WorldWideScience

Sample records for status 140e1 act

  1. 7 CFR 15e.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Employment. 15e.140 Section 15e.140 Agriculture Office... OR ACTIVITIES CONDUCTED BY THE UNITED STATES DEPARTMENT OF AGRICULTURE § 15e.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

  2. 40 CFR 40.140-3 - Federal Water Pollution Control Act.

    Science.gov (United States)

    2010-07-01

    ... such safe water and such elimination or control of water pollution for all native villages in the State... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Federal Water Pollution Control Act. 40... FEDERAL ASSISTANCE RESEARCH AND DEMONSTRATION GRANTS § 40.140-3 Federal Water Pollution Control Act. (a...

  3. Reaction /sup 140/Ce (e, e'p), (2)

    Energy Technology Data Exchange (ETDEWEB)

    Saito, T; Shoda, K [Tohoku Univ., Sendai (Japan). Lab. of Nuclear Science

    1975-06-01

    An experiment was carried out to study the character of the resonance observed at 24.4 MeV in the /sup 140/Ce (..gamma.., p) /sup 139/La reaction. The (..gamma.., p/sub 0/ + p/sub 1/) cross section was measured at the angles of 54.7/sup 0/ and 125.3/sup 0/, at which the angle-dependent term of E1 becomes zero, for the energy range between 19 and 26 MeV. Existence of a peak due to the E2 resonance around 24.4 MeV was examined. The energy of incident electrons from a linear accelerator was changed between 20 and 26.7 MeV. The target was a Ce foil of 7.3 mg/cm/sup 2/ thick. The proton spectra due to the /sup 140/Ce (e, e' p) /sup 139/La reaction were measured with a broad range magnetic spectrometer. In the determined spectra of /sup 140/Ce (..gamma.., p/sub 0/+p/sub 1/) /sup 139/La, any remarkable peak, except one at 20.5 MeV, was not seen. From the observed spectra, the total cross section and the asymmetry factor due to interference were obtained as functions of energy. The values of the asymmetry factor were almost flat in the energy range between 19 and 26 MeV. The resonance at 24.4 MeV in the total cross section may be due to the E1 resonance, and is not due to the E2.

  4. STIS E140M Sensitivity Curves

    Science.gov (United States)

    Monroe, TalaWanda R.

    2017-08-01

    The spectrophotometric white dwarf G191-B2B will be observed with the E140M grating to obtain an updated set of sensitivity curves for this highly used mode. Spectroscopic sensitivity monitoring observations of BD+284211 have shown that the blaze function shapes have changed since SM4 and now limit the relative photometric flux accuracy of 14 of 43 E140M spectral orders to 5-10% at the edges. The blaze function shape changes have hindered attempts to determine the post-SM4 temporal blaze function shifts for this grating. Given the popularity of this unique FUV mode, with almost full simultaneous coverage of 1144 to 1710 A in a single observation, and consideration of the STIS archival legacy, we request 1 orbit to re-observe G191-B2B with the E140/1425 setting.

  5. 10 CFR 140.1 - Purpose.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Purpose. 140.1 Section 140.1 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) FINANCIAL PROTECTION REQUIREMENTS AND INDEMNITY AGREEMENTS General Provisions § 140.1 Purpose. The regulations in this part are issued to provide appropriate procedures and requirements for...

  6. 1 CFR 500.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Employment. 500.140 Section 500.140 General... ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  7. 1 CFR 457.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Employment. 457.140 Section 457.140 General... ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  8. 17 CFR 140.1 - Headquarters office.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Headquarters office. 140.1..., FUNCTIONS, AND PROCEDURES OF THE COMMISSION Organization § 140.1 Headquarters office. (a) General. The headquarters office of the Commission is located at Three Lafayette Centre, 1155 21st Street, NW., Washington...

  9. 25 CFR 140.26 - Infectious plants.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Infectious plants. 140.26 Section 140.26 Indians BUREAU... Infectious plants. Traders shall not introduce into, sell, or spread within Indian reservations any plant, plant product, seed, or any type of vegetation, which is infested, or infected or which might act as a...

