been performed to enhance the properties of steel by customizing heat treatment processes. However, experimental analyses are always associated with high resource requirements in terms of cost and time. As an alternative solution, we propose an image processing-based technique for refinement of raw plain carbon steel microstructure images, into a digital form, usable in experiments related to heat treatment processes of steel in diverse applications. The proposed work follows the conventional steps practiced by materials engineers in manual refinement of steel images; and it appropriately utilizes basic image processing techniques (including filtering, segmentation, opening, and clustering) to automate the whole process. The proposed refinement of steel microstructure images is aimed to enable computer-aided simulations of heat treatment of plain carbon steel, in a timely and cost-efficient manner; hence it is beneficial for the materials and metallurgy industry. Our experimental results prove the efficiency and effectiveness of the proposed technique.
Laser cutting of thick steel plates and simulated steel components using a 30 kW fiber laser
International Nuclear Information System (INIS)
Tamura, Koji; Ishigami, Ryoya; Yamagishi, Ryuichiro
2016-01-01
Laser cutting of thick steel plates and simulated steel components using a 30 kW fiber laser was studied for application to nuclear decommissioning. Successful cutting of carbon steel and stainless steel plates up to 300 mm in thickness was demonstrated, as was that of thick steel components such as simulated reactor vessel walls, a large pipe, and a gate valve. The results indicate that laser cutting applied to nuclear decommissioning is a promising technology. (author)
41 CFR 102-192.5 - What does this part cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does this part cover? 102-192.5 Section 102-192.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT...
13 CFR 102.22 - Requirements relating to systems of records.
2010-01-01
... to insure the security and confidentiality of records and to protect against any anticipated threats... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Requirements relating to systems of records. 102.22 Section 102.22 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RECORD...
13 CFR 121.102 - How does SBA establish size standards?
2010-01-01
... entry barriers, and distribution of firms by size. It also considers technological changes, competition... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false How does SBA establish size standards? 121.102 Section 121.102 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION SMALL...
22 CFR 102.13 - Protective services with respect to deceased victims of accidents.
2010-04-01
... victims of accidents. 102.13 Section 102.13 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION United States Aircraft Accidents Abroad § 102.13 Protective services with respect to deceased victims of accidents. (a) Interim disposition of remains. Generally, local authorities...
2010-01-01
...) PROGRAMS FOR SPECIFIC POSITIONS AND EXAMINATIONS (MISCELLANEOUS) Motor Vehicle Operators § 930.102... United States. Employee means an employee of an agency in either the competitive or excepted service or... used by an agency in the performance of investigative, law enforcement, or intelligence duties if the...
Directory of Open Access Journals (Sweden)
Wanchen XIE
2017-08-01
Full Text Available Hot dip galvanizing technology is now widely used as a method of protection for steel rebars. The corrosion behaviors of Q235 carbon steel and hot galvanized steel in a Ca(OH2 solution with a pH from 10 to 13 was investigated by electrode potential and polarization curves testing. The results indicated that carbon steel and hot galvanized steel were all passivated in a strong alkaline solution. The electrode potential of hot dip galvanized steel was lower than that of carbon steel; thus, hot dip galvanized steel can provide very good anodic protection for carbon steel. However, when the pH value reached 12.5, a polarity reversal occurred under the condition of a certain potential. Hot dip galvanized coating became a cathode, and the corrosion of carbon steel accelerated. The electrochemical behaviors and passivation abilities of hot dip galvanized steel and carbon steel were affected by pH. The higher the pH value was, the more easily they were passivated.DOI: http://dx.doi.org/10.5755/j01.ms.23.3.16675
International Nuclear Information System (INIS)
Bloom, E.E.; Stiegler, J.O.; Rowcliffe, A.F.; Leitnaker, J.M.
1977-01-01
The invention deals with a fuel element for fast breeder reactors. It consits essentially of a uranium oxide, nitride, or carbide or a mixture of these fuels with a plutonium or thorium oxide, nitride, or carbide. The fuel elements are coated with an austenitic stainless steel alloy. Inside the fuel elements, vacancies or small cavities are produced by neutron effects which causes the steel coating to swell. According to the invention, swelling is prevented by a modification of type 304, 316, 321, or 12 K 72HV commercial steels. They consist mainly of Fe, Cr, and Ni in a ratio determined by a temary diagram. They may also contain 1.8 to 2.3% by weight of Mo and a fraction of Si (0.7 to 2% by weight) and Ti(0.10 to 0.5% by weight) to prevent cavity formation. They are structurally modified by cold working. (IHOE) [de
International Nuclear Information System (INIS)
Gelles, D.S.
1995-03-01
Fusion energy production has an inherent advantage over fission: a fuel supply with reduced long term radioactivity. One of the leading candidate materials for structural applications in a fusion reactor is a tungsten stabilized 9% chromium Martensitic steel. This alloy class is being considered because it offers the opportunity to maintain that advantage in the reactor structure as well as provide good high temperature strength and radiation induced swelling and embrittlement resistance. However, calculations indicate that to obtain acceptable radioactivity levels within 500 years after service, clean steel will be required because the niobium impurity levels must be kept below about 2 appm and nickel, molybdenum, nitrogen, copper, and aluminum must be intentionally restricted. International efforts are addressing the problems of clean steel production. Recently, a 5,000 kg heat was vacuum induction melted in Japan using high purity commercial raw materials giving niobium levels less than 0.7 appm. This paper reviews the need for reduced long term radioactivity, defines the advantageous properties of the tungsten stabilized Martensitic steel class, and describes the international efforts to produce acceptable clean steels
Thermal stability of manganese-stabilized stainless steels
International Nuclear Information System (INIS)
Klueh, R.L.; Kenik, E.A.
1993-01-01
Previous work on a series of experimental high-manganese reduced-activation austenitic stainless steels demonstrated that they have improved tensile properties relative to type 316 stainless steel in both the annealed and 20% cold-worked conditions. Steels were tested with an Fe-20Mn-12Cr-0.25C (in weight percent) base composition, to which various combinations of Ti, W, V, P, and B were added. Tensile tests have now been completed on these steels after thermal aging at 600 degrees C. Thermal stability varied with composition, but the alloys were as stable or more stable than type 316 stainless steel. the strength of the annealed steels increased slightly after aging to 5000 h, while a strength decrease occurred for the cold worked steel. In both conditions, a steel containing a combination of all the alloying elements was most stable and had the best strength after thermal aging 5000 h at 600 degrees C. Despite having much higher strength than 316 stainless steel after aging, the ductility of the strongest experimental alloy was still as good as that of 316 stainless steel
41 CFR 102-37.45 - How long is property available for donation screening?
2010-07-01
... available for donation screening? 102-37.45 Section 102-37.45 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.45 How long is property available for donation screening? Entities authorized to participate in the donation program may...
26 CFR 601.102 - Classification of taxes collected by the Internal Revenue Service.
2010-04-01
... Rules § 601.102 Classification of taxes collected by the Internal Revenue Service. (a) Principal... 26 Internal Revenue 20 2010-04-01 2010-04-01 false Classification of taxes collected by the Internal Revenue Service. 601.102 Section 601.102 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF...
41 CFR 105-1.102 - Relationship of GSPMR to FPMR.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Relationship of GSPMR to FPMR. 105-1.102 Section 105-1.102 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1...
29 CFR 102.107 - Notice of petition, service of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Notice of petition, service of petition. 102.107 Section 102.107 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS... petition, service of petition. Upon filing a petition, the general counsel shall immediately serve a copy...
7 CFR 767.102 - Leasing non-real estate inventory property.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Leasing non-real estate inventory property. 767.102..., DEPARTMENT OF AGRICULTURE SPECIAL PROGRAMS INVENTORY PROPERTY MANAGEMENT Lease of Real Estate Inventory Property § 767.102 Leasing non-real estate inventory property. The Agency does not lease non-real estate...
32 CFR 728.102 - Care from other than Federal sources.
2010-07-01
... MEDICAL AND DENTAL CARE FOR ELIGIBLE PERSONS AT NAVY MEDICAL DEPARTMENT FACILITIES Reservists-Continued Treatment, Return to Limited Duty, Separation, or Retirement for Physical Disability § 728.102 Care from... 32 National Defense 5 2010-07-01 2010-07-01 false Care from other than Federal sources. 728.102...
5 CFR 6301.102 - Prior approval for certain outside activities.
2010-01-01
... activities. 6301.102 Section 6301.102 Administrative Personnel DEPARTMENT OF EDUCATION SUPPLEMENTAL STANDARDS...: (i) To participate in the activities of a: (A) Social, fraternal, civic, or political entity; (B... organization at the employee's child's school or day care center, other than as a member of a board of...
International Nuclear Information System (INIS)
Terashima, Keiichi; Koda, Hiroyuki; Takeuchi, Eiichi.
1995-01-01
In order to concretely examine the application of surface reforming by ion implantation, nitrogen ion implantation was applied to the thermally refined steels S45C and SCM440 and the carburized steel SCM415, which are high versatile steels for mechanical structures, and their friction and wear characteristics were examined. The results are summarized as follows. In the surface-reformed material, in which nitrogen was implanted for the purpose of improving the seizure durability of the carburized steel, the load-frictional coefficient curve in lubricated sliding friction was similar to that of the material without implantation, but it was recognized that the load at which seizure occurred reached 2000 kgf or more, and as the amount of implantation was more, the material withstood higher load. In the lubricated sliding friction using a pin-ring type wear testing machine of the thermally refined steels and those to which implantation was applied, it was recognized that the specific wear amount was less in the implanted steels than in those without implantation. The results of the analysis of the implanted surface layers and the friction surfaces are reported. (K.I.)
Larson-Miller Constant of Heat-Resistant Steel
Tamura, Manabu; Abe, Fujio; Shiba, Kiyoyuki; Sakasegawa, Hideo; Tanigawa, Hiroyasu
2013-06-01
Long-term rupture data for 79 types of heat-resistant steels including carbon steel, low-alloy steel, high-alloy steel, austenitic stainless steel, and superalloy were analyzed, and a constant for the Larson-Miller (LM) parameter was obtained in the current study for each material. The calculated LM constant, C, is approximately 20 for heat-resistant steels and alloys except for high-alloy martensitic steels with high creep resistance, for which C ≈ 30 . The apparent activation energy was also calculated, and the LM constant was found to be proportional to the apparent activation energy with a high correlation coefficient, which suggests that the LM constant is a material constant possessing intrinsic physical meaning. The contribution of the entropy change to the LM constant is not small, especially for several martensitic steels with large values of C. Deformation of such martensitic steels should accompany a large entropy change of 10 times the gas constant at least, besides the entropy change due to self-diffusion.
Properties of hot rolled steels for enamelling
International Nuclear Information System (INIS)
Gavrilovski, Dragica; Gavrilovski, Milorad
2003-01-01
The results of an investigation of the structure and properties of experimental produced hot rolled steels suitable for enamelling are presented in the paper. Hot rolled steels for enamelling represent a special group of the steels for conventional enamelling. Their quality has to be adapted to the method and conditions of enamelling. Therefore, these steels should meet some specific requirements. In addition to usual investigation of the chemical composition and mechanical properties, microstructure and quality of the steel surface also were investigated. The basic aim was to examine steels capability for enamelling, i. e. steels resistance to the fish scales phenomena, by trial enamelling, as well as quality of the steel - enamel contact surface, to evaluate the binding. Also, the changes of the mechanical properties, especially the yield point, during thermal treatment, as a very specific requirement, were investigated, by simplified method. Good results were obtained confirming the steels capability for enamelling. (Original)
Reduced-activation steels: present status and future development
International Nuclear Information System (INIS)
Klueh, R.L.
2007-01-01
Full text of publication follows: Reduced-activation steels for fusion reactor applications were developed in the 1980's to replace the commercial elevated- temperature steels first considered. In the United States, this involved replacing Sandvik HT9 and modified 9Cr-1Mo steels. Reduced-activation steels, which were developed for more rapid radioactivity decay following exposure in a fusion neutron environment, were patterned after the commercial steels they were to replace. The objective for the reduced-activation steels was that they have strengths (yield stress and ultimate tensile strength from room temperature to 600 deg. C) and impact toughness (measured in a Charpy test) comparable to or better than the steels they were replacing. That objective was achieved in reduced-activation steels developed in Japan, Europe, and the United States. Since the reduced-activation steels were developed in the 1980's, reactor designers have been interested designs for increased efficiency of future fusion plants. This means reactors will need to operate at higher temperatures-above 550 deg. C, which is the upper-temperature limit for the reduced-activation steels. Although the tensile and impact toughness of the reduced-activation steels exceed those of the commercial steels they were patterned after, their creep-rupture properties are inferior to some of the commercial steels they replaced. furthermore, they are much inferior to commercial steels that have been developed since the 1980's. Reasons for why the creep-rupture properties for the new commercial ferritic/martensitic steels are superior to the earlier commercial steels and the reduced-activation steels were examined. The reasons involve compositional changes that were made in the earlier commercial steels to give the new commercial steels their superior properties. Computational thermodynamics calculations were carried out to compare the expected equilibrium phases. It appears that similar changes in composition
25 CFR 15.102 - Who may notify the agency of a death?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Who may notify the agency of a death? 15.102 Section 15.102 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR PROBATE PROBATE OF INDIAN ESTATES, EXCEPT FOR MEMBERS OF THE OSAGE NATION AND THE FIVE CIVILIZED TRIBES Starting the Probate Process § 15.102 Who may notify the agency of a death? Anyon...
Itty, Pierre-Adrien
2014-06-01
In a X-ray microcomputed tomography study, active corrosion was induced by galvanostatically corroding steel embedded in cement paste. The results give insight into corrosion product build up, crack formation, leaching of products into the cracks and voids, and differences in morphology of corrosion attack in the case of carbon steel or stainless steel reinforcement. Carbon steel was homogeneously etched away with a homogeneous layer of corrosion products forming at the steel/cement paste interface. For ferritic stainless steel, pits were forming, concentrating the corrosion products locally, which led to more extensive damage on the cement paste cover. © 2014 Elsevier Ltd.
Itty, Pierre-Adrien; Serdar, Marijana; Meral, Cagla; Parkinson, Dula; MacDowell, Alastair A.; Bjegović, Dubravka; Monteiro, Paulo J.M.
2014-01-01
In a X-ray microcomputed tomography study, active corrosion was induced by galvanostatically corroding steel embedded in cement paste. The results give insight into corrosion product build up, crack formation, leaching of products into the cracks and voids, and differences in morphology of corrosion attack in the case of carbon steel or stainless steel reinforcement. Carbon steel was homogeneously etched away with a homogeneous layer of corrosion products forming at the steel/cement paste interface. For ferritic stainless steel, pits were forming, concentrating the corrosion products locally, which led to more extensive damage on the cement paste cover. © 2014 Elsevier Ltd.
Sych, O. V.; Khlusova, E. I.; Yashin, E. A.
2017-12-01
The paper presents the results of quantitative analysis of C, Mn, Ni and Cu content on strength and cold-resistance of rolled plates. Relations between the ferritic-bainitic structure morphology and anisotropy and steel performance characteristics have been established. Influence of thermal and deformation rolling patterns on steel structure has been studied. The steel chemical composition has been improved and precision thermomechanical processing conditions for production of cold-resistant Arc-steel plates have been developed.
Irradiation embrittlement of pressure vessel steels
International Nuclear Information System (INIS)
Brumovsky, M.; Vacek, M.
1975-01-01
A Standard Research Programme on Irradiation Embrittlement of Pressure Vessel Steels was approved by the Coordinating Meeting on the 12th May 1972 at the Working Group on Engineering Aspects of Irradiation Embrittlement of Pressure Vessel Steels. This Working Group was set up by the International Atomic Energy Agency in Vienna. Seven countries with their research institutes agreed on doing irradiation experiments according to the approved programme on steel A533 B from the U.S. HSST Programme. The Czechoslovak contribution covering tensile and impact testing of non-irradiated steel and steel irradiated at 280degC to 1.3 x 10 23 n/m 2 (E above 1 MeV) is presented in this report. As an additional part the same set of experiments was carried out on two additional steels - A 542 and A 543, made in SKODA Works for comparison of their irradiation embrittlement and hardening with A533 B steel. (author)
2010-04-01
... MAINTENANCE Contract Procedures § 635.102 Definitions. As used in this subpart: Administrator means the... definition is set forth in the State contract specifications, that definition will apply. Contract time means the number of workdays or calendar days specified in a contract for completion of the contract work...
2010-01-01
... INFORMATION MEDIA § 1213.102 Policy. (a) NASA, a scientific and technical Agency, is committed to a culture of... culture of openness, NASA employees may, consistent with this policy, speak to the press and the public... Policy Directives). Examples of information not releasable under this policy include, without limitation...
2010-01-01
... LOAN SECURITY DOCUMENTS FOR ELECTRIC BORROWERS Loan Contracts With Distribution Borrowers § 1718.102 Definitions. For the purposes of this subpart: Borrower means any organization that has an outstanding loan... defined in 7 CFR 1710.2. Loan documents means the mortgage (or other security instrument acceptable to RUS...
48 CFR 1371.102 - Method of payment and invoicing instructions for ship repair.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Method of payment and invoicing instructions for ship repair. 1371.102 Section 1371.102 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.102...
22 CFR 40.102 - Guardian required to accompany excluded alien.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Guardian required to accompany excluded alien. 40.102 Section 40.102 Foreign Relations DEPARTMENT OF STATE VISAS REGULATIONS PERTAINING TO BOTH... Guardian required to accompany excluded alien. INA 212(a)(9)(B) is not applicable at the time of visa...
Heat treatments in a conventional steel to reproduce the microstructure of a nuclear grade steel
International Nuclear Information System (INIS)
Rosalio G, M.