  10. 25 CFR 140.1 - Sole power to appoint.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Sole power to appoint. 140.1 Section 140.1 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES LICENSED INDIAN TRADERS § 140.1 Sole power to appoint. The Commissioner of Indian Affairs shall have the sole power and authority to...

  11. 7 CFR 1.140 - Conferences and procedure.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Conferences and procedure. 1.140 Section 1.140 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Rules of Practice Governing...) An outline of the case or defense; (ii) The legal theories upon which the party will rely; (iii...

  12. Two-phonon E1 excitations in {sup 40}Ca and {sup 140}Ce

    Energy Technology Data Exchange (ETDEWEB)

    Baldenhofer, Martin; Derya, Vera; Endres, Janis; Hennig, Andreas; Zilges, Andreas [Institute for Nuclear Physics, University of Cologne (Germany); Loeher, Bastian; Savran, Deniz [ExtreMe Matter Institute EMMI and Research Division, GSI, Darmstadt (Germany); Frankfurt Institute for Advanced Studies FIAS, Frankfurt (Germany); Tornow, Werner [Department of Physics, Duke University (United States)

    2014-07-01

    The coupling of a quadrupole- and an octupole-vibrational excitation results in a quintuplet of J{sup π} = 1{sup -} to 5{sup -} vibrational states with two-phonon structure. Candidates for harmonic two-phonon excitations are found energetically in the vicinity of the sum of the constituent excitation energies. Their structure can be tested by studying their γ-decay behavior in detail. We studied candidates for two-phonon E1 excitations in two nuclei of different mass, namely {sup 40}Ca and {sup 140}Ce, with the high-efficiency γ{sup 3} setup [1] at the High Intensity γ-ray Source facility at the Triangle Universities Nuclear Laboratory in Durham, USA. The mono-energetic γ-ray beam allows for a selective excitation of the states of interest. In combination with the γ{sup 3} setup, on the one hand, a high efficiency for γ-ray detection is achieved by an array of HPGe and LaBr detectors, and, on the other hand, the analysis of γ-γ coincidences is possible.

  13. 27 CFR 1.40 - Change of name.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Change of name. 1.40... Amendment and Duration of Basic Permits § 1.40 Change of name. In the event of any change in the name (trade or corporate name) of a permittee, or, in the event a permittee desires to engage in operations under...

  14. Licenciamento ambiental municipal e a LC n°. 140/2011

    Directory of Open Access Journals (Sweden)

    Felipe Pires Muniz de Brito

    2014-05-01

    Full Text Available Segundo a Constituição de 1988, a proteção ambiental é compartilhada por todos os entes da Federação brasileira e, por conta disto, requer uma atuação conjunta. Para tanto, o parágrafo único do art. 23 CF/88 estabeleceu que a tarefa de organizar o sistema federativo ficaria a cargo de lei complementar, a qual fixaria normas de cooperação. Dessa forma, foi promulgada em 2011 a Lei Complementar n°. 140, que, dentre outras matérias, define as competências de União, Estados, Distrito Federal e Municípios perante o licenciamento ambiental. Diante desse quadro, o texto propõe uma análise específica sobre o papel dos entes municipais e, para tanto, mostrou-se fundamental discorrer sobre a constitucionalidade das tipologias municipais submetidas aos Conselhos Estaduais previstas no art. art. 9º, XIV, a LC nº. 140/2011. Ultrapassadas as premissas referidas, busca-se apresentar o licenciamento ambiental municipal como importante foco de políticas públicas, visando buscar de um meio ambiente ecologicamente equilibrado. Palavras chaves: Federalismo de Cooperação. Licenciamento Ambiental Municipal. LC n°. 140/2011. Gestão Pública Ambiental Municipal.

  15. Aggregation process of Aβ1-40 with non-Aβ amyloid component of α-synuclein

    International Nuclear Information System (INIS)

    Eugene, Cindie; Mousseau, Normand

    2015-01-01

    Many neurodegenerative diseases, such as Alzheimer's and Parkinson's diseases, are characterized by the presence of amyloid fibers. Recently, attention has turned from the fibers to the early stages of oligomerization where toxicity could be highest. Here, we focus on the interactions between non-Aβ amyloid component of a-synuclein (NAC) and Aβ 1-40 , two proteins found in amyloid fibrils associated with Alzheimer's disease. We combine the coarse-grained OPEP potential with a Hamiltonian and temperature replica exchange molecular dynamics simulation (HT-REMD) to identify mechanisms leading to the formation of secondary structures promoting fibrillation. We observe that the propensity to form beta-sheet remains the same for Aβ 1-40 whereas is decreases significantly for NAC. In particular, the 25-35 region of Aβ 1-40 is a significant area of secondary structure stabilization with NAC. The ionic interactions between salt-bridge D23 and K28 in Aβ 1-40 and K20 and E23 in NAC of the heterogeneous dimer are consistent with the salt-bridges found in NAC and Aβ 1-40 homogenous dimers and allow us to see that these interactions don't necessarily dominate the interchain stabilizations. Our numerical simulation also show the formation of interaction between the early oligomer of NAC and Aβ 1-40 . (paper)

  16. [Construction and identification of Nogo extra cellular peptide residues 1-40 gene lentiviral vector].

    Science.gov (United States)

    Yuan, Haifeng; Song, Yueming; Liu, Hao; Zhou, Chunguang; Kong, Qingquan; Liu, Liming; Gong, Quan

    2012-02-01

    To construct a lentiviral expression vector carrying Nogo extra cellular peptide residues 1-40 (NEP1-40) and to obtain NEP1-40 efficient and stable expression in mammalian cells. The DNA fragment of NEP1-40 coding sequence was amplified by PCR with designed primer from the cDNA library including NEP1-40 gene, and then subcloned into pGC-FU vector with in-fusion technique to generate the lentiviral expression vector, pGC-FU-NEP1-40. The positive clones were screened by PCR and the correct NEP1-40 was confirmed by sequencing. Recombinant lentiviruses were produced in 293T cells after the cotransfection of pGC-FU-NEP1-40, and packaging plasmids of pHelper 1.0 and pHelper 2.0. Green fluorescent protein (GFP) expression of infected 293T cells was observed to evaluate gene delivery efficiency. NEP1-40 protein expression in 293T cells was detected by Western blot. The lentiviral expression vector carrying NEP1-40 was successfully constructed by GFP observation, and NEP1-40 protein expression was detected in 293T cells by Western blot. The recombinant lentivirus pGC-FU-NEP1-40 is successfully constructed and it lays a foundation for further molecular function study of NEP 1-40.

  17. The role of membrane microdomains in transmembrane signaling through the epithelial glycoprotein Gp140/CDCP1

    Science.gov (United States)

    Alvares, Stacy M.; Dunn, Clarence A.; Brown, Tod A.; Wayner, Elizabeth E.; Carter, William G.

    2008-01-01

    Cell adhesion to the extracellular matrix (ECM) via integrin adhesion receptors initiates signaling cascades leading to changes in cell behavior. While integrin clustering is necessary to initiate cell attachment to the matrix, additional membrane components are necessary to mediate the transmembrane signals and the cell adhesion response that alter downstream cell behavior. Many of these signaling components reside in glycosphingolipid-rich and cholesterol-rich membrane domains such as Tetraspanin Enriched Microdomains (TEMs)/Glycosynapse 3 and Detergent-Resistant Microdomains (DRMs), also known as lipid rafts. In the following article, we will review examples of how components in these membrane microdomains modulate integrin adhesion after initial attachment to the ECM. Additionally, we will present data on a novel adhesion-responsive transmembrane glycoprotein Gp140/CUB Domain Containing Protein 1, which clusters in epithelial cell-cell contacts. Gp140 can then be phosphorylated by Src Family Kinases at tyrosine 734 in response to outside-in signals- possibly through interactions involving the extracellular CUB domains. Data presented here suggests that outside-in signals through Gp140 in cell-cell contacts assemble membrane clusters that associate with membrane microdomains to recruit and activate SFKs. Active SFKs then mediate phosphorylation of Gp140, SFK and PKCδ with Gp140 acting as a transmembrane scaffold for these kinases. We propose that the clustering of Gp140 and signaling components in membrane microdomains in cell-cell contacts contributes to changes in cell behavior. PMID:18269919