2014-01-01
The ferritic steels used in the manufacture of pressurized vessels of Boiling Water Reactors (BWR) suffer degradation in their mechanical properties due to damage caused by the neutron fluxes of high energy bigger to a Mega electron volt (E> 1 MeV) generated in the reactor core. The materials with which the pressurized vessels of nuclear reactors cooled by light water are built correspond to low alloy ferritic steels. The effect of neutron irradiation on these steels is manifested as an increase in hardness, mechanical strength, with the consequent decrease in ductility, fracture toughness and an increase in temperature of ductile-brittle transition. The life of a BWR is 40 years, its design must be considered sufficient margin of safety because pressure forces experienced during operation, maintenance and testing of postulated accident conditions. It is necessary that under these conditions the vessel to behave ductile and likely to propagate a fracture is minimized. The vessels of light water nuclear reactors have a bainite microstructure. Specifically, the reactor vessels of the nuclear power plant of Laguna Verde (Veracruz, Mexico) are made of a steel Astm A-533, Grade B Class 1. At present they are carrying out some welding tests for the construction of a model of a BWR, however, to use nuclear grade steel such as Astm A-533 to carry out some of the welding tests, is very expensive; perform these in a conventional material provides basic information. Although the microstructure present in the conventional material does not correspond exactly to the degree of nuclear material, it can take of reference. Therefore, it is proposed to conduct a pilot study to establish the thermal treatment that reproduces the microstructure of nuclear grade steel, in conventional steel. The resulting properties of the conventional steel samples will be compared to a JRQ steel, that is a steel Astm A-533, Grade B Class 1, provided by IAEA. (Author)
2010-04-01
... OF THE TREASURY LIQUORS âTIED-HOUSEâ Exceptions § 6.102 Outside signs. The act by an industry member... advertising matter about the product or the industry member which is permanently inscribed or securely affixed...
41 CFR 102-33.40 - What are GSA's responsibilities for Federal aviation management?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are GSA's responsibilities for Federal aviation management? 102-33.40 Section 102-33.40 Public Contracts and Property... PROPERTY 33-MANAGEMENT OF GOVERNMENT AIRCRAFT How These Rules Apply Responsibilities § 102-33.40 What are...
41 CFR 102-34.340 - Do we need a fleet management information system?
2010-07-01
... management information system? 102-34.340 Section 102-34.340 Public Contracts and Property Management Federal... VEHICLE MANAGEMENT Federal Fleet Report § 102-34.340 Do we need a fleet management information system? Yes, you must have a fleet management information system at the department or agency level that — (a...
41 CFR 102-36.455 - How do we report excess shelf-life items?
2010-07-01
... shelf-life items? 102-36.455 Section 102-36.455 Public Contracts and Property Management Federal...-DISPOSITION OF EXCESS PERSONAL PROPERTY Personal Property Whose Disposal Requires Special Handling Shelf-Life Items § 102-36.455 How do we report excess shelf-life items? You must identify the property as shelf...
Controlling DC permeability in cast steels
Energy Technology Data Exchange (ETDEWEB)
Sumner, Aaran, E-mail: aaran.sumner@nottingham.ac.uk [University of Nottingham, Nottingham University Park Campus, Nottingham NG7 2RD, England (United Kingdom); Gerada, Chris, E-mail: chris.gerada@nottingham.ac.uk [Electrical Machines, University of Nottingham, Tower Building, Nottingham NG7 2RD, England (United Kingdom); Brown, Neil, E-mail: neil.brown@cummins.com [Advanced Electrical Machines Research and Technology at Cummins Power Generation, Peterborough PE2 6FZ, England (United Kingdom); Clare, Adam, E-mail: adam.clare@nottingham.ac.uk [Advanced Manufacturing, University of Nottingham, University Park Campus, Nottingham NG7 2RD, England (United Kingdom)
2017-05-01
Annealing (at multiple cooling rates) and quenching (with tempering) was performed on specimens of cast steel of varying composition. The aim was to devise a method for selecting the steel with the highest permeability, from any given range of steels, and then increasing the permeability by heat treatment. Metallographic samples were imaged using optical microscopy to show the effect of the applied heat treatments on the microstructure. Commonly cast steels can have DC permeability altered by the careful selection of a heat treatment. Increases of up to 381% were achieved by annealing using a cooling rate of 6.0 °C/min. Annealing was found to cause the carbon present in the steel to migrate from grain boundaries and from within ferrite crystals into adjacent pearlite crystals. The migration of the carbon resulted in less carbon at grain boundaries and within ferrite crystals reducing the number of pinning sites between magnetic domains. This gives rise to a higher permeability. Quenching then tempering was found to cause the formation of small ferrite crystals with the carbon content of the steel predominately held in the martensitic crystal structures. The results show that with any given range of steel compositions the highest baseline DC permeability will be found with the steel that has the highest iron content and the lowest carbon content. For the samples tested in this paper a cooling rate of 4.5 °C/min resulted in the relative permeability of the sample with the highest baseline permeability, AS4, increasing from 783 to 1479 at 0.5 T. This paper shows how heat treatments commonly applied to hypoeutectoid cast steels, to improve their mechanical performance, can be used to also enhance electromagnetic properties of these alloys. The use of cast steels allows the creation of DC components for electrical machines not possible by the widely used method of stacking of electrical grade sheet steels. - Highlights: • A range of structural steels had their
Controlling DC permeability in cast steels
International Nuclear Information System (INIS)
Sumner, Aaran; Gerada, Chris; Brown, Neil; Clare, Adam
2017-01-01
Annealing (at multiple cooling rates) and quenching (with tempering) was performed on specimens of cast steel of varying composition. The aim was to devise a method for selecting the steel with the highest permeability, from any given range of steels, and then increasing the permeability by heat treatment. Metallographic samples were imaged using optical microscopy to show the effect of the applied heat treatments on the microstructure. Commonly cast steels can have DC permeability altered by the careful selection of a heat treatment. Increases of up to 381% were achieved by annealing using a cooling rate of 6.0 °C/min. Annealing was found to cause the carbon present in the steel to migrate from grain boundaries and from within ferrite crystals into adjacent pearlite crystals. The migration of the carbon resulted in less carbon at grain boundaries and within ferrite crystals reducing the number of pinning sites between magnetic domains. This gives rise to a higher permeability. Quenching then tempering was found to cause the formation of small ferrite crystals with the carbon content of the steel predominately held in the martensitic crystal structures. The results show that with any given range of steel compositions the highest baseline DC permeability will be found with the steel that has the highest iron content and the lowest carbon content. For the samples tested in this paper a cooling rate of 4.5 °C/min resulted in the relative permeability of the sample with the highest baseline permeability, AS4, increasing from 783 to 1479 at 0.5 T. This paper shows how heat treatments commonly applied to hypoeutectoid cast steels, to improve their mechanical performance, can be used to also enhance electromagnetic properties of these alloys. The use of cast steels allows the creation of DC components for electrical machines not possible by the widely used method of stacking of electrical grade sheet steels. - Highlights: • A range of structural steels had their
STEFINS: a steel freezing integral simulation program
International Nuclear Information System (INIS)
Frank, M.V.
1980-09-01
STEFINS (STEel Freezing INtegral Simulation) is a computer program for the calculation of the rate of solidification of molten steel on solid steel. Such computations arize when investigating core melt accidents in fast reactors. In principle this problem involves a coupled two-dimensional thermal and hydraulic approach. However, by physically reasonable assumptions a decoupled approach has been developed. The transient solidification of molten steel on a cold wall is solved in the direction normal to the molten steel flow and independent from the solution for the molten steel temperature and Nusselt number along the direction of flow. The solutions to the applicable energy equations have been programmed in cylindrical and slab geometries. Internal gamma heating of steel is included
Nitrogen-containing steels and thermomechanical treatment
International Nuclear Information System (INIS)
Kaputkina, L.; Prokoshkina, V.G.; Svyazhin, G.
2004-01-01
The strengthening of nitrogen-containing corrosion-resistant steels resulting from alloying and thermomechanical treatment have been investigated using X-ray diffraction analysis, light microscopy, hardness measurements and tensile testing. Combined data have been obtained for nitrogen interaction with alloying elements , peculiarities of deformed structure and short-range of nitrogen-containing steels of various structural classes. The higher nitrogen and total alloying element contents, the higher deformation strengthening. Prospects of use the steels with not high nitrogen content and methods of their thermomechanical strengthening are shown. High temperature thermomechanical treatment (HTMT) is very effective for obtaining high and thermally stable constructional strength of nitrogen-containing steels of all classes. The HTMT is most effective if used in a combination with dispersion hardening for aging steels or in the case of mechanically unstable austenitic steels. (author)
Automated Steel Cleanliness Analysis Tool (ASCAT)
Energy Technology Data Exchange (ETDEWEB)
Gary Casuccio (RJ Lee Group); Michael Potter (RJ Lee Group); Fred Schwerer (RJ Lee Group); Dr. Richard J. Fruehan (Carnegie Mellon University); Dr. Scott Story (US Steel)
2005-12-30
The objective of this study was to develop the Automated Steel Cleanliness Analysis Tool (ASCATTM) to permit steelmakers to evaluate the quality of the steel through the analysis of individual inclusions. By characterizing individual inclusions, determinations can be made as to the cleanliness of the steel. Understanding the complicating effects of inclusions in the steelmaking process and on the resulting properties of steel allows the steel producer to increase throughput, better control the process, reduce remelts, and improve the quality of the product. The ASCAT (Figure 1) is a steel-smart inclusion analysis tool developed around a customized next-generation computer controlled scanning electron microscopy (NG-CCSEM) hardware platform that permits acquisition of inclusion size and composition data at a rate never before possible in SEM-based instruments. With built-in customized ''intelligent'' software, the inclusion data is automatically sorted into clusters representing different inclusion types to define the characteristics of a particular heat (Figure 2). The ASCAT represents an innovative new tool for the collection of statistically meaningful data on inclusions, and provides a means of understanding the complicated effects of inclusions in the steel making process and on the resulting properties of steel. Research conducted by RJLG with AISI (American Iron and Steel Institute) and SMA (Steel Manufactures of America) members indicates that the ASCAT has application in high-grade bar, sheet, plate, tin products, pipes, SBQ, tire cord, welding rod, and specialty steels and alloys where control of inclusions, whether natural or engineered, are crucial to their specification for a given end-use. Example applications include castability of calcium treated steel; interstitial free (IF) degasser grade slag conditioning practice; tundish clogging and erosion minimization; degasser circulation and optimization; quality assessment/steel
Automated Steel Cleanliness Analysis Tool (ASCAT)
International Nuclear Information System (INIS)
Gary Casuccio; Michael Potter; Fred Schwerer; Richard J. Fruehan; Dr. Scott Story
2005-01-01
The objective of this study was to develop the Automated Steel Cleanliness Analysis Tool (ASCATTM) to permit steelmakers to evaluate the quality of the steel through the analysis of individual inclusions. By characterizing individual inclusions, determinations can be made as to the cleanliness of the steel. Understanding the complicating effects of inclusions in the steelmaking process and on the resulting properties of steel allows the steel producer to increase throughput, better control the process, reduce remelts, and improve the quality of the product. The ASCAT (Figure 1) is a steel-smart inclusion analysis tool developed around a customized next-generation computer controlled scanning electron microscopy (NG-CCSEM) hardware platform that permits acquisition of inclusion size and composition data at a rate never before possible in SEM-based instruments. With built-in customized ''intelligent'' software, the inclusion data is automatically sorted into clusters representing different inclusion types to define the characteristics of a particular heat (Figure 2). The ASCAT represents an innovative new tool for the collection of statistically meaningful data on inclusions, and provides a means of understanding the complicated effects of inclusions in the steel making process and on the resulting properties of steel. Research conducted by RJLG with AISI (American Iron and Steel Institute) and SMA (Steel Manufactures of America) members indicates that the ASCAT has application in high-grade bar, sheet, plate, tin products, pipes, SBQ, tire cord, welding rod, and specialty steels and alloys where control of inclusions, whether natural or engineered, are crucial to their specification for a given end-use. Example applications include castability of calcium treated steel; interstitial free (IF) degasser grade slag conditioning practice; tundish clogging and erosion minimization; degasser circulation and optimization; quality assessment/steel cleanliness; slab, billet
2010-01-01
... such service is creditable under CSRS) and social security deductions as a result of the Social... coverage. Employee means an employee as defined by § 842.102 of this chapter. Employing office means the office of an agency to which jurisdiction and responsibility for retirement matters for an employee have...
2010-04-01
... SUPPORTIVE HOUSING FOR THE ELDERLY PROGRAM AND SECTION 811 SUPPORTIVE HOUSING FOR PERSONS WITH DISABILITIES... for Projects With HUD-Insured and HUD-Held Mortgages § 886.102 Definitions. The terms Fair Market Rent...-held purchase money mortgage; or a project for the elderly financed under section 202 of the Housing...
14 CFR 1215.102 - Definitions.
2010-01-01
... (TDRSS) Use and Reimbursement Policy for Non-U.S. Government Users § 1215.102 Definitions. (a) User. Any non-U.S. Government representative or entity who contracts with NASA to use TDRSS services. (b) TDRSS... user ground system/TDRSS interface. (c) Bit stream. The digital electronic signals acquired by TDRSS...
41 CFR 102-83.80 - What is an urban area?
2010-07-01
... defined by the Office of Management and Budget (OMB) in OMB Bulletin No. 99-04, or succeeding OMB Bulletin... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is an urban area? 102-83.80 Section 102-83.80 Public Contracts and Property Management Federal Property Management...
21 CFR 225.102 - Master record file and production records.
2010-04-01
... or production run of medicated feed to which it pertains. The Master Record File or card shall... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Master record file and production records. 225.102....102 Master record file and production records. (a) The Master Record File provides the complete...
10 CFR 436.102 - General operations plan format and content.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false General operations plan format and content. 436.102... PROGRAMS Guidelines for General Operations Plans § 436.102 General operations plan format and content. (a... effective date of these guidelines, a general operations 10-year plan which shall consist of two parts, an...
International Nuclear Information System (INIS)
Nakano, Junichi; Yamamoto, Masahiro; Tsukada, Takashi
2014-01-01
Seawater was injected into reactor cores of Units 1, 2, and 3 in the Fukushima Daiichi nuclear power station as an urgent coolant. It is considered that the injected seawater causes corrosion of steels of the reactor pressure vessel and primary containment vessel. To investigate the effects of gamma-rays irradiation on weight loss in carbon steel and low-alloy steel, corrosion tests were performed in diluted seawater at 50°C under gamma-rays irradiation. Specimens were irradiated with dose rates of 4.4 kGy/h and 0.2 kGy/h. To evaluate the effects of hydrazine (N 2 H 4 ) on the reduction of oxygen and hydrogen peroxide, N 2 H 4 was added to the diluted seawater. In the diluted seawater without N 2 H 4 , weight loss in the steels irradiated with 0.2 kGy/h was similar to that in the unirradiated steels, and weight loss in the steels irradiated with 4.4 kGy/h increased to approximate 1.7 times of those in the unirradiated steels. Weight loss in the steels irradiated in the diluted seawater containing N 2 H 4 was similar to that in the diluted seawater without N 2 H 4 . When N 2 was introduced into the gas phase in the flasks during gamma-rays irradiation, weight loss in the steels decreased. (author)
41 CFR 102-37.520 - What is the authority for public airport donations?
2010-07-01
... for public airport donations? 102-37.520 Section 102-37.520 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Airports § 102-37.520 What is the authority for public airport donations? The authority for public airport donations is 49 U.S.C. 47151. 49 U...
Study on cementitious properties of steel slag
Directory of Open Access Journals (Sweden)
Zhu G.
2013-01-01
Full Text Available The converter steel slag chemical and mineral components in China’s main steel plants have been analysed in the present paper. The electronic microscope, energy spectrum analysis, X-ray diffraction analysis confirmed the main mineral compositions in the converter slag. Converter slag of different components were grounded to obtain a powder with specific surface area over 400m2/kg, making them to take place some part of the cement in the concrete as the admixture and carry out the standard tests. The results indicate that the converter slag can be used as cementitious materials for construction. Furthermore, physical mechanic and durability tests on the concrete that certain amount of cement be substituted by converter steel slag powder from different steel plants are carried out, the results show that the concrete with partial substitution of steel slag powder has the advantages of higher later period strength, better frost resistance, good wear resistance and lower hydration heat, etc. This study can be used as the technical basis for “Steel Slag Powder Used For Cement And Concrete”, “Steel Slag Portland Cement”, “Low Heat Portland Steel Slag Cement”, “Steel Slag Road Cement” in China, as well as a driving force to the works of steel slag utilization with high-value addition, circular economy, energy conservation and discharge reduction in the iron and steel industry.
Modern steels for light automobiles (review)
Tikhonov, A. K.
1994-10-01
The article considers the directions of work at VAZ together with metallurgists of the CIS for creating highly efficient economically-alloyed and microalloyed steels; highly ductile forged steels with improved corrosion resistance coated with zinc and with good stamping, welding, and painting capacity. Steels are created for petrol tanks with aluminum-zinc coatings instead of lead, and new heat and corrosion-resistant steels are developed for automobile exhaust gas systems.
Inclusion control in high-performance steels
International Nuclear Information System (INIS)
Holappa, L.E.K.; Helle, A.S.
1995-01-01
Progress of clean steel production, fundamentals of oxide and sulphide inclusions as well as inclusion morphology in normal and calcium treated steels are described. Effects of cleanliness and inclusion control on steel properties are discussed. In many damaging constructional and engineering applications the nonmetallic inclusions have a quite decisive role in steel performance. An example of combination of good mechanical properties and superior machinability by applying inclusion control is presented. (author)
Steel fiber reinforced concrete
International Nuclear Information System (INIS)
Baloch, S.U.
2005-01-01
Steel-Fiber Reinforced Concrete is constructed by adding short fibers of small cross-sectional size .to the fresh concrete. These fibers reinforce the concrete in all directions, as they are randomly oriented. The improved mechanical properties of concrete include ductility, impact-resistance, compressive, tensile and flexural strength and abrasion-resistance. These uniqlte properties of the fiber- reinforcement can be exploited to great advantage in concrete structural members containing both conventional bar-reinforcement and steel fibers. The improvements in mechanical properties of cementitious materials resulting from steel-fiber reinforcement depend on the type, geometry, volume fraction and material-properties of fibers, the matrix mix proportions and the fiber-matrix interfacial bond characteristics. Effects of steel fibers on the mechanical properties of concrete have been investigated in this paper through a comprehensive testing-programme, by varying the fiber volume fraction and the aspect-ratio (Lid) of fibers. Significant improvements are observed in compressive, tensile, flexural strength and impact-resistance of concrete, accompanied by marked improvement in ductility. optimum fiber-volume fraction and aspect-ratio of steel fibers is identified. Test results are analyzed in details and relevant conclusions drawn. The research is finally concluded with future research needs. (author)
Ion-plasma diffusion aluminide coatings for gas turbine blades (structure and properties)
International Nuclear Information System (INIS)
Muboyadzhyan, S.A.; Budinovskij, S.A.; Terekhova, V.V.