  18. Status of Electricity Act, 2003: A systematic review of literature

    International Nuclear Information System (INIS)

    Mukherjee, Shilpi; Dhingra, Tarun; Sengupta, Anirban

    2017-01-01

    The Electricity Act 2003 was a landmark Act which promised to remove the maladies which afflict the Indian Power Sector and that too at a time when the sector was ridden with problems. With concepts such as open access, multiple distribution licensees, wheeling of electricity etc, the said Act intended to encourage competition which in turn was meant bring a paradigm shift in the sector. The paper undertakes a systematic literature review to find the status of review of the promising Act. More than a decade has passed since its enactment and amendments are due with the legislative body of India but none of the literature reviewed gives a comprehensive view encompassing all the objectives of the Act. Moreover, these documents study either the probable impact or the impact on a particular segment only. It has important implications for the Power sector which highlights a significant gap in literature and provides a basis on which future research can be built upon. - Highlights: • Electricity Act 2003 is a landmark in Indian power sector reform. • Systematic literature review is done to find the status of review of the Act. • Status of Electricity Act 2003 not comprehensively reviewed. • Status of the act needs to be reviewed comprehensively through actual data.

  19. 14 CFR 1264.140 - Stay pending appeal.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Stay pending appeal. 1264.140 Section 1264... FRAUD CIVIL PENALTIES ACT OF 1986 § 1264.140 Stay pending appeal. (a) An initial decision is stayed automatically pending disposition of a motion for reconsideration or of an appeal to the authority head. (b) No...

  20. Surface chemistry of lipid raft and amyloid Aβ (1-40) Langmuir monolayer.

    Science.gov (United States)

    Thakur, Garima; Pao, Christine; Micic, Miodrag; Johnson, Sheba; Leblanc, Roger M

    2011-10-15

    Lipid rafts being rich in cholesterol and sphingolipids are considered to provide ordered lipid environment in the neuronal membranes, where it is hypothesized that the cleavage of amyloid precursor protein (APP) to Aβ (1-40) and Aβ (1-42) takes place. It is highly likely that the interaction of lipid raft components like cholesterol, sphingomylein or GM1 leads to nucleation of Aβ and results in aggregation or accumulation of amyloid plaques. One has investigated surface pressure-area isotherms of the lipid raft and Aβ (1-40) Langmuir monolayer. The compression-decompression cycles and the stability of the lipid raft Langmuir monolayer are crucial parameters for the investigation of interaction of Aβ (1-40) with the lipid raft Langmuir monolayer. It was revealed that GM1 provides instability to the lipid raft Langmuir monolayer. Adsorption of Aβ (1-40) onto the lipid raft Langmuir monolayer containing neutral (POPC) or negatively charged phospholipid (DPPG) was examined. The adsorption isotherms revealed that the concentration of cholesterol was important for adsorption of Aβ (1-40) onto the lipid raft Langmuir monolayer containing POPC whereas for the lipid raft Langmuir monolayer containing DPPG:cholesterol or GM1 did not play any role. In situ UV-vis absorption spectroscopy supported the interpretation of results for the adsorption isotherms. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Search for excited leptons in $e^{+} e^{-}$ annihilation at $\\sqrt {s}$ = 130 - 140 GeV

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bencze, G L; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Bujak, A T; Burger, J D; Burger, W J; Burgos, C; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, C; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coan, T E; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Dénes, E; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabbretti, R; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Felcini, Marta; Ferguson, T; Fernández, D; Fernández, G; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Gailloud, M; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; González, E; Gougas, Andreas; Goujon, D; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gustafson, H R; Gutay, L J; Hangarter, K; Hartmann, B; Hasan, A; He, J T; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Koffeman, E; Köngeter, A; Koutsenko, V F; Koulbardis, A; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lindemann, B; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Maolinbay, M; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Möller, M; Monteleoni, B; Moore, R; Morganti, S; Mount, R; Müller, S; Muheim, F; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Redaelli, M; Ren, D; Rescigno, M; Reucroft, S; Ricker, A; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Salicio, J M; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schulte, R; Schultze, K; Schwenke, J; Schwering, G; Sciacca, C; Seiler, P G; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Toker, O; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tsaregorodtsev, A Yu; Tully, C; Tuchscherer, H; Tung, K L; Ulbricht, J; Urbàn, L; Uwer, U; Valente, E; Van de Walle, R T; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vuilleumier, L; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Weill, R; Willmott, C; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zaccardelli, C; Zalite, A; Zemp, P; Zeng, J Y; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, G J; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Van der Zwaan, B C C

    1996-01-01

    We report on a search for the excited leptons e^*,mu^*,tau^* and nu^* in e+e- collisions at sqrt{s} = 130 - 140 GeV using the L3 detector at LEP. No evidence has been found for their existence. From an analysis of the expected pair produced l^*l^* in the channels e.e.gamma.gamma, mu.mu.gamma.gamma, tau.tau.gamma.gamma, eeWW, and nu.nu.gamma.gamma, we determine the lower mass limits at 95% C.L. of 64.7 GeV for e^*, 64.9 GeV for mu^*, 64.2 GeV for tau*, 57.3 GeV ( eW decay mode) and 61.4 GeV ( nu.gamma decay mode) for nu^*. From an analysis of the expected singly produced l.l^* in the channels e.e.gamma, mu.mu.gamma, tau.tau.gamma, nu.eW and nu.nu.gamma, we determine upper limits on the couplings lambda/m_{l^*} up to m_{l^*} = 130 GeV.

  2. The 140 GHZ, 1 MW Gyrotron - Status and Recent Results

    Science.gov (United States)

    Gantenbein, G.; Dammertz, G.; Illy, S.; Kern, S.; Leonhardt, W.; Piosczyk, B.; Schmid, M.; Thumm, M.; Braune, H.; Erckmann, V.; Laqua, H. P.; Michel, G.; Kasparek, W.; Lechte, C.; Legrand, F.; Lievin, C.; Prinz, O.

    2009-04-01

    A 10 MW ECRH system is currently under construction for the stellarator W7-X which will be built up and operated by IPP in Greifswald, Germany. The present status of the complete system is reported in [1]. The RF power will be provided by 10 gyrotrons. A European collaboration has been established to develop and build the 10 gyrotrons each with an output power of 1 MW for continuous wave (CW) operation [2]. Nine gyrotrons are being manufactured by Thales Electron Devices (TED), Vélizy, France, one gyrotron was produced by CPI, Palo Alto, CA and passed the acceptance tests at IPP. The acceptance tests of the TED gyrotrons are performed at the test stand at FZK and on site at IPP. The first series tube yielded a total output power of 0.98 MW, with an efficiency of 31 % (without a single stage depressed collector) in short pulse operation and of 0.92 MW in pulses of 1800 s (efficiency of almost 45 % at a depression voltage of 29 kV) [3], The Gaussian mode output power was 0.91 MW. The RF power, measured in a calorimetric load at the end of a 25 m long quasi-optical transmission line with seven mirrors, was 0.87 MW. In this contribution typical results of the next series gyrotrons will be reported.

  3. Thioflavin T templates amyloid β(1-40) conformation and aggregation pathway

    DEFF Research Database (Denmark)

    Di Carlo, Maria Giovanna; Minicozzi, Velia; Foderà, Vito

    2015-01-01

    Aβ(1-40) peptide supramolecular assembly and fibril formation processes are widely recognized to have direct implications in the progression of Alzheimer's disease. The molecular basis of this biological process is still unknown and there is a strong need of developing effective strategies...... in turn rests on the reliability of the probe/labels involved. Here we present evidences of the effect of Thioflavin T (ThT), a worldwide used fluorescent dye to monitor amyloid growth, on the Aβ(1-40) conformation, stability and aggregation. By combining experimental information and Molecular Dynamics...... simulation results, we show that the presence of ThT in solution affects peptide conformation inducing peculiar supramolecular association. In particular ThT interactions with specific Aβ(1-40) residues promote a rigid partially-folded conformation which shifts the balance between different species...