2003-01-01
A consideration is given to the ion-plasma method of heart resisting alloy diffusion coating with alloyed aluminides offering some advantages over routine techniques. Specific features of ion-plasma diffusion coatings production at the surface of heart resisting alloys using one- and multistage techniques are studied. The process of formation of coatings (Al-Si-Y, Al-Si-Ni-B, Al-Si-Cr-Y) along with coating effects on long-term heat resistance of nickel base alloys (ZhS6U, VZhL12U, ZhS26VNK) is investigated. The advantages of the new method of diffusion aluminide coatings are reported [ru
Development of nuclear grade stainless steels at KCSSL
International Nuclear Information System (INIS)
Balachandran, G.; Dhere, M.; Mahadik, A.; Hinge, N.M.; Balasubramanian, V.
2011-01-01
Kalyani Carpenter Special Steels Ltd is an alloy steel plant, where a variety of alloy steel grades are produced for automotive, defence, nuclear and aerospace applications. The plant has developed expertise in processing of several alloy steel grades of superior quality that meets stringent specifications. Primary steel is processed through a combination of electric arc furnace, ladle furnace and vacuum degassing where stringent control over dephosphorisation, desulphurization, deoxidation is effected to get a refined high quality steel. The molten steel is cast through continuous casting of slabs or ingot casting. In grades specific to nuclear application, the primary cast products are further subjected to electroslag remelting to achieve further freedom from inclusions and to achieve a favourable solidification grain structure, which ultimately improve the hot workability of the alloy steel. Appropriate choice of slag and operating parameters are needed for realising the required ingot quality. The present study would examine the processing and quality aspects of some important grades of steels used in nuclear industry namely ferritic 9Cr-1Mo steel, martensitic stainless steels 403, 410, precipitation hardenable 17-4 PH stainless steel and austenitic 321, 316LN stainless steel, which were made and supplied for applications to Indian nuclear industry. The expertise developed in processing the steels in terms of melting, heat treatment and their relationship to structural features and mechanical properties would be highlighted. (author)
International Nuclear Information System (INIS)
Paventhan, R.; Lakshminarayanan, P.R.; Balasubramanian, V.
2011-01-01
Research highlights: → Fusion welding of dissimilar metals is a problem due to difference in properties. → Solid state welding process such as friction welding is a solution for the above problem. → Fatigue life of friction welded carbon steel and stainless steel joints are evaluated. → Effect of notch on the fatigue life of friction welded dissimilar joints is reported. → Formation of intermetallic is responsible for reduction in fatigue life of dissimilar joints. -- Abstract: This paper reports the fatigue behaviour of friction welded medium carbon steel-austenitic stainless steel (MCS-ASS) dissimilar joints. Commercial grade medium carbon steel rods of 12 mm diameter and AISI 304 grade austenitic stainless steel rods of 12 mm diameter were used to fabricate the joints. A constant speed, continuous drive friction welding machine was used to fabricate the joints. Fatigue life of the joints was evaluated conducting the experiments using rotary bending fatigue testing machine (R = -1). Applied stress vs. number of cycles to failure (S-N) curve was plotted for unnotched and notched specimens. Basquin constants, fatigue strength, fatigue notch factor and notch sensitivity factor were evaluated for the dissimilar joints. Fatigue strength of the joints is correlated with microstructure, microhardness and tensile properties of the joints.
Mangan, Katherine
2013-01-01
Bobby Curran grew up in a working-class neighborhood in Baltimore, finished high school, and followed his grandfather's steel-toed bootprints straight to Sparrows Point, a 3,000-acre sprawl of industry on the Chesapeake Bay. College was not part of the plan. A gritty but well-paying job at the RG Steel plant was Mr. Curran's ticket to a secure…
Development of new high-performance stainless steels
International Nuclear Information System (INIS)
Park, Yong Soo
2002-01-01
This paper focused on high-performance stainless steels and their development status. Effect of nitrogen addition on super-stainless steel was discussed. Research activities at Yonsei University, on austenitic and martensitic high-performance stainless, steels, and the next-generation duplex stainless steels were introduced
Ferritic/martensitic steels: Promises and problems
International Nuclear Information System (INIS)
Klueh, R.L.; Ehrlich, K.; Abe, F.
1992-01-01
Ferritic/martensitic steels are candidate structural materials for fusion reactors because of their higher swelling resistance, higher thermal conductivity, lower thermal expansion, and better liquid-metal compatibility than austenitic steels. Irradiation effects will ultimately determine the applicability of these steels, and the effects of irradiation on microstructure and swelling, and on the tensile, fatigue, and impact properties of the ferritic/martensitic steels are discussed. Most irradiation studies have been carried out in fast reactors, where little transmutation helium forms. Helium has been shown to enhance swelling and affect tensile and fracture behavior, making helium a critical issue, since high helium concentrations will be generated in conjunction with displacement damage in a fusion reactor. These issues are reviewed to evaluate the status of ferritic/martensitic steels and to assess the research required to insure that such steels are viable candidates for fusion applications
Evaluation criteria of structural steel reliability
International Nuclear Information System (INIS)
Zav'yalov, A.S.
1980-01-01
Different low-carbon and medium-carbon structural steels are investigated. It is stated that steel reliability evaluation criteria depend on the fracture mode, steel suffering from the brittle fracture under the influence of the stresses (despite their great variety) arising in articles during the production and operation. Fibrous steel fracture at the given temperature and article thickness says about its high ductility and toughness and brittle fractures are impossible. Brittle fractures take place in case of a crystalline and mixed fracture with a predominant crystalline component. Evaluation methods of article and sample steel structural strength differing greatly from real articles in a thickness (diameter) or used at temperatures higher than possible operation temperatures cannot be reliability evaluation criteria because at a great thickness (diameter) and lower operation temperatures steel fracture and its strain mode can change resulting in a sharp reliability degradation
Development of PWR pressure vessel steels
International Nuclear Information System (INIS)
Druce, S.; Edwards, B.
1982-01-01
Requirements to be met by vessel steels for pressurized water reactors are analyzed. Chemicat composition of low-alloyed steels, mechanical properties of sheets and forgings made of these steels and changes in the composition and properties over the wall thickness of the reactor vessel are presented. Problems of the vessel manufacturing including welding and heat treatment processes of sheets and forgings are considered. Special attention is paid to steel embrittlement during vessel fabrication and operation (radiation embrittlement, thermal embrittlement). The role of non-metal inclusions and their effect on anisotropy of fracture toughness is discussed. Possible developments of vessel steels and procedures for producing reactor vessels are reviewed
Development of PWR pressure vessel steels
Energy Technology Data Exchange (ETDEWEB)
Druce, S.; Edwards, B.
1982-01-01
Requirements to be met by vessel steels for pressurized water reactors are analyzed. Chemicat composition of low-alloyed steels, mechanical properties of sheets and forgings made of these steels and changes in the composition and properties over the wall thickness of the reactor vessel are presented. Problems of the vessel manufacturing including welding and heat treatment processes of sheets and forgings are considered. Special attention is paid to steel embrittlement during vessel fabrication and operation (radiation embrittlement, thermal embrittlement). The role of non-metal inclusions and their effect on anisotropy of fracture toughness is discussed. Possible developments of vessel steels and procedures for producing reactor vessels are reviewed.
NKTR-102 Efficacy versus irinotecan in a mouse model of brain metastases of breast cancer
International Nuclear Information System (INIS)
Adkins, Chris E.; Nounou, Mohamed I.; Hye, Tanvirul; Mohammad, Afroz S.; Terrell-Hall, Tori; Mohan, Neel K.; Eldon, Michael A.; Hoch, Ute; Lockman, Paul R.
2015-01-01
Brain metastases are an increasing problem in women with invasive breast cancer. Strategies designed to treat brain metastases of breast cancer, particularly chemotherapeutics such as irinotecan, demonstrate limited efficacy. Conventional irinotecan distributes poorly to brain metastases; therefore, NKTR-102, a PEGylated irinotecan conjugate should enhance irinotecan and its active metabolite SN38 exposure in brain metastases leading to brain tumor cytotoxicity. Female nude mice were intracranially or intracardially implanted with human brain seeking breast cancer cells (MDA-MB-231Br) and dosed with irinotecan or NKTR-102 to determine plasma and tumor pharmacokinetics of irinotecan and SN38. Tumor burden and survival were evaluated in mice treated with vehicle, irinotecan (50 mg/kg), or NKTR-102 low and high doses (10 mg/kg, 50 mg/kg respectively). NKTR-102 penetrates the blood-tumor barrier and distributes to brain metastases. NKTR-102 increased and prolonged SN38 exposure (>20 ng/g for 168 h) versus conventional irinotecan (>1 ng/g for 4 h). Treatment with NKTR-102 extended survival time (from 35 days to 74 days) and increased overall survival for NKTR-102 low dose (30 % mice) and NKTR-102 high dose (50 % mice). Tumor burden decreased (37 % with 10 mg/kg NKTR-102 and 96 % with 50 mg/kg) and lesion sizes decreased (33 % with 10 mg/kg NKTR-102 and 83 % with 50 mg/kg NKTR-102) compared to conventional irinotecan treated animals. Elevated and prolonged tumor SN38 exposure after NKTR-102 administration appears responsible for increased survival in this model of breast cancer brain metastasis. Further, SN38 concentrations observed in this study are clinically achieved with 145 mg/m 2 NKTR-102, such as those used in the BEACON trial, underlining translational relevance of these results. The online version of this article (doi:10.1186/s12885-015-1672-4) contains supplementary material, which is available to authorized users
International Nuclear Information System (INIS)
Koh, S. K.; Na, E. G.; Baek, T. H.; Won, S. Y.; Park, S. J.; Lee, S. W.
2001-01-01
In this paper, high strength pressure vessel steels having the same chemical compositions were manufactured by the two different steel-making processes, such as Vacuum Degassing(VD) and Electro-Slag Remelting(ESR) methods. After the steel-making process, they were normalized at 955 deg. C, quenched at 843 .deg. C, and finally tempered at 550 .deg. C or 450 deg. C, resulting in tempered martensitic microstructures with different yielding strengths depending on the tempering conditions. Low-Cycle Fatigue(LCF) tests, Fatigue Crack Growth Rate(FCGR) tests, and fracture toughness tests were performed to investigate the fatigue and fracture behaviors of the pressure vessel steels. In contrast to very similar monotonic, LCF, and FCGR behaviors between VD and ESR steels, a quite difference was noticed in the fracture toughness. Fracture toughness of ESR steel was higher than that of VD steel, being attributed to the removal of impurities in steel-making process
Zhao, Hemin; Dong, Fujun; Liu, Xiaolin; Xiong, Xiong
This essay introduces the developed high-heat input welding quenched and tempered pressure vessel steel 12MnNiVR for oil storage tank by Xinyu Steel, which passed the review by the Boiler and Pressure Vessel Standards Technical Committee in 2009. The review comments that compared to the domestic and foreign similar steel standard, the key technical index of enterprise standard were in advanced level. After the heat input of 100kJ/cm electro-gas welding, welded points were still with excellent low temperature toughness at -20°C. The steel plate may be constructed for oil storage tank, which has been permitted by thickness range from 10 to 40mm, and design temperature among -20°C-100°C. It studied microstructure genetic effects mechanical properties of the steel. Many production practices indicated that the mechanical properties of products and the steel by stress relief heat treatment of steel were excellent, with pretreatment of hot metal, converter refining, external refining, protective casting, TMCP and heat treatment process measurements. The stability of performance and matured technology of Xinyu Steel support the products could completely service the demand of steel constructed for 10-15 million cubic meters large oil storage tank.
29 CFR 102.100 - Notice of petition; service of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Notice of petition; service of petition. 102.100 Section... petition; service of petition. Upon the filing of a petition the petitioner shall immediately serve in the manner provided by § 102.114(a) of these rules a copy of the petition on all parties to the proceeding...
21 CFR 102.41 - Potato chips made from dried potatoes.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Potato chips made from dried potatoes. 102.41... Specific Nonstandardized Foods § 102.41 Potato chips made from dried potatoes. (a) The common or usual name of the food product that resembles and is of the same composition as potato chips, except that it is...
Corrosion behavior of 2205 duplex stainless steel.
Platt, J A; Guzman, A; Zuccari, A; Thornburg, D W; Rhodes, B F; Oshida, Y; Moore, B K
1997-07-01
The corrosion of 2205 duplex stainless steel was compared with that of AISI type 316L stainless steel. The 2205 stainless steel is a potential orthodontic bracket material with low nickel content (4 to 6 wt%), whereas the 316L stainless steel (nickel content: 10 to 14 wt%) is a currently used bracket material. Both stainless steels were subjected to electrochemical and immersion (crevice) corrosion tests in 37 degrees C, 0.9 wt% sodium chloride solution. Electrochemical testing indicates that 2205 has a longer passivation range than 316L. The corrosion rate of 2205 was 0.416 MPY (milli-inch per year), whereas 316L exhibited 0.647 MPY. When 2205 was coupled to 316L with equal surface area ratio, the corrosion rate of 2205 reduced to 0.260 MPY, indicating that 316L stainless steel behaved like a sacrificial anode. When 316L is coupled with NiTi, TMA, or stainless steel arch wire and was subjected to the immersion corrosion test, it was found that 316L suffered from crevice corrosion. On the other hand, 2205 stainless steel did not show any localized crevice corrosion, although the surface of 2205 was covered with corrosion products, formed when coupled to NiTi and stainless steel wires. This study indicates that considering corrosion resistance, 2205 duplex stainless steel is an improved alternative to 316L for orthodontic bracket fabrication when used in conjunction with titanium, its alloys, or stainless steel arch wires.
78 FR 69177 - Ownership and Control Reports, Forms 102/102S, 40/40S, and 71
2013-11-18
... equally important regulatory challenges. Effective surveillance now requires automated analysis and... Form 102S ix. Consolidation Form Proposed by FIA x. Section 15(a) Factors C. Regulatory Flexibility Act... establish a comprehensive new regulatory framework for swaps and security-based swaps. The legislation was...
Directory of Open Access Journals (Sweden)
PARUSOV E. V.
2017-01-01
Full Text Available Formulation of the problem. Significant influence on the quality of rolled steel have various defects on its surface, which in its turn inherited from surface defects of billet and possible damage to the surface of rolled steel in the rolling mill line. One of the criteria for assessing the quality indicators of rolled steel is rationing of surface defects [1; 2; 3; 6; 7]. Current status of the issue. Analyzing the different requirements of regulations to the surface quality of the rolled high-carbon steels, we can conclude that the maximum allowable depth of defects on the surface of billet should be in the range of 2.0...5.0 mm (depending on the section of the billet, method of its production and further the destination Purpose. Develop a methodology for calculating the maximum allowable depth of defects on the steel billet surface depending on the requirements placed on the surface quality of hot-rolled steel. Results. A simplified method of calculation, allowing at the rated depth of defects on the surface of the hot-rolled steel to make operatively calculation of the maximum allowable depth of surface defects of steel billets before heating the metal in the heat deformation was developed. The findings shows that the maximum allowable depth of surface defects is reduced with increasing diameter rolled steel, reducing the initial section steel billet and degrees of oxidation of the metal in the heating furnace.
International Nuclear Information System (INIS)
Bilous, W.; Hajewska, E.; Szteke, W.; Przyborska, M.; Wasiak, J.; Wieczorkowski, M.
2005-01-01
In the paper the fundamental steels using in the construction of pressure vessel water reactor are discussed. The properties of these steels as well as the influence of neutron irradiation on its degradation in the time of exploitation are also done. (authors)
Identification of MPL R102P Mutation in Hereditary Thrombocytosis.
Bellanné-Chantelot, Christine; Mosca, Matthieu; Marty, Caroline; Favier, Rémi; Vainchenker, William; Plo, Isabelle
2017-01-01
The molecular basis of hereditary thrombocytosis is germline mutations affecting the thrombopoietin (TPO)/TPO receptor (MPL)/JAK2 signaling axis. Here, we report one family presenting two cases with a mild thrombocytosis. By sequencing JAK2 and MPL coding exons, we identified a germline MPL R102P heterozygous mutation in the proband and his daughter. Concomitantly, we detected high TPO levels in the serum of these two patients. The mutation was not found in three other unaffected cases from the family except in another proband's daughter who did not present thrombocytosis but had a high TPO level. The MPL R102P mutation was first described in congenital amegakaryocytic thrombocytopenia in a homozygous state with a loss-of-function activity. It was previously shown that MPL R102P was blocked in the endoplasmic reticulum without being able to translocate to the plasma membrane. Thus, this case report identifies for the first time that MPL R102P mutation can differently impact megakaryopoiesis: thrombocytosis or thrombocytopenia depending on the presence of the heterozygous or homozygous state, respectively. The paradoxical effect associated with heterozygous MPL R102P may be due to subnormal cell-surface expression of wild-type MPL in platelets inducing a defective TPO clearance. As a consequence, increased TPO levels may activate megakaryocyte progenitors that express a lower, but still sufficient level of MPL for the induction of proliferation.
Identification of MPL R102P Mutation in Hereditary Thrombocytosis
Directory of Open Access Journals (Sweden)
Christine Bellanné-Chantelot
2017-09-01
Full Text Available The molecular basis of hereditary thrombocytosis is germline mutations affecting the thrombopoietin (TPO/TPO receptor (MPL/JAK2 signaling axis. Here, we report one family presenting two cases with a mild thrombocytosis. By sequencing JAK2 and MPL coding exons, we identified a germline MPL R102P heterozygous mutation in the proband and his daughter. Concomitantly, we detected high TPO levels in the serum of these two patients. The mutation was not found in three other unaffected cases from the family except in another proband’s daughter who did not present thrombocytosis but had a high TPO level. The MPL R102P mutation was first described in congenital amegakaryocytic thrombocytopenia in a homozygous state with a loss-of-function activity. It was previously shown that MPL R102P was blocked in the endoplasmic reticulum without being able to translocate to the plasma membrane. Thus, this case report identifies for the first time that MPL R102P mutation can differently impact megakaryopoiesis: thrombocytosis or thrombocytopenia depending on the presence of the heterozygous or homozygous state, respectively. The paradoxical effect associated with heterozygous MPL R102P may be due to subnormal cell-surface expression of wild-type MPL in platelets inducing a defective TPO clearance. As a consequence, increased TPO levels may activate megakaryocyte progenitors that express a lower, but still sufficient level of MPL for the induction of proliferation.