  4. 13 CFR 120.140 - What ethical requirements apply to participants?

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What ethical requirements apply to... LOANS Policies Applying to All Business Loans Ethical Requirements § 120.140 What ethical requirements... “Participants”), must act ethically and exhibit good character. Ethical indiscretion of an Associate of a...

  5. The antioxidant status of coenzyme Q10 and vitamin E in children with type 1 diabetes.

    Science.gov (United States)

    Alkholy, Usama M; Abdalmonem, Nermin; Zaki, Ahmed; Elkoumi, Mohamed A; Hashim, Mustafa I Abu; Basset, Maha A A; Salah, Hossam E

    2018-02-07

    The purpose of this study was to evaluate the antioxidant status of plasma vitamin E and plasma and intracellular coenzyme Q10 in children with type 1 diabetes. This case-control study was conducted on 72 children with type 1 diabetes and compared to 48 healthy children, who were age, sex, and ethnicity-matched. The diabetic children were divided according to their glycosylated hemoglobin (A1c %) into two groups: poor and good glycemic control groups. All children underwent full history taking, clinical examination, and laboratory measurement of complete blood count, A1c %, plasma cholesterol, triglycerides, and vitamin E levels and coenzyme Q10 levels in plasma, erythrocytes, and platelets. Children with poor glycemic control showed significantly higher plasma vitamin E, coenzyme Q10, triglycerides, low-density lipoproteins, waist circumference/height ratio, cholesterol levels, and lower high-density lipoproteins and platelet coenzyme Q10 redox status in comparison to those with good glycemic control and the control group (p<0.05). Plasma coenzyme Q10 showed a positive correlation with the duration of type 1 diabetes, triglycerides, cholesterol, vitamin E, and A1c %, and negative correlation with the age of the diabetic group (p<0.05). The platelet redox status showed a negative correlation with the A1c % levels (r=-0.31; p=0.022) and the duration of type 1 diabetes (r=-0.35, p=0.012). Patients with type 1 diabetes, especially poorly controlled, had elevation of plasma vitamin E and coenzyme Q10 levels and decreased platelet redox status of coenzyme Q10, which may be an indicator of increased oxidative stress. Copyright © 2018 Sociedade Brasileira de Pediatria. Published by Elsevier Editora Ltda. All rights reserved.

  6. Why are earthquakes nudging the pole towards 140°E?

    Science.gov (United States)

    Spada, Giorgio

    Earthquakes have collectively the tendency to displace the pole of rotation of the earth towards a preferred direction (∼140°E). This trend, which is still unexplained on quantitative grounds, has been revealed by computations of earthquake-induced inertia variations on both a secular and a decade time-scale. Purpose of this letter is to show that the above trend results from the combined effects of the geographical distribution of hypocenters and of the prevailing dip-slip nature of large earthquakes in this century. Our findings are based on the static dislocation theory and on simple geometrical arguments.

  7. Neodymium-140 DOTA-LM3

    DEFF Research Database (Denmark)

    Severin, Gregory; Kristensen, Lotte K.; Nielsen, Carsten H.

    2017-01-01

    analogue, DOTA-LM3 (1,4,7,10- tetraazacyclododecane, 1,4,7- tri acetic acid, 10- acetamide N - p-Cl-Phecyclo(D-Cys-Tyr-d-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)D-Tyr-NH2) and injected into H727 xenograft bearing mice. Comparative pre- and post-mortem PET imaging at 16 h postinjection was used to quantify......140Nd (t1/2 = 3.4 days), owing to its short-lived positron emitting daughter 140Pr (t1/2 = 3.4 min), has promise as an in vivo generator for positron emission tomography (PET). However, the electron capture decay of 140Nd is chemically disruptive to macrocycle-based radiolabeling, meaning...... the in vivo redistribution of 140Pr following 140Nd decay. The somatostatin receptor-positive pancreas exhibited the highest tissue accumulation of 140Nd-DOTA-LM3 (13% ID/g at 16 h) coupled with the largest observed redistribution rate, where 56 ± 7% (n = 4, mean ± SD) of the in situ produced 140Pr washed out...