Heat Treatment and Properties of Iron and Steel
National Research Council Canada - National Science Library
Digges, Thomas
1966-01-01
.... Chemical compositions, heat treatments, and some properties and uses are presented for structural steels, tool steels, stainless and heat-resisting steels, precipitation-hardenable stainless steels...
International Nuclear Information System (INIS)
Esch, R.A.
1996-01-01
Ten grab samples (2AN-95-1, 2, 3, 4A, 5A; 102-AN-1, 2, 3(A), 3(B), and 4) and one field blank (2AN-95-6) were taken from tank 241-AN-102. In support of the safety screening program, total organic carbon and cyanide were performed as secondary analyses because the differential scanning calorimetry results exceeded the notification limit. These were compared to safety screening limits at a confidence level of 95%. Waste compatibility analyses were performed on the 3 supernate samples and the field blank from the latest sampling event. Results presented in the 45 day and in this report show that the waste in Tank 241-AN-1D2 has energetics greater than 480 J/g (dry) and total organic carbon > 3 wt%; however, with a moisture content > 17 wt%, the tank may be considered ''conditionally'' safe in accordance with the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue
2012-09-30
system components to be built. Figure la shows the machine design . PSC-2012 Page 94 Glue Application Sheet Transfer Feed Elevator Figure la...Department of Defense such as cleats, ejection chutes , control arms, muzzle brakes, mortar components, clevises, tow bar clamps, ammo conveyor elements...Foundry and the members of Steel Founders’ Society of America. Abstract Weapon system designers and builders need advanced steel casting technology
High temperature oxidation behavior of ODS steels
Kaito, T.; Narita, T.; Ukai, S.; Matsuda, Y.
2004-08-01
Oxide dispersion strengthened (ODS) steels are being developing for application as advanced fast reactor cladding and fusion blanket materials, in order to allow increased operation temperature. Oxidation testing of ODS steel was conducted under a controlled dry air atmosphere to evaluate the high temperature oxidation behavior. This showed that 9Cr-ODS martensitic steels and 12Cr-ODS ferritic steels have superior high temperature oxidation resistance compared to 11 mass% Cr PNC-FMS and 17 mass% Cr ferritic stainless steel. This high temperature resistance is attributed to earlier formation of the protective α-Cr 2O 3 on the outer surface of ODS steels.
41 CFR 301-75.102 - What pre-employment interview travel expenses are not payable?
2010-07-01
... interview travel expenses are not payable? 301-75.102 Section 301-75.102 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75-PRE-EMPLOYMENT INTERVIEW TRAVEL Travel Expenses § 301-75.102 What pre-employment interview travel...
41 CFR 102-118.20 - Who is subject to this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who is subject to this part? 102-118.20 Section 102-118.20 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
41 CFR 102-41.235 - May we sell forfeited drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we sell forfeited drug paraphernalia? 102-41.235 Section 102-41.235 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
Fragmentation of armor piercing steel projectiles upon oblique perforation of steel plates
Directory of Open Access Journals (Sweden)
Aizik F.
2012-08-01
Full Text Available In this study, a constitutive strength and failure model for a steel core of a14.5 mm API projectile was developed. Dynamic response of a projectile steel core was described by the Johnson-Cook constitutive model combined with principal tensile stress spall model. In order to obtain the parameters required for numerical description of projectile core material behavior, a series of planar impact experiments was done. The parameters of the Johnson-Cook constitutive model were extracted by matching simulated and experimental velocity profiles of planar impact. A series of oblique ballistic experiments with x-ray monitoring was carried out to study the effect of obliquity angle and armor steel plate thickness on shattering behavior of the 14.5 mm API projectile. According to analysis of x-ray images the fragmentation level increases with both steel plate thickness and angle of inclination. The numerical modeling of the ballistic experiments was done using commercial finite element code, LS-DYNA. Dynamic response of high hardness (HH armor steel was described using a modified Johnson-Cook strength and failure model. A series of simulations with various values of maximal principal tensile stress was run in order to capture the overall fracture behavior of the projectile’s core. Reasonable agreement between simulated and x-ray failure pattern of projectile core has been observed.
On high temperature strength of carbon steels
International Nuclear Information System (INIS)
Ichinose, Hiroyuki; Tamura, Manabu; Kanero, Takahiro; Ihara, Yoshihito
1977-01-01
In the steels for high temperature use, the oxidation resistance is regarded as important, but carbon steels show enough oxidation resistance to be used continuously at the temperature up to 500 deg. C if the strength is left out of consideration, and up to 450 deg. C even when the strength is taken into account. Moreover, the production is easy, the workability and weldability are good, and the price is cheap in carbon steels as compared with alloy steels. In the boilers for large thermal power stations, 0.15-0.30% C steels are used for reheater tubes, main feed water tubes, steam headers, wall water tubes, economizer tubes, bypass pipings and others, and they account for 70% of all steel materials used for the boilers of 350 MW class and 30% in 1000 MW class. The JIS standard for the carbon steels for high temperature use and the related standards in foreign countries are shown. The high temperature strength of carbon steels changes according to the trace elements, melting and heat treatment as well as the main compositions of C, Si and Mn. Al and N affect the high temperature strength largely. The characteristics of carbon steels after the heating for hours, the factors controlling the microstructure and high temperature strength, and the measures to improve the high temperature strength of carbon steels are explained. (Kako, I.)
East/west steels for reactor pressure vessels
International Nuclear Information System (INIS)
Davies, M.; Kryukov, A.; Nikolaev, Y.; English, C.
1997-01-01
The report consist of three parts dealing with comparison of the irradiation behaviour of 'Eastern' and 'Western' steels, mechanisms of irradiation embrittlement and the role of compositional variations on the irradiation sensitivity of pressure vessels. Nickel, copper and phosphorus are the elements rendering the most essential influence on behaviour of pressure vessel steels under irradiation and subsequent thermal annealing. For WWER-440 reactor pressure vessel (RPV) steels in which nickel content does nor exceed 0.3% the main affecting factors are phosphorous and copper. For WWER-1000 RPV welds in which nickel content generally exceed 1.5% the role of nickel in radiation embrittlement is decisive. In 'Western' type steels main influencing elements are nickel and copper. The secondary role of phosphorus in radiation embrittlement of 'Western' steels is caused by lower relative content compared to 'Eastern' steels. The process of how copper, phosphorus and nickel contents affect the irradiation sensitivity of both types of steel seem to be similar. Some distinctions between the observed radiation effects is apparently caused by differences in the irradiation conditions and ratios of the contents of above mentioned elements in both types of steel. For 'Eastern' RPV steels the dependence of the recovery degree of irradiated steels due to postirradiation thermal annealing id obviously dependent on phosphorus contents and the influence of nickel contents on this process is detectable
Development of ferritic steels for fusion reactor applications
Energy Technology Data Exchange (ETDEWEB)
Klueh, R.L.; Maziasz, P.J.; Corwin, W.R.
1988-08-01
Chromium-molybdenum ferritic (martensitic) steels are leading candidates for the structural components for future fusion reactors. However, irradiation of such steels in a fusion environment will produce long-lived radioactive isotopes that will lead to difficult waste-disposal problems. Such problems could be reduced by replacing the elements in the steels (i.e., Mo, Nb, Ni, N, and Cu) that lead to long-lived radioactive isotopes. We have proposed the development of ferritic steels analogous to conventional Cr-Mo steels, which contain molybdenum and niobium. It is proposed that molybdenum be replaced by tungsten and niobium be replaced by tantalum. Eight experimental steels were produced. Chromium concentrations of 2.25, 5, 9, and 12% were used (all concentrations are in wt %). Steels with these chromium compositions, each containing 2% W and 0.25% V, were produced. To determine the effect of tungsten and vanadium, 2.25 Cr steels were produced with 2% W and no vanadium and with 0.25% V and O and 1% W. A 9Cr steel containing 2% W, 0.25 V, and 0.07% Ta was also studied. For all alloys, carbon was maintained at 0.1%. Tempering studies on the normalized steels indicated that the tempering behavior of the new Cr-W steels was similar to that of the analogous Cr-Mo steels. Microscopy studies indicated that 2% tungsten was required in the 2.25 Cr steels to produce 100% bainite in 15.9-mm-thick plate during normalization. The 5Cr and 9Cr steels were 100% martensite, but the 12 Cr steel contained about 75% martensite with the balance delta-ferrite. 33 refs., 35 figs., 5 tabs.
Development of ferritic steels for fusion reactor applications
International Nuclear Information System (INIS)
Klueh, R.L.; Maziasz, P.J.; Corwin, W.R.
1988-08-01
Chromium-molybdenum ferritic (martensitic) steels are leading candidates for the structural components for future fusion reactors. However, irradiation of such steels in a fusion environment will produce long-lived radioactive isotopes that will lead to difficult waste-disposal problems. Such problems could be reduced by replacing the elements in the steels (i.e., Mo, Nb, Ni, N, and Cu) that lead to long-lived radioactive isotopes. We have proposed the development of ferritic steels analogous to conventional Cr-Mo steels, which contain molybdenum and niobium. It is proposed that molybdenum be replaced by tungsten and niobium be replaced by tantalum. Eight experimental steels were produced. Chromium concentrations of 2.25, 5, 9, and 12% were used (all concentrations are in wt %). Steels with these chromium compositions, each containing 2% W and 0.25% V, were produced. To determine the effect of tungsten and vanadium, 2.25 Cr steels were produced with 2% W and no vanadium and with 0.25% V and O and 1% W. A 9Cr steel containing 2% W, 0.25 V, and 0.07% Ta was also studied. For all alloys, carbon was maintained at 0.1%. Tempering studies on the normalized steels indicated that the tempering behavior of the new Cr-W steels was similar to that of the analogous Cr-Mo steels. Microscopy studies indicated that 2% tungsten was required in the 2.25 Cr steels to produce 100% bainite in 15.9-mm-thick plate during normalization. The 5Cr and 9Cr steels were 100% martensite, but the 12 Cr steel contained about 75% martensite with the balance delta-ferrite. 33 refs., 35 figs., 5 tabs
Hydrogen effects in stainless steel
International Nuclear Information System (INIS)
Caskey, G.R. Jr.
1983-01-01
The effects of hydrogen on stainless steels have been reviewed and are summarized in this paper. Discussion covers hydrogen solution and transport in stainless steels as well as the effects of hydrogen on deformation and fracture under various loading conditions. Damage is caused also by helium that arises from decay of the hydrogen isotope tritium. Austenitic, ferritic, martensite, and precipitation-hardenable stainless steels are included in the discussion. 200 references
Occupational Profiles in the European Steel Industry.
Franz, Hans-Werner; And Others
The steel industry in Europe has faced great changes, with resulting layoffs and restructuring. Now that the most basic changes seem to be over, it has become evident that the remaining steel industry requires more highly trained workers than was the case previously. Although steel maintenance employees were always highly skilled, steel production…
Yu, Wei-Wen
2010-01-01
The definitive text in the field, thoroughly updated and expanded Hailed by professionals around the world as the definitive text on the subject, Cold-Formed Steel Design is an indispensable resource for all who design for and work with cold-formed steel. No other book provides such exhaustive coverage of both the theory and practice of cold-formed steel construction. Updated and expanded to reflect all the important developments that have occurred in the field over the past decade, this Fourth Edition of the classic text provides you with more of the detailed, up-to-the-minute techni
Directory of Open Access Journals (Sweden)
Ahmed A. M. AL-Shaar
2018-01-01
Full Text Available Self-compacting concrete-filled steel tube (SCCFST beams, similar to other structural members, necessitate retrofitting for many causes. However, research on SCCFST beams externally retrofitted by bolted steel plates has seldom been explored in the literature. This paper aims at experimentally investigating the retrofitting performance of square self-compacting concrete-filled steel tube (SCCFST beams using bolted steel plates with three different retrofitting schemes including varied configurations and two different steel plate lengths under flexure. A total of 18 specimens which consist of 12 retrofitted SCCFST beams, three unretrofitted (control SCCFST beams, and three hollow steel tubes were used. The flexural behaviour of the retrofitted SCCFST beams was examined regarding flexural strength, failure modes, and moment versus deflection curves, energy absorption, and ductility. Experimental results revealed that the implemented retrofitting schemes efficiently improve the moment carrying capacity and stiffness of the retrofitted SCCFST beams compared to the control beams. The increment in flexural strength ranged from 1% to 46%. Furthermore, the adopted retrofitting schemes were able to restore the energy absorption and ductility of the damaged beams in the range of 35% to 75% of the original beam ductility. Furthermore, a theoretical model was suggested to predict the moment capacity of the retrofitted SCCFST beams. The theoretical model results were in good agreement with the test results.
ESF GROUND SUPPORT - STRUCTURAL STEEL ANALYSIS
Energy Technology Data Exchange (ETDEWEB)
T. Misiak
1996-06-26
The purpose and objective of this analysis are to expand the level of detail and confirm member sizes for steel sets included in the Ground Support Design Analysis, Reference 5.20. This analysis also provides bounding values and details and defines critical design attributes for alternative configurations of the steel set. One possible configuration for the steel set is presented. This analysis covers the steel set design for the Exploratory Studies Facility (ESF) entire Main Loop 25-foot diameter tunnel.
41 CFR 102-37.40 - What type of surplus property is available for donation?
2010-07-01
... property is available for donation? 102-37.40 Section 102-37.40 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY General Provisions Donation Overview § 102-37.40 What type of surplus property is available for donation? All surplus property (including property held by...
2010-07-01
... such complaint may be amended upon such terms as may be deemed just, prior to the hearing, by the... hearing; and after the case has been transferred to the Board pursuant to § 102.45, at any time prior to... to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Procedure Under Section 10 (a...
Hanford Double-Shell Tank AY-102 Radioactive Waste Leak Investigation Update
International Nuclear Information System (INIS)
Washenfelder, Dennis J.
2015-01-01
The presentation outline is: Briefly review leak integrity status of tank AY-102 and current leak behavior; Summarize recent initiatives to understand leak mechanism and to verify integrity of remaining waste confinement structures; describe planned waste recovery activities; and, introduce other papers on tank AY-102 topics.
Hanford Double-Shell Tank AY-102 Radioactive Waste Leak Investigation Update
Energy Technology Data Exchange (ETDEWEB)
Washenfelder, Dennis J. [Washington River Protection Solutions, Richland, WA (United States)
2015-02-03
The presentation outline is: Briefly review leak integrity status of tank AY-102 and current leak behavior; Summarize recent initiatives to understand leak mechanism and to verify integrity of remaining waste confinement structures; describe planned waste recovery activities; and, introduce other papers on tank AY-102 topics.
Mondal, Mounarik; Das, Hrishikesh; Ahn, Eun Yeong; Hong, Sung Tae; Kim, Moon-Jo; Han, Heung Nam; Pal, Tapan Kumar
2017-09-01
Friction stir welding (FSW) of dissimilar stainless steels, low nickel austenitic stainless steel and 409M ferritic stainless steel, is experimentally investigated. Process responses during FSW and the microstructures of the resultant dissimilar joints are evaluated. Material flow in the stir zone is investigated in detail by elemental mapping. Elemental mapping of the dissimilar joints clearly indicates that the material flow pattern during FSW depends on the process parameter combination. Dynamic recrystallization and recovery are also observed in the dissimilar joints. Among the two different stainless steels selected in the present study, the ferritic stainless steels shows more severe dynamic recrystallization, resulting in a very fine microstructure, probably due to the higher stacking fault energy.
Utilization of structural steel in buildings.
Moynihan, Muiris C; Allwood, Julian M
2014-08-08
Over one-quarter of steel produced annually is used in the construction of buildings. Making this steel causes carbon dioxide emissions, which climate change experts recommend be reduced by half in the next 37 years. One option to achieve this is to design and build more efficiently, still delivering the same service from buildings but using less steel to do so. To estimate how much steel could be saved from this option, 23 steel-framed building designs are studied, sourced from leading UK engineering firms. The utilization of each beam is found and buildings are analysed to find patterns. The results for over 10 000 beams show that average utilization is below 50% of their capacity. The primary reason for this low value is 'rationalization'-providing extra material to reduce labour costs. By designing for minimum material rather than minimum cost, steel use in buildings could be drastically reduced, leading to an equivalent reduction in 'embodied' carbon emissions.
Corrosion fatigue of pressure vessel steels in PWR environments--influence of steel sulfur content
International Nuclear Information System (INIS)
Scott, P.M.; Druce, S.G.; Truswell, A.E.
1984-01-01
Large effects of simulated light water reactor environments at 288 C on fatigue crack growth in low alloy pressure vessel steels are observed only when specific mechanical, metallurgical, and electrochemical conditions are satisfied simultaneously. In this paper, the relative importance of three key variables--steel impurity content, water chemistry, and flow rate--and their interaction with loading rate or strain rate are examined. In particular, the results of a systematic examination of the influence of a steel's sulfur content are described
Corrosion fatigue of pressure vessel steels in PWR environments--influence of steel sulfur content
Energy Technology Data Exchange (ETDEWEB)
Scott, P.M.; Druce, S.G.; Truswell, A.E.
1984-07-01
Large effects of simulated light water reactor environments at 288 C on fatigue crack growth in low alloy pressure vessel steels are observed only when specific mechanical, metallurgical, and electrochemical conditions are satisfied simultaneously. In this paper, the relative importance of three key variables--steel impurity content, water chemistry, and flow rate--and their interaction with loading rate or strain rate are examined. In particular, the results of a systematic examination of the influence of a steel's sulfur content are described.
Aerosol measurements from plasma torch cuts on stainless steel, carbon steel, and aluminum
International Nuclear Information System (INIS)
Novick, V.J.; Brodrick, C.J.; Crawford, S.; Nasiatka, J.; Pierucci, K.; Reyes, V.; Sambrook, J.; Wrobel, S.; Yeary, J.