  8. Receptor-interacting Protein 140 Overexpression Promotes Neuro-2a Neuronal Differentiation by ERK1/2 Signaling

    Directory of Open Access Journals (Sweden)

    Xiao Feng

    2015-01-01

    Full Text Available Background: Abnormal neuronal differentiation plays an important role in central nervous system (CNS development abnormalities such as Down syndrome (DS, a disorder that results directly from overexpression of genes in trisomic cells. Receptor-interacting protein 140 (RIP140 is significantly upregulated in DS brains, suggesting its involvement in DS CNS development abnormalities. However, the role of RIP140 in neuronal differentiation is still not clear. The current study aimed to investigate the effect of RIP140 overexpression on the differentiation of neuro-2a (N2a neuroblastoma cells, in vitro. Methods: Stably RIP140-overexpressing N2a (N2a-RIP140 cells were used as a neurodevelopmental model, and were constructed by lipofection and overexpression validated by real-time polymerase chain reaction and Western blot. Retinoic acid (RA was used to stimulate N2a differentiation. Combining the expression of Tuj1 at the mRNA and protein levels, the percentage of cells baring neurites, and the number of neurites per cell body was semi-quantified to determine the effect of RIP140 on differentiation of N2a cells. Furthermore, western blot and the ERK1/2 inhibitor U0126 were used to identify the specific signaling pathway by which RIP140 induces differentiation of N2a cells. Statistical significance of the differences between groups was determined by one-way analysis of variance followed by the Dunnett test. Results: Compared to untransfected N2a cells RIPl40 expression in N2a-RIP140 cells was remarkably upregulated at both the mRNA and protein levels. N2a-RIP140 cells had a significantly increased percentage of cells baring neurites, and numbers of neurites per cell, as compared to N2a cells, in the absence and presence of RA (P < 0.05. In addition, Tuj1, a neuronal biomarker, was strongly upregulated in N2a-RIP140 cells (P < 0.05 and phosphorylated ERK1/2 (p-ERK1/2 levels in N2a-RIP140 cells were dramatically increased, while differentiation was

  9. Skin score correlates with global DNA methylation and GSTO1 A140D polymorphism in arsenic-affected population of Eastern India.

    Science.gov (United States)

    Majumder, Moumita; Dasgupta, Uma B; Guha Mazumder, D N; Das, Nilansu

    2017-07-01

    Arsenic is a potent environmental toxicant causing serious public health concerns in India, Bangladesh and other parts of the world. Gene- and promoter-specific hypermethylation has been reported in different arsenic-exposed cell lines, whereas whole genome DNA methylation study suggested genomic hypo- and hypermethylation after arsenic exposure in in vitro and in vivo studies. Along with other characteristic biomarkers, arsenic toxicity leads to typical skin lesions. The present study demonstrates significant correlation between severities of skin manifestations with their whole genome DNA methylation status as well as with a particular polymorphism (Ala 140 Asp) status in arsenic metabolizing enzyme Glutathione S-transferase Omega-1 (GSTO1) in arsenic-exposed population of the district of Nadia, West Bengal, India.

  10. Status of Fermilab E-710

    International Nuclear Information System (INIS)

    Rubinstein, R.

    1993-08-01

    This report give the current status of E-710, an experiment at the Fermilab bar pp Tevatron Collider to measure elastic scattering, total cross sections and diffraction dissociation up to √s = 1.8 TeV

  11. Dimer formation enhances structural differences between amyloid β-protein (1-40 and (1-42: an explicit-solvent molecular dynamics study.