1996-01-01
The main purpose of this project is to quantify aerosol particle size and generation rates produced by a plasma torch whencutting stainless steel, carbon steel and aluminum. the plasma torch is a common cutting tool used in the dismantling of nuclear facilities. Eventually, other cutting tools will be characterized and the information will be compiled in a user guide to aid in theplanning of both D ampersand D and other cutting operations. The data will be taken from controlled laboratory experiments on uncontaminated metals and field samples taken during D ampersand D operations at ANL nuclear facilities. The plasma torch data was collected from laboratory cutting tests conducted inside of a closed, filtered chamber. The particle size distributions were determined by isokinetically sampling the exhaust duct using a cascade impactor. Cuts on different thicknesses showed there was no observable dependence of the aerosol quantity produced as a function of material thickness for carbon steel. However, data for both stainless steel and aluminum revealed that the aerosol mass produced for these materials appear to have some dependance on thickness, with thinner materials producing tmore aerosols. The results of the laboratory cutting tests show that most measured particle size distributions are bimodal with one mode at about 0.2 μm and the other at about 10 μm. The average Mass Median Aerodynamic Diameters (MMAD's) for these tests are 0.36 ±0.08 μm for stainless steel, 0.48 ±0.17μm for aluminum and 0.52±0.12 μm for carbon steel
42 CFR 460.102 - Interdisciplinary team.
2010-10-01
... ELDERLY (PACE) PACE Services § 460.102 Interdisciplinary team. (a) Basic requirement. A PACE organization... the following: (i) Managing a participant's medical situations. (ii) Overseeing a participant's use of.... (iii) Documenting changes of a participant's condition in the participant's medical record consistent...
48 CFR 15.102 - Oral presentations.
2010-10-01
... document what the Government relied upon in making the source selection decision. The method and level of... Section 15.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS... impact (including cost) on small businesses. In considering the costs of oral presentations, contracting...
41 CFR 102-76.60 - To which facilities does the Architectural Barriers Act apply?
2010-07-01
... PROPERTY 76-DESIGN AND CONSTRUCTION Architectural Barriers Act § 102-76.60 To which facilities does the Architectural Barriers Act apply? (a) The Architectural Barriers Act applies to any facility that is intended... the Architectural Barriers Act apply? 102-76.60 Section 102-76.60 Public Contracts and Property...
41 CFR 102-37.580 - Who is responsible for costs associated with the donation?
2010-07-01
... costs associated with the donation? 102-37.580 Section 102-37.580 Public Contracts and Property... PROPERTY 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.580 Who is responsible for costs associated with the donation? The recipient public body...
41 CFR 102-34.230 - How am I responsible for protecting Government motor vehicles?
2010-07-01
... theft or damage; and (b) Lock the unattended Government motor vehicle. (The only exception to this... protecting Government motor vehicles? 102-34.230 Section 102-34.230 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Official Use of Government Motor Vehicles § 102-34.230 How am I...
41 CFR 102-74.15 - What are the facility management responsibilities of occupant agencies?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are the facility management responsibilities of occupant agencies? 102-74.15 Section 102-74.15 Public Contracts and Property... PROPERTY 74-FACILITY MANAGEMENT Facility Management § 102-74.15 What are the facility management...
Kawasaki Steel Giho, Vol. 27, No. 4, 1995. Special issue on steel structure
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-31
;Contents (Partial): Vertical Gust Prediction of Cable-Stayed Bridges in Yawed Wind; Design and Construction of a Super Platform Structure Made of Steel; Prefabricated Steel Deck of Battledeck Floor Type for Redecking; Aesthetic Design of Structures; and Lift-up Construction Method for Multi-layer Building.
Directory of Open Access Journals (Sweden)
Ryo Asaoka
Full Text Available PURPOSE: To cluster test points in glaucoma patients' 30-2 and 10-2 visual field (VF (Humphrey Field Analyzer: HFA, Carl Zeiss Meditec, Dublin, CA in order to map the different regions damaged by the disease. METHOD: This retrospective study included 128 eyes from 128 patients. 142 total deviation (TD values (74 from the 30-2 VF and 68 from the 10-2 VF were clustered using the 'Hierarchical Ordered Partitioning And Collapsing Hybrid-Partitioning Around Medoids' algorithm. The stability of the identified clusters was evaluated using bootstrapping. RESULTS: 65 sectors were identified in total: 38 sectors were located outside the 10-2 VF whereas 29 sectors were located inside the 10-2 VF (two sectors overlap in both grids. The mapping of many sectors appeared to follow the distribution of retinal nerve fiber bundles. The results of bootstrapping suggested clusters were stable whether they were outside or inside the 10-2 VF. CONCLUSION: A considerable number of sectors were identified in the 10-2 VF area, despite the fact that clustering was carried out on all points in both the 30-2 VF and 10-2 VF simultaneously. These findings suggest that glaucomatous central VF deterioration cannot be picked up by the 30-2 test grid alone, because of poor spatial sampling; denser estimation of the central ten degrees, than offered by the 30-2 test grid alone, is needed. It may be beneficial to develop a new VF test grid that combines test points from 30-2 and 10-2 VFs--the results of this study could help to devise this test grid.
Data for a steel industry model
Mæstad, Ottar
2000-01-01
SNF has recently developed a new model of the steel market and some of the major factor markets connected to the steel industry. The aim of the model has been to study how regulations of the emissions of carbon dioxide (CO2) in the steel industry might affect the structure of the industry. It has also been an objective to investigate how structural changes in the steel industry might influence on the industry’s demand for transport services. This paper outlines the details about the data that...
Symbolic aesthetics in steel structural systems
Directory of Open Access Journals (Sweden)
Usama Abdul-Mun'em Khuraibet
2015-02-01
Full Text Available The aesthetic expression and its orders are important for steel structures forming. Steel structures are a compilation of structural elements, where its shapes have standard dimensions and pre-fabricated. As the steel construction systems not only aim to achieve the functional requirements for users, but must also have the symbolic aesthetics which provides visually and cognitive expression for viewers. In this sense the research interested in expressional aesthetics in these systems and highlights the importance of attention as structural items. Therefore the visual items which related with steel structures contain some of the most powerful forms of modern architecture, steel structures with a glass cladding, agility and accuracy in manufacture of structural elements as visual items, structural interest in the forms of spaces which have long span systems or in high buildings are different forms of expression and influence. So the research focuses on the study of those expressive patterns related with the steel construction properties, including the advantages of these systems at the level of strength and firmness, flexibility and economy as well as aesthetic and expression. Accordingly, the research problem concentrated on educational shortage in the study of the structural steel system aspects concerning constructional characteristic, expressive and aesthetic features, and how to deal with them as a language bearing the symbols and meanings which have clear structural style, because it the best ways to make those systems as communication means with users, by premise that the use of expressional symbol in steel construction increases the aesthetic value. Therefore the research aims to reveal the most structural and expressive patterns by analysis the expressional means and steel structural aesthetics.
33 CFR 100.102 - Great Connecticut River Raft Race, Middletown, CT.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Great Connecticut River Raft Race, Middletown, CT. 100.102 Section 100.102 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Raft Race, Middletown, CT. (a) Regulated Area. That section of the Connecticut River between Dart...
7 CFR 59.102 - Mandatory daily reporting for cows and bulls.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Mandatory daily reporting for cows and bulls. 59.102... (CONTINUED) LIVESTOCK MANDATORY REPORTING Cattle Reporting § 59.102 Mandatory daily reporting for cows and bulls. (a) In General. The corporate officers or officially designated representatives of each cow and...
Future directions for ferritic/martensitic steels for nuclear applications
International Nuclear Information System (INIS)
Klueh, R.L.; Swindeman, R.W.
2000-01-01
High-chromium (7-12% Cr) ferritic/martensitic steels are being considered for nuclear applications for both fission and fusion reactors. Conventional 9-12Cr Cr-Mo steels were the first candidates for these applications. For fusion reactors, reduced-activation steels were developed that were patterned on the conventional steels but with molybdenum replaced by tungsten and niobium replaced by tantalum. Both the conventional and reduced-activation steels are considered to have an upper operating temperature limit of about 550degC. For improved reactor efficiency, higher operating temperatures are required. For ferritic/martensitic steels that could meet such requirements, oxide dispersion-strengthened (ODS) steels are being considered. In this paper, the ferritic/martensitic steels that are candidate steels for nuclear applications will be reviewed, the prospect for ODS steel development and the development of steels produced by conventional processes will be discussed. (author)
41 CFR 102-38.130 - Must we publicly advertise sales of Federal personal property?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Must we publicly advertise sales of Federal personal property? 102-38.130 Section 102-38.130 Public Contracts and Property... PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Advertising § 102-38.130 Must we publicly advertise...
41 CFR 102-37.565 - What is the authority for donations to public bodies?
2010-07-01
... for donations to public bodies? 102-37.565 Section 102-37.565 Public Contracts and Property Management... 37-DONATION OF SURPLUS PERSONAL PROPERTY Donations to Public Bodies in Lieu of Abandonment/Destruction § 102-37.565 What is the authority for donations to public bodies? Section 527 of title 40, United...
41 CFR 102-118.60 - To what extent must my agency use electronic commerce?
2010-07-01
... agency use electronic commerce? 102-118.60 Section 102-118.60 Public Contracts and Property Management... Services § 102-118.60 To what extent must my agency use electronic commerce? Your agency must use electronic commerce in all areas of your transportation program. This includes the use of electronic systems...
Analisis Penerapan Psak – 102 Murabahah (Studi Kasus Pada Ksu Bmt Rahmat Syariah Kediri
Directory of Open Access Journals (Sweden)
Inggrid Eka Pratiwi
2014-11-01
Full Text Available The purpose of this research is to find out whether the accounting practices which include the recognition, measurement, presentation and disclosure of the murabaha transactions applied to the BMT Rahmat Syariah in accordance with PSAK 102 about accounting murabaha. The research method used is descriptive qualitative approach with this type of case study research. The Unit of analysis in this study is the accounting treatment of murabaha is applied to the BMT Rahmat Syariah. Analytical techniques used in this research is a domain analysis techniques. From the results of the research can be determined three related domains of contract i.e. the beginning of akkadian murabaha, during the process of installment and repayment. Research results can be concluded that BMT Rahmat Syariah in terms of recognition, measurement, presentation and disclosure of early contract deal not in accordance with PSAK 102. During the process of contract, in terms of the measurement of profit murabaha were in accordance with PSAK 102, but in terms of recognition, presentation, and disclosure is not in accordance with PSAK 102. Whereas in the recognition, measurement and disclosure of fines (ta'zir is in compliance with PSAK 102 only served and which is not in accordance with PSAK 102. At the time of payment of the measurements were in accordance with PSAK 102, however, recognition, representation, and the disclosure is not in accordance with PSAK 102.
International Nuclear Information System (INIS)
Yonezawa, T.
2015-01-01
In order to clarify the effect of SFE on SCC resistance of austenitic stainless steels and to develop the alternative material of Type 316LN stainless steel for BWR application, the effect of chemical composition and heat treatment on SFE value and SCCGR in oxygenated high temperature water were studied. The correlation factors between SFE values for 54 heats of materials and their chemical compositions for nickel, molybdenum, chromium, manganese, nitrogen, silicon and carbon were obtained. From these correlation factors, original formulae for SFE values calculation of austenitic stainless steels in the SHTWC, SHTFC and AGG conditions were established. The maximum crack length, average crack length and cracked area of the IGSCC for 33 heats were evaluated as IGSCC resistance in oxygenated high temperature water. The IGSCC resistance of strain hardened nonsensitized austenitic stainless steels in oxygenated high temperature water increases with increasing of nickel contents and SFE values. From this study, it is suggested that the SFE value is a key parameter for the IGSCC resistance of non-sensitized strain hardened austenitic stainless steels. As an alternative material of Type 316LN stainless steel, increased SFE value material, which is high nickel, high chromium, low silicon and low nitrogen material, is recommendable. (author)
International Nuclear Information System (INIS)
Dudak, J.R.
1992-01-01
In 1989, National Steel felt the need to take the next step to make its Detroit-based division, Great Lakes Steel, more competitive in the world flat-rolled steel market. In 1988, Great Lakes Steel started flowing natural gas through the first fully litigated bypass (Competitive Sourcing Option) of a local distribution company. In 1989, the second connection with the new supply route for gas transportation, Panhandle Eastern had started flowing and the LDC, Michigan Consolidated Gas Co. (MichCon) had pulled out their piping previously serving the plants. Since we had been able to structure a fully reliable supply route, storage and balancing program for gas in the face of such strong opposition by the LDC, the author felt it was time to attack the next singularly sourced major commodity, electricity. Electricity, at this major integrated steel plant, represented approximately 7% of plant cost yearly. Yet being monopolized, Great Lakes Division (GLD) could not multiple source this commodity like it does with its other 93% of costs, except for labor (25% of the 93%). Multiple sourcing is done to bring competitive pressure to suppliers and to diversify supplies and protect plant operation in the event of failure by one supplier. This paper describes National Steel's strategy to reduce the cost of power, at the minimum of capital costs, the most expedient way possible, that does not sacrifice any major long-term potential cost improvements. The results show that competitively priced power is available across the mid-west, at prices well below many state regulated electric utilities, for at least 5 to 15 years, but with major obstacles in obtaining transmission access
48 CFR 47.102 - Transportation insurance.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Transportation insurance... MANAGEMENT TRANSPORTATION General 47.102 Transportation insurance. (a) The Government generally (1) retains... assumed responsibility. The cost of this insurance to the carrier shall be part of the transportation cost...
41 CFR 101-39.102 - Determinations.
2010-07-01
...-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.1-Establishment, Modification, and Discontinuance of Interagency Fleet Management Systems § 101-39.102 Determinations. Each determination to establish a fleet management system... name of the executive agency designated to be responsible for operating the fleet management system and...
Auburn Steel Company radioactive contamination incident
International Nuclear Information System (INIS)
Bradley, F.J.; Cabasino, L.; Kelly, R.; Awai, A.; Kasyk, G.
1986-04-01
On February 21, 1983, workers at the Auburn Steel Company, Auburn, New York discovered that about 120 tons of steel poured that day had become contaminated with 60 Co. In addition to the steel, the air cleaning system and portions of the mill used in casting the steel were contaminated. Approximately 25 curies of 60 Co were involved. Decontamination and disposal of the contamination cost in excess of $2,200,000. This report details the discovery of the contamination, decontamination of the plant and disposal of the contamination
41 CFR 102-33.130 - If we hire CAS, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we hire CAS, what are our management responsibilities? 102-33.130 Section 102-33.130 Public Contracts and Property... § 102-33.130 If we hire CAS, what are our management responsibilities? If you hire CAS, you are...
41 CFR 102-194.5 - What is the Standard and Optional Forms Management Program?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the Standard and Optional Forms Management Program? 102-194.5 Section 102-194.5 Public Contracts and Property Management... PROGRAMS 194-STANDARD AND OPTIONAL FORMS MANAGEMENT PROGRAM § 102-194.5 What is the Standard and Optional...
41 CFR 102-42.25 - Who retains custody of gifts and decorations pending disposal?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Who retains custody of gifts and decorations pending disposal? 102-42.25 Section 102-42.25 Public Contracts and Property..., Handling and Disposition § 102-42.25 Who retains custody of gifts and decorations pending disposal? (a) The...
41 CFR 102-2.140 - What elements of plain language appear in the FMR?
2010-07-01
... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.140 What elements of plain language... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What elements of plain language appear in the FMR? 102-2.140 Section 102-2.140 Public Contracts and Property Management Federal...
Steeling and Resilience in Art Education
Heise, Donalyn
2014-01-01
Steel is an incredibly strong alloy of iron and carbon. Due to its incredible strength and durability, this resilient material is commonly used for constructing buildings. The transitive verb "steeling" is defined in Miriam-Webster dictionary as "to fill with resolution or determination, as in, she 'steeled herself to face the…
Development of commercial nitrogen-rich stainless steels
International Nuclear Information System (INIS)
Liljas, M.
1999-01-01
This paper reviews the development of nitrogen alloyed stainless steels. Nitrogen alloying of austenitic stainless steels started at an early stage and was to a large extent caused by nickel shortage. However, direct technical advantages such as increased strength of the nitrogen alloyed steels made them attractive alternatives to the current steels. It was not until the advent of the AOD (argon oxygen decarburisation) process in the late 1960s that nitrogen alloying could be controlled to such accuracy that it became successful commercially on a broader scale. The paper describes production aspects and how nitrogen addition influences microstructure and the resulting properties of austenitic and duplex stainless steels. For austenitic steels there are several reasons for nitrogen alloying. Apart from increasing strength nitrogen also improves structural stability, work hardening and corrosion resistance. For duplex steels nitrogen also has a decisive effect in controlling the microstructure during thermal cycles such as welding. (orig.)
Damascus steels: history, processing, properties and carbon dating
International Nuclear Information System (INIS)
Wadsworth, J.
2007-01-01
In the mid-1970s, a class of steels containing high levels of carbon (∼ 1-2 wt% C) was developed for superplastic characteristics - that is, the ability to plastically deform to an extraordinary degree in tension at intermediate temperatures. Because these steels also had excellent room temperature properties, they were developed for their commercial potential. In the late 1970s, we became aware of the striking compositional similarities between these modern steels and the ancient steels of Damascus. This observation led us to revisit the history and metallurgy of Damascus steels and related steels. The legends and origins of Damascus steel date back to the time of Alexander the Great (323 BC) and the medieval Crusades (11th and 12th century AD), and this material has also been the subject of scrutiny by famous scientist in Europe, including Michael Faraday. Modern attempts to reproduce the legendary surface patterns which famously characterized Damascus steels are described. The extend to which the characteristics of Damascus steels are unusual is discussed. Finally, a program on radiocarbon dating was initiated to directly determine the age of about 50 ancient steels, including a Damascus knife, and the results are summarized. (author)
41 CFR 102-85.40 - What are the major components of the pricing policy?
2010-07-01
... components of the pricing policy? 102-85.40 Section 102-85.40 Public Contracts and Property Management...-PRICING POLICY FOR OCCUPANCY IN GSA SPACE Pricing Policy-General § 102-85.40 What are the major components of the pricing policy? The major components of the pricing policy are: (a) An OA between a customer...
22 CFR 102.9 - Arranging for entry and travel of investigating and airline representatives.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arranging for entry and travel of investigating and airline representatives. 102.9 Section 102.9 Foreign Relations DEPARTMENT OF STATE ECONOMIC AND OTHER FUNCTIONS CIVIL AVIATION United States Aircraft Accidents Abroad § 102.9 Arranging for entry and travel of investigating and airline...
Designing of the chemical composition of steels basing on the hardenability of constructional steels
International Nuclear Information System (INIS)
Dobrzanski, L.A.; Sitek, W.
2003-01-01
The paper presents the original method of modelling of the relationships between chemical composition of alloy constructional steel and its hardenability, employing neural networks. Basing on the experimental results of the hardenability investigations, which employed Jominy method, the model of the neural networks was developed and fully verified experimentally. The model makes it possible to obtain Jominy hardenability curves basing on the steel chemical composition. The model of neural networks, making it possible to design the steel chemical composition, basing on the known Jominy hardenability curve shape, was developed also and fully verified numerically. (author)
Mechanical properties of irradiated 9Cr-2WVTa steel
International Nuclear Information System (INIS)
Klueh, R.L.; Alexander, D.J.; Rieth, M.
1998-01-01
An Fe-9Cr-2W-0.25V-0.07Ta-0.1C (9Cr-2WVTa) steel has excellent strength and impact toughness before and after irradiation in the Fast Flux Test Facility and the High Flux Reactor (HFR). The ductile-brittle transition temperature (DBTT) increased only 32 C after 28 dpa at 365 C in FFTF, compared to a shift of ∼60 C for a 9Cr-2WV steel--the same as the 9Cr-2WVTa steel but without tantalum. This difference occurred despite the two steels having similar tensile but without tantalum. This difference occurred despite the two steels having similar tensile properties before and after irradiation. The 9Cr-2WVTa steel has a smaller prior-austenite grain size, but otherwise microstructures are similar before irradiation and show similar changes during irradiation. The irradiation behavior of the 9Cr-2WVTa steel differs from the 9Cr-2WV steel and other similar steels in two ways: (1) the shift in DBTT of the 9Cr-2WVTa steel irradiated in FFTF does not saturate with fluence by ∼28 dpa, whereas for the 9Cr-2WV steel and most similar steels, saturation occurs at <10 dpa, and (2) the shift in DBTT for 9Cr-2WVTa steel irradiated in FFTF and HFR increased with irradiation temperature, whereas it decreased for the 9Cr-2WV steel, as it does for most similar steels. The improved properties of the 9Cr-2WVTa steel and the differences with other steels were attributed to tantalum in solution
Energy Technology Data Exchange (ETDEWEB)
Kaneko, T.; Urata, I.; Okata, S. [Kawasaki Steel Corp., Tokyo (Japan)
1996-03-01
In the steel structure technology of Kawasaki Steel, the joint technique (e.g., welding) is added to them while developing or improving the products that meet the social needs as a material supplier. Moreover, the execution technique that manufactures materials or constructs them as an integrated structure, the structural analysis that conforms to the function and application of a structure, and the design technique on dynamic properties or durability such as earthquake resistance, fatigue, and corrosion resistance are synthetically expanded for engineering. In this paper, a building steel frame, non-residence building, bridge, and harbor structure as steel structure in the building and construction fields were described for each structure genre. The structural technology of a building steel frame is summarized to the products of pillar materials. An earthquake brace, using a dead soft steel, with high earthquake energy absorption capability and a damping wall were also developed. The design and execution technique of a large roof was systematized. The exchange technique of a road bridge RC floor and the technique of an unstiffened suspension bridge for pipeline were developed. A new technique was also developed for a suspension monorail track and offshore structure. 30 refs., 5 figs.
41 CFR 102-117.280 - What aspects of the TSP's performance are important to measure?
2010-07-01
...'s performance are important to measure? 102-117.280 Section 102-117.280 Public Contracts and... § 102-117.280 What aspects of the TSP's performance are important to measure? Important TSP performance...) Percentage of customer satisfaction reports on carrier performance. ...
Simple Heat Treatment for Production of Hot-Dip Galvanized Dual Phase Steel Using Si-Al Steels
Equihua-Guillén, F.; García-Lara, A. M.; Muñíz-Valdes, C. R.; Ortíz-Cuellar, J. C.; Camporredondo-Saucedo, J. E.
2014-01-01
This work presents relevant metallurgical considerations to produce galvanized dual phase steels from low cost aluminum-silicon steels which are produced by continuous strip processing. Two steels with different contents of Si and Al were austenized in the two-phase field ferrite + austenite (α + γ) in a fast manner to obtain dual phase steels, suitable for hot-dip galvanizing process, under typical parameters of continuous annealing processing line. Tensile dual phase properties were obtained from specimens cooled from temperature below Ar3, held during 3 min, intermediate cooling at temperature above Ar1 and quenching in Zn bath at 465 °C. The results have shown typical microstructure and tensile properties of galvanized dual phase steels. Finally, the synergistic effect of aluminum, silicon, and residual chromium on martensite start temperature ( M s), critical cooling rate ( C R), volume fraction of martensite, and tensile properties has been studied.
Corrosion behaviour of laser clad stainless steels
International Nuclear Information System (INIS)
Damborenea, J.J. de; Weerasinghe, V.M.; West, D.R.F.
1993-01-01
The present paper is focussed in the study of the properties of a clad layer of stainless steel on a mild steel. By blowing powder of the alloy into a melt pool generated by a laser of 2 KW, an homogeneous layer of 316 stainless steel can be obtained. Structure, composition and corrosion behaviour are similar to those of a stainless steel in as-received condition. (Author)
Ion-nitriding of austenitic stainless steels
International Nuclear Information System (INIS)
Pacheco, O.; Hertz, D.; Lebrun, J.P.; Michel, H.
1995-01-01
Although ion-nitriding is an extensively industrialized process enabling steel surfaces to be hardened by nitrogen diffusion, with a resulting increase in wear, seizure and fatigue resistance, its direct application to stainless steels, while enhancing their mechanical properties, also causes a marked degradation in their oxidation resistance. However, by adaption of the nitriding process, it is possible to maintain the improved wear resistant properties while retaining the oxidation resistance of the stainless steel. The controlled diffusion permits the growth of a nitrogen supersaturated austenite layer on parts made of stainless steel (AISI 304L and 316L) without chromium nitride precipitation. The diffusion layer remains stable during post heat treatments up to 650 F for 5,000 hrs and maintains a hardness of 900 HV. A very low and stable friction coefficient is achieved which provides good wear resistance against stainless steels under diverse conditions. Electrochemical and chemical tests in various media confirm the preservation of the stainless steel characteristics. An example of the application of this process is the treatment of Reactor Control Rod Cluster Assemblies (RCCAs) for Pressurized Water Nuclear Reactors
Tank 241-S-102, Core 232 analytical results for the final report
Energy Technology Data Exchange (ETDEWEB)
STEEN, F.H.
1998-11-04
This document is the analytical laboratory report for tank 241-S-102 push mode core segments collected between March 5, 1998 and April 2, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-S-102 Retained Gas Sampler System Sampling and Analysis Plan (TSAP) (McCain, 1998), Letter of Instruction for Compatibility Analysis of Samples from Tank 241-S-102 (LOI) (Thompson, 1998) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) (Mulkey and Miller, 1998). The analytical results are included in the data summary table (Table 1).
5 CFR 5701.102 - Fundraising activities.
2010-01-01
... 5701.102 Administrative Personnel FEDERAL TRADE COMMISSION SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT...-duty hours, seek a contribution from a company that is regulated by the Commission, but not from one... substantially affected by the employee's job. While the Standards of Conduct provide that companies under the...
High - speed steel for precise cased tools
International Nuclear Information System (INIS)
Karwiarz, J.; Mazur, A.
2001-01-01
The test results of high-vanadium high - speed steel (SWV9) for precise casted tools are presented. The face -milling cutters of NFCa80A type have been tested in industrial operating conditions. An average life - time of SWV9 steel tools was 3-10 times longer compare to the conventional high - speed milling cutters. Metallography of SWB9 precise casted steel revealed beneficial for tool properties distribution of primary vanadium carbides in the steel matrix. Presented results should be a good argument for wide application of high - vanadium high - speed steel for precise casted tools. (author)
41 CFR 102-192.30 - What types of mail does this part apply to?
2010-07-01
... 192-MAIL MANAGEMENT Introduction to this Part § 102-192.30 What types of mail does this part apply to... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What types of mail does this part apply to? 102-192.30 Section 102-192.30 Public Contracts and Property Management Federal...
Thermochemical surface engineering of steels
DEFF Research Database (Denmark)
Thermochemical Surface Engineering of Steels provides a comprehensive scientific overview of the principles and different techniques involved in thermochemical surface engineering, including thermodynamics, kinetics principles, process technologies and techniques for enhanced performance of steels...
The problems of high-nitrogen steels production
International Nuclear Information System (INIS)
Svyazhin, A.G.; Kaputkina, L.M.; Efimenko, S.P.
1999-01-01
Analysis of existing technologies of high-nitrogen steel production shows that rational nitrogen content in mass production corresponds to moderate high values. Such steels can be smelted under normal or slightly elevated pressure in steelmaking units, using processes of mass- and special metallurgy. High-nitrogen steels with ''overequilibrium'' nitrogen content are promising, but technology and equipment for production of them are complicated, and production of such steels is therefore limited. (orig.)
Experience with TL-102M for the treatment of radiation stomatitis
International Nuclear Information System (INIS)
Nishio, Juntaro; Matsuya, Tokuzo; Inoue, Kazuo; Miyazaki, Tadashi; Maeda, Noriaki.
1984-01-01
TL-102M was administered to 14 patients who had radiation stomatitis following radiation therapy for malignant tumors in the oral cavity. Regarding the degree of overall improvement, one of the 14 patients was evaluated as ''extremely improved'', eight as ''improved'', four as ''slightly improved'', and one as ''unchanged''. None of the patients had side effects. Adherent, powdered TL-102M was easy to take for patients. Most of the patients desired to continue to take this drug because of having neither painfulness nor adhesive feeling. The usage of TL-102M could be helpful in promoting the treatment for cancer, thus suggesting that it is useful in treating radiation stomatitis. (Namekawa, K.)
Behaviour of steels in natural environments: focus on stainless steels in natural sea water
International Nuclear Information System (INIS)
Feron, D.
2005-01-01
Corrosion behaviour of steels and alloys in natural environments is not only dependent to material parameters and environmental chemistry, but also to micro-organisms which may be there. The global approach used to investigate the behaviour of alloys in natural environments is illustrated by the work done on stainless steels in seawater. In aerated seawater, studies led to the proposal of an 'enzymatic model' based on the enzymatic catalyze of the cathodic reaction and which allows reproducing the electrochemical behaviour of stainless steels in natural seawater and the crevice corrosion phenomena observed in natural sea waters. Coupling areas under aerobic and anaerobic conditions leads to the worst situation for stainless steel behaviour: the catalysis of the cathodic reaction on aerobic exposed surfaces and the decrease of the corrosion resistance of anaerobic surfaces due to sulphides. These results lead to the concept of electro-active bio-films. (author)
Structure of three Zlatoust bulats (Damascus-steel blades)
Schastlivtsev, V. M.; Gerasimov, V. Yu.; Rodionov, D. P.
2008-08-01
Chemical composition, structure, and hardness of samples of three Zlatoust bulats (Damascus steels), namely, an Anosov bulat blade (1841), Obukhov bulat blade (1859), and a Shvetsov forged bulat-steel blank (crucible steel) have been investigated. The Anosov bulat possesses all signs of the classical Damascus steel; this is a hypereutectoid carbon steel with a structure formed from chains of carbides against the background of fine pearlite (troostite). A banded pattern is revealed on the surface of the blade. The Obukhov blade cannot be referred to classical Damascus steel. The pattern on the surface of the blade is absent, despite the fact that the initial steel is hypereutectoid. The structure of the blade does not correspond to the structure of classical Damascus steel; this is bainite with numerous cementite particles. The Shvetsov sample cannot be regarded as Damascus steel since it is made from a hypereutectoid steel alloyed by managanese and tungsten. The pattern on the surface of the metal is a consequence of the dendritic structure of the ingot which is developed during forging. The structure of this pattern differs from classical damascene pattern, since the latter is formed due to a specific arrangement of a variety of carbide particles against the pearlitic or some other background obtained during heat treatment.
International Nuclear Information System (INIS)
Lafond, G.; Leclerq, G.; Moliexe, F.; Namdar, R.; Roesch, L.; Sanz, G.
1977-01-01
This work was essentially aimed to the study of the following three questions. Is it possible to assess the cold formability of steels using simple material properties as criteria. What values of mechanical properties can one expect to reach in cold formed parts. Are there simple ways of characterizing the speroidization treatments carried out on steels before cold forming operations. The present report describes the results obtained during this investigation. It is logically divided into three separate parts. Experimental study of cold formability in wire drawing. Influence of metallurgical variables on mechanical properties of high carbon cold drawn wires. Contribution to the study of characterization methods of cold forming steels subjected to a spheroidization heat treatment
Electromagnetic properties of low-spin states in 102,104Pd
International Nuclear Information System (INIS)
Luontama, M.; Julin, R.; Kantele, J.; Passoja, A.; Trzaska, W.; Baecklin, A.; Jonsson, N.G.; Westerberg, L.
1985-12-01
Electromagnetic transitions from low-lying 0 + , 2 + , 4 + and 3 - states in 102 , 104 Pd have been studied with (p,2n) and (p,p) reactions and with Coulomb excitation. The E2 transition probabilities from the 0 3 + state in 102 Pd (13 W.u.) and from the 0 2 + state in 104 Pd (14 W.u.) are somewhat low for two-phonon states. Generally, the E2 transition rates are reasonably well reproduced by the IBA-2 and by the boson-expansion description. The intruding 0 2 + state (tsub(1/2) = 14.3 ns) in 102 Pd is connected to the 2 2 + and 2 3 + states via strong E2 transitions: B(E2;0 2 + →2 2 + )=96+-40 W.u.; B(E2;2 3 + →0 2 + )=17+-8 W.u
High yttria ferritic ODS steels through powder forging
Kumar, Deepak; Prakash, Ujjwal; Dabhade, Vikram V.; Laha, K.; Sakthivel, T.
2017-05-01
Oxide dispersion strengthened (ODS) steels are being developed for future nuclear reactors. ODS Fe-18%Cr-2%W-0.2%Ti steels with 0, 0.35, 0.5, 1 and 1.5% Y2O3 (all compositions in weight%) dispersion were fabricated by mechanical alloying of elemental powders. The powders were placed in a mild steel can and forged in a stream of hydrogen gas at 1473 K. The steels were forged again to final density. The strength of ODS steel increased with yttria content. Though this was accompanied by a decrease in tensile elongation, all the steels showed significant ductility. The ductility in high yttria alloys may be attributed to improved inter-particle bonding between milled powders due to reduction of surface oxides by hydrogen. This may permit development of ODS steels with yttria contents higher than the conventional limit of 0.5%. It is suggested that powder forging is a promising route to fabricate ODS steels with high yttria contents and improved ductility.
41 CFR 102-79.110 - What Integrated Workplace policy must Federal agencies strive to promote?
2010-07-01
... capital costs over a substantial time period; and (i) Support alternative workplace arrangements... Workplace policy must Federal agencies strive to promote? 102-79.110 Section 102-79.110 Public Contracts and... Integrated Workplace § 102-79.110 What Integrated Workplace policy must Federal agencies strive to promote...
Behaviour of carbon steel and chromium steels in CO2 environments
International Nuclear Information System (INIS)
Lefebvre, B.; Bounie, P.; Guntz, G.; Prouheze, J.C.; Renault, J.J.
1984-01-01
The behavior in aqueous CO 2 environments of steel with chromium content between 0 and 22% has been studied by autoclave tests. The influence of chromium and molybdenum contents has been investigated particularly on 13 Cr steel. Conventional electrochemical test results are related to the CO 2 autoclave test results. The influence of the environment: temperature, chloride concentration, partial pressure of CO 2 and some amount of H 2 S on the corrosion resistance are discussed
Microstructural Development during Welding of TRIP steels
Amirthalingam, M.
2010-01-01
The Advanced High Strength Steels (AHSS) are promising solutions for the production of lighter automobiles which reduce fuel consumption and increase passenger safety by improving crash-worthiness. Transformation Induced Plasticity Steel (TRIP) are part of the advanced high strength steels which
Tribological Response of Heat Treated AISI 52100 Steels Against Steel and Ceramic Counterparts
Directory of Open Access Journals (Sweden)
Türedi E.
2017-09-01
Full Text Available AISI 52100 bearing steels are commonly used in applications requiring high hardness and abrasion resistance. The bearing steels are working under dynamic loads in service conditions and their toughness properties become important. In order to provide the desired mechanical properties, various heat treatments (austenizing, quenching and tempering are usually applied. In this study, AISI 52100 bearing steel samples were austenized at 900°C for ½ h and water quenched to room temperature. Then tempering was carried out at 795°C, 400°C and 200°C for ½ h. In order to investigate the effect of heat treatment conditions on wear behavior, dry friction tests were performed according to ASTM G99-05 Standard with a ‘ball-on-disk’ type tribometer. The samples were tested against steel and ceramic counterparts using the parameters of 100 m distance and 30 N load and 0.063 m/s rotational speed. After wear test, the surface characterization was carried out using microscopy. Wear loss values were calculated using a novel optical method on both flat and counterpart specimens.
Precaution against radioactive contamination of steel products in Germany
International Nuclear Information System (INIS)
Ewers, E.; Schulz-Klemp, V.; Steffen, R.
1999-01-01
Regulations for handling of radioactive materials in Germany. Engagement of the Germany Iron and Steel Institute (VDEh) since the end of the eighties and measures taken. Level of radioactivity in uncontaminated steel products. Agreements between steel industry and scrap supplying industry as well as terms of delivery. Actual status of equipment for detection of radioactivity in the German steel plants. Demands of steel users for clean steel. (author)
41 CFR 102-118.30 - Are Government corporations bound by this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Are Government corporations bound by this part? 102-118.30 Section 102-118.30 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118...
41 CFR 102-118.5 - What is the purpose of this part?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is the purpose of this part? 102-118.5 Section 102-118.5 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION TRANSPORTATION 118-TRANSPORTATION...
24 CFR 597.102 - Tests of pervasive poverty, unemployment and general distress.
2010-04-01
..., unemployment and general distress. 597.102 Section 597.102 Housing and Urban Development Regulations Relating..., unemployment and general distress. (a) Pervasive poverty. Pervasive poverty shall be demonstrated by the... component areas of an affluent character. (b) Unemployment. Unemployment shall be demonstrated by: (1) Data...
41 CFR 102-41.210 - What are some examples of drug paraphernalia?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What are some examples of drug paraphernalia? 102-41.210 Section 102-41.210 Public Contracts and Property Management Federal Property Management Regulations System (Continued) FEDERAL MANAGEMENT REGULATION PERSONAL PROPERTY 41...
41 CFR 102-34.85 - What motor vehicles require motor vehicle identification?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What motor vehicles require motor vehicle identification? 102-34.85 Section 102-34.85 Public Contracts and Property Management... 34-MOTOR VEHICLE MANAGEMENT Identifying and Registering Motor Vehicles Motor Vehicle Identification...
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
With an objective to save energy and reduce greenhouse gas emission, a project has been discussed to introduce a gas turbine combined cycle power generation system for effective waste heat utilization and a pellet coating facility into the direct reduction steel making plant of Ahwaz Steel Complex in the Islamic Republic of Iran. The project will have a waste heat boiler installed at the outlet of the MIDREX plant waste heat recovery device to link it with a gas turbine combined cycle power plant to structure a 42-MW power generation system. In addition, productivity enhancement was attempted by applying the raw material pellets with coating to raise the reduction gas blow-in temperature. The energy saving effect expected from this project would be saving of 63,140 tons of crude oil equivalent annually, and the greenhouse effect gas reducing effect would reduce 173,790 t-CO2 annually. Although the investment will require about 3.16 billion yen, the cost reduction amount in association with power generation is small because of the power purchase unit cost being as very low as 1.9 yen/kWh, making the investment recovery period 10.2 years. Therefore, the project will not be realizable economically. (NEDO)
Anodized Steel Electrodes for Supercapacitors.
Sagu, Jagdeep S; Wijayantha, K G Upul; Bohm, Mallika; Bohm, Siva; Kumar Rout, Tapan
2016-03-09
Steel was anodized in 10 M NaOH to enhance its surface texture and internal surface area for application as an electrode in supercapacitors. A mechanism was proposed for the anodization process. Field-emission gun scanning electron microscopy (FEGSEM) studies of anodized steel revealed that it contains a highly porous sponge like structure ideal for supercapacitor electrodes. X-ray photoelectron spectroscopy (XPS) measurements showed that the surface of the anodized steel was Fe2O3, whereas X-ray diffraction (XRD) measurements indicated that the bulk remained as metallic Fe. The supercapacitor performance of the anodized steel was tested in 1 M NaOH and a capacitance of 18 mF cm(-2) was obtained. Cyclic voltammetry measurements showed that there was a large psueudocapacitive contribution which was due to oxidation of Fe to Fe(OH)2 and then further oxidation to FeOOH, and the respective reduction of these species back to metallic Fe. These redox processes were found to be remarkably reversible as the electrode showed no loss in capacitance after 10000 cycles. The results demonstrate that anodization of steel is a suitable method to produce high-surface-area electrodes for supercapacitors with excellent cycling lifetime.
Corrosion of steel in concrete
International Nuclear Information System (INIS)
Preece, C.M.
1982-10-01
A comparative study has been made of those properties of Massiv and Standard cements which are considered to determine their ability to protect steel reinforcement from corroding. Saturated Massiv cement has a higher evaporabel water content, but a significantly finer pore structure than has saturated Standard cement. This fine structure resulted in an electrical resistivity ten times higher and chloride diffusivity ten times lower than those of Standard cement. Electrochemical measurements have shown that the passive current density of steel in Massiv mortar is higher than that of steel in Standard mortar, but the higher current should lead to a more rapid decrease in potential to a level at which neither chloride attack of hydrogen evolution will occur. Whereas steel in Standard mortar was found to be highly susceptible to crevice corrosion, no such attack has been observed in Massiv mortar. Moreover, the initiation of chloride induced corrosion and the subsequent rates of corrosion were both lower in Massiv mortar than in Standard mortar. Thus, it may be predicted that Massiv cement would provide greater protection for steel reinforcement in underground structures exposed to chloride containing ground water than would Standard cement. (author)
46 CFR 56.60-5 - Steel (High temperature applications).
2010-10-01
....A.) Upon prolonged exposure to temperatures above 775 °F (412 °C), the carbide phase of plain carbon steel, plain nickel-alloy steel, carbon-manganese-alloy steel, manganese-vanadium-alloy steel, and carbon-silicon steel may convert to graphite. (b) (Reproduces 124.2.B.) Upon prolonged exposure to...
Austenitic stainless steels with cryogenic resistance
International Nuclear Information System (INIS)
Tarata, Daniela Florentina
1999-01-01
The most used austenitic stainless steels are alloyed with chromium and nickel and have a reduced carbon content, usually lower than 0.1 % what ensures corresponding properties for processing by plastic deformation at welding, corrosion resistance in aggressive environment and toughness at low temperatures. Steels of this kind alloyed with manganese are also used to reduce the nickel content. By alloying with manganese which is a gammageneous element one ensures the stability of austenites. Being cheaper these steels may be used extensively for components and equipment used in cryogenics field. The best results were obtained with steels of second group, AMnNi, in which the designed chemical composition was achieved, i.e. the partial replacement of nickel by manganese ensured the toughness at cryogenic temperatures. If these steels are supplementary alloyed, their strength properties may increase to the detriment of plasticity and toughness, although the cryogenic character is preserved
42 CFR 102.31 - Medical benefits.
2010-10-01
... Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION... covered injury, or to give relief, reduce the degree or the period of disability, or aid in lessening the... provided in § 102.84, the Secretary retains the right to recover medical benefits paid to requesters by...
41 CFR 102-192.155 - What should our agency-wide mail management policy statement cover?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What should our agency-wide mail management policy statement cover? 102-192.155 Section 102-192.155 Public Contracts and... REGULATION ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Other Agency Responsibilities § 102-192.155 What...
13 CFR 127.102 - What are the definitions of the terms used in this part?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What are the definitions of the terms used in this part? 127.102 Section 127.102 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION WOMEN-OWNED SMALL BUSINESS FEDERAL CONTRACT ASSISTANCE PROCEDURES General Provisions § 127.102...
Micropurity in stainless steel making
International Nuclear Information System (INIS)
Motloch, Z.
1981-01-01
New technologies were developed by the Vitkovice research institutes in response to high requirements for the quality of high-alloy steels for nuclear power, viz., duplex technology with double vacuum degassing at the DH unit and oxidation vacuum degassing using the VAKUVIT equipment. The steel produced shows low contents of impurities and high micropurity. A study was conducted into changes in carbon content and the formation of titanium nitrides and carbonitrides in austenitic steels during their production, and optimum technological parameters were found for eliminating their formation in forgings. (author)
Water requirements of the iron and steel industry
Walling, Faulkner B.; Otts, Louis Ethelbert
1967-01-01
Twenty-nine steel plants surveyed during 1957 and 1958 withdrew from various sources about 1,400 billion gallons of water annually and produced 40.8 million tons of ingot steel. This is equivalent to about 34,000 gallons of water per ton of steel. Fifteen iron ore mines and fifteen ore concentration plants together withdrew annually about 89,000 million gallons to produce 15 million tons of iron ore concentrate, or 5,900 gallons per ton of concentrate. About 97 percent of the water used in the steel plants came from surface sources, 2.2 percent was reclaimed sewage, and 1.2 percent was ground water. Steel plants supplied about 96 percent of their own water requirements, although only three plants used self-supplied water exclusively. Water used by the iron ore mines and concentration plants was also predominantly self supplied from surface source. Water use in the iron and steel industry varied widely and depended on the availability of water, age and condition of plants and equipment, kinds of processes, and plant operating procedures. Gross water use in integrated steel plants ranged from 11,200 to 110,000 gallons per ton of steel ingots, and in steel processing plants it ranged from 4,180 to 26,700 gallons per ton. Water reuse also varied widely from 0 to 18 times in integrated steel plants and from 0 to 44 times in steel processing plants. Availability of water seemed to be the principal factor in determining the rate of reuse. Of the units within steel plants, a typical (median) blast furnace required 20,500 gallons of water per ton of pig iron. At the 1956-60 average rate of pig iron consumption, this amounts to about 13,000 gallons per ton of steel ingots or about 40 percent of that required by a typical integrated steel plant 33,200 gallons per ton. Different processes of iron ore concentration are devised specifically for the various kinds of ore. These processes result in a wide range of water use from 124 to 11,300 gallons of water per ton of iron ore
Spark Plasma Co-Sintering of Mechanically Milled Tool Steel and High Speed Steel Powders.
Pellizzari, Massimo; Fedrizzi, Anna; Zadra, Mario
2016-06-16
Hot work tool steel (AISI H13) and high speed steel (AISI M3:2) powders were successfully co-sintered to produce hybrid tool steels that have properties and microstructures that can be modulated for specific applications. To promote co-sintering, which is made difficult by the various densification kinetics of the two steels, the particle sizes and structures were refined by mechanical milling (MM). Near full density samples (>99.5%) showing very fine and homogeneous microstructure were obtained using spark plasma sintering (SPS). The density of the blends (20, 40, 60, 80 wt % H13) was in agreement with the linear rule of mixtures. Their hardness showed a positive deviation, which could be ascribed to the strengthening effect of the secondary particles altering the stress distribution during indentation. A toughening of the M3:2-rich blends could be explained in view of the crack deviation and crack arrest exerted by the H13 particles.
Spark Plasma Co-Sintering of Mechanically Milled Tool Steel and High Speed Steel Powders
Directory of Open Access Journals (Sweden)
Massimo Pellizzari
2016-06-01
Full Text Available Hot work tool steel (AISI H13 and high speed steel (AISI M3:2 powders were successfully co-sintered to produce hybrid tool steels that have properties and microstructures that can be modulated for specific applications. To promote co-sintering, which is made difficult by the various densification kinetics of the two steels, the particle sizes and structures were refined by mechanical milling (MM. Near full density samples (>99.5% showing very fine and homogeneous microstructure were obtained using spark plasma sintering (SPS. The density of the blends (20, 40, 60, 80 wt % H13 was in agreement with the linear rule of mixtures. Their hardness showed a positive deviation, which could be ascribed to the strengthening effect of the secondary particles altering the stress distribution during indentation. A toughening of the M3:2-rich blends could be explained in view of the crack deviation and crack arrest exerted by the H13 particles.
Metallurgy of steels for PWR pressure vessels
International Nuclear Information System (INIS)
Kepka, M.; Mocek, J.; Barackova, L.
1980-01-01
A survey and the chemical compositions are presented of reactor pressure vessel steels. The metallurgy is described of steel making for pressure vessels in Japan and the USSR. Both acidic and alkaline open-hearth steel is used for the manufacture of ingots. The leading world manufacturers of forging ingots for pressure vessels, however, exclusively use electric steel. Vacuum casting techniques are exclusively used. Experience is shown gained with the introduction of the manufacture of forging ingots for pressure vessels at SKODA, Plzen. The metallurgical procedure was tested utilizing alkaline open hearths, electric arc furnaces and facilities for vacuum casting of steel. Pure charge raw materials should be used for securing high steel purity. Prior to forging pressure vessel rings, not only should sufficiently big bottoms and heads be removed but also the ingot middle part should be scrapped showing higher contents of impurities and nonhomogeneous structure. (B.S.)
Metallurgy of steels for PWR pressure vessels
Energy Technology Data Exchange (ETDEWEB)
Kepka, M; Mocek, J; Barackova, L [Skoda, Plzen (Czechoslovakia)
1980-09-01
A survey and the chemical compositions are presented of reactor pressure vessel steels. The metallurgy is described of steel making for pressure vessels in Japan and the USSR. Both acidic and alkaline open-hearth steel is used for the manufacture of ingots. The leading world manufacturers of forging ingots for pressure vessels, however, exclusively use electric steel. Vacuum casting techniques are exclusively used. Experience is shown gained with the introduction of the manufacture of forging ingots for pressure vessels at SKODA, Plzen. The metallurgical procedure was tested utilizing alkaline open hearths, electric arc furnaces and facilities for vacuum casting of steel. Pure charge raw materials should be used for securing high steel purity. Prior to forging pressure vessel rings, not only should sufficiently big bottoms and heads be removed but also the ingot middle part should be scrapped showing higher contents of impurities and nonhomogeneous structure.
Metadynamic recrystallization in C steels
Indian Academy of Sciences (India)
Unknown
EN24 and EN2 steels, a drop from 4000 s to 6 s for similar temperature rise was observed. Metadynamic ... carbon–manganese or silicon–manganese steels, but stops after a reduction at ... growth by strain-induced grain boundary migration;.
Indian Academy of Sciences (India)
manufacture of steel in south India by a crucible process at ... indicates that the production of wootz steel was almost on an industrial scale in ... in an Age of Design marked by ... The Russian Anasoff also studied the process of manufacturing.
41 CFR 102-80.135 - Who is a qualified fire protection engineer?
2010-07-01
... protection engineer? 102-80.135 Section 102-80.135 Public Contracts and Property Management Federal Property... qualified fire protection engineer? A qualified fire protection engineer is defined as an individual with a thorough knowledge and understanding of the principles of physics and chemistry governing fire growth...
42 CFR 482.102 - Condition of participation: Patient and living donor rights.
2010-10-01
... health, disability, or life insurance may be affected; (8) The donor's right to opt out of donation at... donor rights. 482.102 Section 482.102 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) STANDARDS AND CERTIFICATION CONDITIONS OF PARTICIPATION FOR...
41 CFR 101-29.102 - Use of metric system of measurement in Federal product descriptions.
2010-07-01
... PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.1-General § 101-29.102 Use of metric system of measurement in... measurement in Federal product descriptions. 101-29.102 Section 101-29.102 Public Contracts and Property... Federal agencies to: (a) Maintain close liaison with other Federal agencies, State and local governments...
Optimum conditions for aging of stainless maraging steels
International Nuclear Information System (INIS)
Mironenko, P.A.; Krasnikova, S.I.; Drobot, A.V.
1980-01-01
Aging kinetics of two 0Kh11N10M2T type steels in which 3 % Mo (steel 1), and 3 % Mo and 11 % Co (steel 2) had been additionally introduced instead of titanium were investigated. Electron microscopy and X-ray methods were used. It was ascertained that the process of steel aging proceeded in 3 stages. Steel 2 was hardened more intensively during the aging, had a higher degree of hardness and strength after the aging, weakened more slowly if overaged than steel 1. The intermetallide hcp-phase Fe 2 Mo was the hardening phase on steels extended aging. Optimum combination of impact strength and strength was was achieved using two-stage aging: the first stage - maximum strength aging was achieved, the second stage - aging at minimum temperatures of two-phase α+γ region
Shon, Sudeok; Yoo, Mina; Lee, Seungjae
2017-03-06
The steel frame reinforced with steel shear wall is a lateral load resisting system and has higher strength and shear performance than the concrete shear wall system. Especially, using corrugated steel plates in these shear wall systems improves out-of-plane stiffness and flexibility in the deformation along the corrugation. In this paper, a cyclic loading test of this steel frame reinforced with trapezoidal-corrugated steel plate was performed to evaluate the structural performance. The hysteresis behavior and the energy dissipation capacity of the steel frame were also compared according to the corrugated direction of the plate. For the test, one simple frame model without the wall and two frame models reinforced with the plate are considered and designed. The test results showed that the model reinforced with the corrugated steel plate had a greater accumulated energy dissipation capacity than the experimental result of the non-reinforced model. Furthermore, the energy dissipation curves of two reinforced frame models, which have different corrugated directions, produced similar results.
Radiation induced microstructural evolution in ferritic/martensitic steels
International Nuclear Information System (INIS)
Kohno, Y.; Kohyama, A.; Asakura, K.; Gelles, D.S.
1993-01-01
R and D of ferritic/martensitic steels as structural materials for fusion reactor is one of the most important issues of fusion technology. The efforts to characterize microstructural evolution under irradiation in the conventional Fe-Cr-Mo steels as well as newly developed Fe-Cr-Mn or Fe-Cr-W low activation ferritic/ martensitic steels have been continued. This paper provides some of the recent results of heavy irradiation effects on the microstructural evolution of ferritic/martensitic steels neutron irradiated in the FFTF/MOTA (Fast Flux Test Facility/Materials Open Test Assembly). Materials examined are Fe-10Cr-2Mo dual phase steel (JFMS: Japanese Ferritic/Martensitic Steel), Fe-12Cr-XMn-1Mo manganese stabilized martensitic steels and Fe-8Cr-2W Tungsten stabilized low activation martensitic steel (F82H). JFMS showed excellent void swelling resistance similar to 12Cr martensitic steel such as HT-9, while the manganese stabilized steels and F82H showed less void swelling resistance with small amount of void swelling at 640-700 K (F82H: 0.14% at 678 K). As for irradiation response of precipitate behavior, significant formation of intermetallic χ phase was observed in the manganese stabilized steels along grain boundaries which is though to cause mechanical property degradation. On the other hand, precipitates identified were the same type as those in unirradiated condition in F82H with no recognition of irradiation induced precipitates, which suggested satisfactory mechanical properties of F82H after the irradiation. (author)
Corrosion fatigue crack growth in clad low-alloy steels: Part 1, medium-sulfur forging steel
International Nuclear Information System (INIS)
James, L.A.; Poskie, T.J.; Auten, T.A.; Cullen, W.H.
1996-01-01
Corrosion fatigue crack propagation tests were conducted on a medium- sulfur ASTM A508-2 forging steel overlaid with weld-deposited Alloy EN82H cladding. The specimens featured semi-elliptical surface cracks penetrating approximately 6.3 mm of cladding into the underlying steel. The initial crack sizes were relatively large with surface lengths of 30.3--38.3 mm, and depths of 13.1--16.8 mm. The experiments were conducted in a quasi-stagnant low-oxygen (O 2 < 10 ppb) aqueous environment at 243 degrees C, under loading conditions (ΔK, R, and cyclic frequency) conductive to environmentally-assisted cracking (EAC) in higher-sulfur steels under quasi-stagnant conditions. Earlier experiments on unclad compact tension specimens of this heat of steel did not exhibit EAC, and the present experiments on semi-elliptical surface cracks penetrating cladding also did not exhibit EAC
A model for TRIP steel constitutive behaviour
Perdahcioglu, Emin Semih; Geijselaers, Hubertus J.M.; Menari, G
2011-01-01
A constitutive model is developed for TRIP steel. This is a steel which contains three or four different phases in its microstructure. One of the phases in TRIP steels is metastable austenite (Retained Austenite) which transforms to martensite upon deformation. The accompanying transformation strain
International Nuclear Information System (INIS)
Nasser, A.
2010-01-01
This thesis aims to study the durability of nuclear waste deep storage structures. The work carried out is essentially an experimental study, and focuses on the corrosion of steel in the passive state with aerated or non-aerated conditions on the one hand, and the corrosion of steel in carbonated concrete during the propagation phase on the other hand. Indeed, the pore solution of concrete in contact with the metal is alkaline (pH between 12 and 13). Under these conditions, steel reinforced concrete remains passive by forming a stable and protective oxide layer (corrosion of steel in the passive state). This passive layer limits the steel corrosion rate at very low values (negligible on a short life time) but not null. For the nuclear waste storage structures due to a very long life time (up to several hundred years), this low corrosion rate can become a risk. Therefore, it is necessary to study the evolution of the oxide layer growth over time. The objectives of the thesis are to study the influence of the steel-concrete interface quality on reinforcement corrosion in passive and active state, and the possible occurrence of galvanic corrosion currents between different reinforcement steel areas. (author)
Tensile-property characterization of thermally aged cast stainless steels
International Nuclear Information System (INIS)
Michaud, W.F.; Toben, P.T.; Soppet, W.K.; Chopra, O.K.
1994-02-01
The effect of thermal aging on tensile properties of cast stainless steels during service in light water reactors has been evaluated. Tensile data for several experimental and commercial heats of cast stainless steels are presented. Thermal aging increases the tensile strength of these steels. The high-C Mo-bearing CF-8M steels are more susceptible to thermal aging than the Mo-free CF-3 or CF-8 steels. A procedure and correlations are presented for predicting the change in tensile flow and yield stresses and engineering stress-vs.-strain curve of cast stainless steel as a function of time and temperature of service. The tensile properties of aged cast stainless steel are estimated from known material information, i.e., chemical composition and the initial tensile strength of the steel. The correlations described in this report may be used for assessing thermal embrittlement of cast stainless steel components
Transmission Properties of Human PrP 102L Prions Challenge the Relevance of Mouse Models of GSS.
Asante, Emmanuel A; Grimshaw, Andrew; Smidak, Michelle; Jakubcova, Tatiana; Tomlinson, Andrew; Jeelani, Asif; Hamdan, Shyma; Powell, Caroline; Joiner, Susan; Linehan, Jacqueline M; Brandner, Sebastian; Wadsworth, Jonathan D F; Collinge, John
2015-07-01
Inherited prion disease (IPD) is caused by autosomal-dominant pathogenic mutations in the human prion protein (PrP) gene (PRNP). A proline to leucine substitution at PrP residue 102 (P102L) is classically associated with Gerstmann-Sträussler-Scheinker (GSS) disease but shows marked clinical and neuropathological variability within kindreds that may be caused by variable propagation of distinct prion strains generated from either PrP 102L or wild type PrP. To-date the transmission properties of prions propagated in P102L patients remain ill-defined. Multiple mouse models of GSS have focused on mutating the corresponding residue of murine PrP (P101L), however murine PrP 101L, a novel PrP primary structure, may not have the repertoire of pathogenic prion conformations necessary to accurately model the human disease. Here we describe the transmission properties of prions generated in human PrP 102L expressing transgenic mice that were generated after primary challenge with ex vivo human GSS P102L or classical CJD prions. We show that distinct strains of prions were generated in these mice dependent upon source of the inoculum (either GSS P102L or CJD brain) and have designated these GSS-102L and CJD-102L prions, respectively. GSS-102L prions have transmission properties distinct from all prion strains seen in sporadic and acquired human prion disease. Significantly, GSS-102L prions appear incapable of transmitting disease to conventional mice expressing wild type mouse PrP, which contrasts strikingly with the reported transmission properties of prions generated in GSS P102L-challenged mice expressing mouse PrP 101L. We conclude that future transgenic modeling of IPDs should focus exclusively on expression of mutant human PrP, as other approaches may generate novel experimental prion strains that are unrelated to human disease.
7 CFR 1435.102 - Eligibility requirements.
2010-01-01
... to be eligible to be pledged as loan collateral: (1) Refined beet sugar to be pledged as loan... yield raw cane sugar or refined beet sugar, as determined by CCC. (e) The loan collateral must be stored... OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS SUGAR PROGRAM Sugar Loan Program § 1435.102...
Chemical analysis of steel by optical emission spectrometry
International Nuclear Information System (INIS)
Hayakawa, M.O.; Kajita, T.; Jeszensky, G.
1981-01-01
The development of the chemical analysis for special steels by optical emission spectrometry direct reading method with computer, at the Siderurgica N.S. Aparecida S.A. is presented. Results are presented for the low alloy steels and high speed steel. Also, the contribution of this method to the special steel preparation is commented. (Author) [pt
Steamside Oxidation Behavior of Experimental 9%Cr Steels
Energy Technology Data Exchange (ETDEWEB)
Dogan, O.N.; Holcomb, G.R.; Alman, D.E.; Jablonski, P.D.
2007-10-01
Reducing emissions and increasing economic competitiveness require more efficient steam power plants that utilize fossil fuels. One of the major challenges in designing these plants is the availability of materials that can stand the supercritical and ultra-supercritical steam conditions at a competitive cost. There are several programs around the world developing new ferritic and austenitic steels for superheater and reheater tubes exposed to the advanced steam conditions. The new steels must possess properties better than current steels in terms of creep strength, steamside oxidation resistance, fireside corrosion resistance, and thermal fatigue resistance. This paper introduces a series of experimental 9%Cr steels containing Cu, Co, and Ti. Stability of the phases in the new steels is discussed and compared to the phases in the commercially available materials. The steels were tested under both the dry and moist conditions at 650ºC for their cyclical oxidation resistance. Results of oxidation tests are presented. Under the moist conditions, the experimental steels exhibited significantly less mass gain compared to the commercial P91 steel. Microstructural characterization of the scale revealed different oxide compositions.
International Nuclear Information System (INIS)
Teng, Chih-Chuan; Kuo, Hsing-Chun; Sze, Chun-I
2013-01-01
CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential displays. • CIL
Energy Technology Data Exchange (ETDEWEB)
Teng, Chih-Chuan [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Institute of Basic Medicine Science, National Cheng Kung University, Tainan, Taiwan (China); Kuo, Hsing-Chun [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Taiwan (China); Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Department of Medical Research China Medical University Hospital, Taichung, Taiwan (China); Sze, Chun-I, E-mail: szec@mail.ncku.edu.tw [Institute of Basic Medicine Science, Department of Cell Biology and Anatomy and Pathology, National Cheng Kung University, Tainan, Taiwan (China)
2013-11-01
CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone), the major active agent of the alkaloid derivative, has been demonstrated to exert anticancer effects. Herein, we present an investigation focused on the identification of the target(s) of CIL-102's action and the mechanism of its action in apoptotic and anti-invasive pathways. Proteomic approaches were used to purify and identify the protein substrates using 2D difference gel electrophoresis (2D SDS-PAGE) to assess changes in the expression of relevant protein treatment with CIL-102 that resulted in the inhibition of viability and invasion. Our results demonstrate that CIL-102 treatment of U87 cells decreased cell proliferation and invasiveness. CIL-102 dose-dependent induction of apoptosis and inhibitory invasiveness were accompanied by sustained phosphorylation of JNK1/2 and p70S6K as well as generation of the reactive oxygen species. In addition, differential proteins displayed between CIL-102-treated and untreated U87 were determined and validated. There were 11 differentially expressed proteins between the CIL-102-treated and untreated groups. Furthermore, we demonstrated that CIL-102 inhibited cancer cell proliferation and reduced anti-invasion properties by up-regulating the levels of FUMH (Fumarate hydratase). The investigation demonstrated that there was an increase in the cellular levels of FUMH in the CIL-102 reduction in viability and invasion via the activation of JNK1/2 and mTOR signaling modules. NAC administration and shRNA FUMH conferred resistance to CIL-102-inhibited HIF1α and MMP-2 levels via inhibition of JNK1/2 and mTOR activation. We concluded that CIL-102-induced an apoptosis cascade and decreased aggressiveness in astrocytoma cells by modulation of mitochondria function, providing a new mechanism for CIL-102 treatment. - Highlights: • We found the effect of CIL-102 on neuroblastoma cells. • Fumarate hydratase as a CIL-102's target by proteomic differential
41 CFR 102-33.125 - If we use Federal aircraft, what are our management responsibilities?
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false If we use Federal aircraft, what are our management responsibilities? 102-33.125 Section 102-33.125 Public Contracts and... Parts Overview § 102-33.125 If we use Federal aircraft, what are our management responsibilities? If you...
41 CFR 102-38.105 - Under what conditions may we negotiate sales of personal property?
2010-07-01
... property when— (a) The personal property has an estimated fair market value that does not exceed $15,000... may we negotiate sales of personal property? 102-38.105 Section 102-38.105 Public Contracts and... REGULATION PERSONAL PROPERTY 38-SALE OF PERSONAL PROPERTY Sales Process Negotiated Sales § 102-38.105 Under...
41 CFR 102-192.130 - What are your general responsibilities as an agency mail manager?
2010-07-01
... responsibilities as an agency mail manager? 102-192.130 Section 102-192.130 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Agency Mail Manager Requirements § 102-192.130 What are your general responsibilities as an agency mail manager? In addition to carrying out the responsibilities in Subparts B, C, D...
41 CFR 102-192.135 - Must we have a mail center manager at our facility?
2010-07-01
... center manager at our facility? 102-192.135 Section 102-192.135 Public Contracts and Property Management... PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.135 Must we have a mail center manager at our facility? Yes, every facility that has more than two full time people dedicated to...
Plasticity of low carbon stainless steels
International Nuclear Information System (INIS)
Bulat, S.I.; Fel'dgandler, Eh.G.; Kareva, E.N.
1975-01-01
In the temperature range 800-1200 0 C and with strain rates of from 10 -3 to 3 s -1 , austenitic (000Kh18N12) and austenitic-ferrite (000Kh26N6) very low carbon stainless steels containing 0.02-0.03% C exhibit no higher resilience than corresponding ordinary steels containing 0.10-0.12% C. However, the plasticity of such steels (particularly two-phase steels) at 900-1100 0 C is appreciably inferior owing to the development of intergranular brittle fracture. Pressure treatment preceded by partial cooling of the surface to 850 0 C yields rolled and forged products with acceptable indices but is inconvenient technically. At the Zlatoustovsk and Ashin metallurgical plants successful tests have been performed involving the forging and rolling of such steels heated to 1280-1300 0 C without partial cooling; it was necessary to improve the killing conditions, correct the chemical composition (increasing the proportion of ferrite) and take measures against heat loss. (author)
International Nuclear Information System (INIS)
Li, Xiaodong; Chang, Ying; Wang, Cunyu; Hu, Ping; Dong, Han
2017-01-01
The application of high strength steels (HSS) for automotive structural parts is an effective way to realize lightweight and enhance safety. Therefore, improvements in mechanical properties of HSS are needed. In the present study, the warm stamping process of the third generation automotive medium-Mn steel was discussed, the characteristics of martensitic transformation were investigated, as well as the microstructure and mechanical properties were analyzed, compared to the popular hot-stamped 22MnB5 steel in the automotive industry. The results are indicated as follows. Firstly, the quenching rate of the medium-Mn steel can be selected in a wide range based on its CCT curves, which is beneficial to the control of forming process. Secondly, the influence of stamping temperature and pressure on the M s temperature of the medium-Mn steel is not obvious and can be neglected, which is favorable to the even distribution of martensitic microstructure and mechanical properties. Thirdly, the phenomenon of decarbonization is hardly found on the surface of the warm-stamped medium-Mn steel, and the ultra-fine-grained microstructure is found inside the medium-Mn steel after warm stamping. Besides, the warm-stamped medium-Mn steel holds the better comprehensive properties, such as a lower yield ratio, higher total elongation and higher tear toughness than the hot-stamped 22MnB5 steel. Furthermore, an actual warm-stamped B-pillar of medium-Mn steel is stamped and ultra-fine-grained martensitic microstructure is obtained. The mechanical properties are evenly distributed. As a result, this paper proves that the warm-stamped medium-Mn steel part can meet the requirements of lightweight and crash safety, and is promising for the industrial production of automotive structural parts.
Energy Technology Data Exchange (ETDEWEB)
Li, Xiaodong [School of Automotive Engineering, State Key Lab of Structural Analysis for Industrial Equipment, Dalian University of Technology, Dalian 116024 (China); Chang, Ying, E-mail: yingc@dlut.edu.cn [School of Automotive Engineering, State Key Lab of Structural Analysis for Industrial Equipment, Dalian University of Technology, Dalian 116024 (China); Wang, Cunyu [East China Branch of Central Iron & Steel Research Institute (CISRI), Beijing 100081 (China); Hu, Ping [School of Automotive Engineering, State Key Lab of Structural Analysis for Industrial Equipment, Dalian University of Technology, Dalian 116024 (China); Dong, Han [East China Branch of Central Iron & Steel Research Institute (CISRI), Beijing 100081 (China)
2017-01-02
The application of high strength steels (HSS) for automotive structural parts is an effective way to realize lightweight and enhance safety. Therefore, improvements in mechanical properties of HSS are needed. In the present study, the warm stamping process of the third generation automotive medium-Mn steel was discussed, the characteristics of martensitic transformation were investigated, as well as the microstructure and mechanical properties were analyzed, compared to the popular hot-stamped 22MnB5 steel in the automotive industry. The results are indicated as follows. Firstly, the quenching rate of the medium-Mn steel can be selected in a wide range based on its CCT curves, which is beneficial to the control of forming process. Secondly, the influence of stamping temperature and pressure on the M{sub s} temperature of the medium-Mn steel is not obvious and can be neglected, which is favorable to the even distribution of martensitic microstructure and mechanical properties. Thirdly, the phenomenon of decarbonization is hardly found on the surface of the warm-stamped medium-Mn steel, and the ultra-fine-grained microstructure is found inside the medium-Mn steel after warm stamping. Besides, the warm-stamped medium-Mn steel holds the better comprehensive properties, such as a lower yield ratio, higher total elongation and higher tear toughness than the hot-stamped 22MnB5 steel. Furthermore, an actual warm-stamped B-pillar of medium-Mn steel is stamped and ultra-fine-grained martensitic microstructure is obtained. The mechanical properties are evenly distributed. As a result, this paper proves that the warm-stamped medium-Mn steel part can meet the requirements of lightweight and crash safety, and is promising for the industrial production of automotive structural parts.
41 CFR 102-85.20 - What does an Occupancy Agreement (OA) do?
2010-07-01
... defines GSA's relationship with each customer agency and: (a) Establishes specific financial terms... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What does an Occupancy Agreement (OA) do? 102-85.20 Section 102-85.20 Public Contracts and Property Management Federal Property...
International Nuclear Information System (INIS)
Torralba, José M.; Navarro, Alfonso; Campos, Mónica
2013-01-01
A new method of developing lean powder metallurgy steel is proposed. The microstructure of the steel is tailored by combining two different prealloyed steel grades. These materials open a new niche in steel grades for high-performance applications by using a low-cost method of production. Moreover, an alternative route to developing microstructures suitable for manufacturing TRIP and/or Q and P steels is proposed avoiding some of the complex steps that must otherwise be taken to obtain the proper starting microstructure
Energy Technology Data Exchange (ETDEWEB)
Torralba, José M., E-mail: josemanuel.torralba@imdea.org [IMDEA Materials Institute, C/Eric Kandel 2, 28906 - Getafe, Madrid (Spain); Department of Materials Science and Engineering, Universidad Carlos III Av. Universidad, 30, Leganés (Spain); Navarro, Alfonso; Campos, Mónica [Department of Materials Science and Engineering, Universidad Carlos III Av. Universidad, 30, Leganés (Spain)
2013-06-20
A new method of developing lean powder metallurgy steel is proposed. The microstructure of the steel is tailored by combining two different prealloyed steel grades. These materials open a new niche in steel grades for high-performance applications by using a low-cost method of production. Moreover, an alternative route to developing microstructures suitable for manufacturing TRIP and/or Q and P steels is proposed avoiding some of the complex steps that must otherwise be taken to obtain the proper starting microstructure.
Energy Technology Data Exchange (ETDEWEB)
Murase, K. [Kobe Steel Ltd., Tokyo (Japan)
2004-07-01
The international and Japan's steel industry, the coking coal market, and Japan's expectations from Canada's coal industry are discussed. Japan's steel mills are operating at full capacity. Crude steel production for the first half of 2004 was 55.8 million tons. The steel mills are profitable, but costs are high, and there are difficulties with procuring raw materials. Japan is trying to enhance the quality of coke, in order to achieve higher productivity in the production of pig iron. Economic growth is rising disproportionately in the BRICs (Brazil, Russia, India, and China), with a large increase in coking coal demand from China. On the supply side, there are several projects underway in Australia and Canada to increase production. These include new developments by Elk Valley Coal Corporation, Grande Cache Coal, Western Canadian Coal, and Northern Energy and Mining in Canada. The Elga Mine in the far eastern part of Russia is under development. But the market is expected to remain tight for some time. Japan envisions Canadian coal producers will provide a stable coal supply, expansion of production and infrastructure capabilities, and stabilization of price. 16 slides/overheads are included.
Clean Cast Steel Technology, Phase IV
Energy Technology Data Exchange (ETDEWEB)
Charles E. Bates
2003-02-24
The objective of the Clean Cast Steel Technology Program was to improve casting product quality by removing or minimizing oxide defects and to allow the production of higher integrity castings for high speed machining lines. Previous research has concentrated on macro-inclusions that break, chip, or crack machine tool cutters and drills and cause immediate shutdown of the machining lines. The overall goal of the project is to reduce the amount of surface macro-inclusions and improve the machinability of steel castings. Macro-inclusions and improve the machinability of steel castings. Macro-inclusions have been identified by industrial sponsors as a major barrier to improving the quality and marketability of steel castings.
Mechanical properties of CO2/MIG welded structural rolled steel and stainless steel
International Nuclear Information System (INIS)
Lim, Jong Young; Yoon, Myong Jin; Kim, Sang Youn; Kim, Tae Gyu; Shin, Hyeon Seung
2015-01-01
To accomplish long-term use of specific parts of steel, welding technology is widely applied. In this study, to compare the efficiency in improving mechanical properties, rolled steel (SS400) was welded with stainless steel (STS304) by both CO 2 welding method and MIG (metal inert gas) welding method, respectively. Multi-tests were conducted on the welded specimen, such as X-ray irradiation, Vickers' Hardness, tensile test, fatigue test and fatigue crack growth test. Based on the fatigue crack growth test performed by two different methods, the relationship of da/dN was analyzed. Although the hardness by the two methods was similar, tensile test and fatigue properties of MIG welded specimen are superior to CO 2 welded one.