    Directory of Open Access Journals (Sweden)

    Bogdan Barz

    Full Text Available Amyloid β-protein (Aβ is central to the pathology of Alzheimer's disease. A 5% difference in the primary structure of the two predominant alloforms, Aβ(1-40 and Aβ(1-42, results in distinct assembly pathways and toxicity properties. Discrete molecular dynamics (DMD studies of Aβ(1-40 and Aβ(1-42 assembly resulted in alloform-specific oligomer size distributions consistent with experimental findings. Here, a large ensemble of DMD-derived Aβ(1-40 and Aβ(1-42 monomers and dimers was subjected to fully atomistic molecular dynamics (MD simulations using the OPLS-AA force field combined with two water models, SPCE and TIP3P. The resulting all-atom conformations were slightly larger, less compact, had similar turn and lower β-strand propensities than those predicted by DMD. Fully atomistic Aβ(1-40 and Aβ(1-42 monomers populated qualitatively similar free energy landscapes. In contrast, the free energy landscape of Aβ(1-42 dimers indicated a larger conformational variability in comparison to that of Aβ(1-40 dimers. Aβ(1-42 dimers were characterized by an increased flexibility in the N-terminal region D1-R5 and a larger solvent exposure of charged amino acids relative to Aβ(1-40 dimers. Of the three positively charged amino acids, R5 was the most and K16 the least involved in salt bridge formation. This result was independent of the water model, alloform, and assembly state. Overall, salt bridge propensities increased upon dimer formation. An exception was the salt bridge propensity of K28, which decreased upon formation of Aβ(1-42 dimers and was significantly lower than in Aβ(1-40 dimers. The potential relevance of the three positively charged amino acids in mediating the Aβ oligomer toxicity is discussed in the light of available experimental data.

  12. 23 CFR 140.912 - Transportation.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Transportation. 140.912 Section 140.912 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PAYMENT PROCEDURES REIMBURSEMENT Reimbursement for Railroad Work § 140.912 Transportation. (a) Employees. The company's cost of necessary employee...

  13. 23 CFR 140.916 - Protection.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Protection. 140.916 Section 140.916 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PAYMENT PROCEDURES REIMBURSEMENT Reimbursement for Railroad Work § 140.916 Protection. The cost of essential protective services which, in the opinion of a...

  14. 40 CFR 12.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Employment. 12.140 Section 12.140... IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE ENVIRONMENTAL PROTECTION AGENCY § 12.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

  15. Undocumented & Unafraid: The DREAM Act 5 and the Public Disclosure of Undocumented Status as a Political Act

    Science.gov (United States)

    Galindo, Rene

    2012-01-01

    In 2010, the political advocacy of undocumented immigrant students in support of the DREAM Act took a new and decisive direction when the public disclosure of undocumented status as political act was adopted. This new political strategy included the first case of civil disobedience practiced by a group of undocumented immigrant students now known…

  16. Comparison of Witczak NCHRP 1-40D & Hirsh dynamic modulus models based on different binder characterization methods: a case study

    Directory of Open Access Journals (Sweden)

    Khattab Ahmed M.

    2017-01-01

    Full Text Available The Pavement ME Design method considers the hot mix asphalt (HMA dynamic modulus (E* as the main mechanistic property that affects pavement performance. For the HMA, E* can be determined directly by laboratory testing (level 1 or it can be estimated using predictive equations (levels 2 and 3. Pavement-ME Design introduced the NCHRP1-40D model as the latest model for predicting E* when levels 2 or 3 HMA inputs are used. This study focused on utilizing laboratory measured E* data to compare NCHRP1-40D model with Hirsh model. This comparison included the evaluation of the binder characterization level as per Pavement ME Design and its influence on the performance of these models. E*tests were conducted in the laboratory on 25 local mixes representing different road construction projects in the kingdom of Saudi Arabia. The main tests for the mix binders were dynamic Shear Rheometer (DSR and Brookfield Rotational Viscometer (RV. Results showed that both models with level 3 binder data produced very similar accuracy. The highest accuracy and lowest bias for both models occurred with level 3 binder data. Finally, the accuracy of prediction and level of bias for both models were found to be a function of the binder input level.

  17. 23 CFR 140.505 - Reimbursable costs.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reimbursable costs. 140.505 Section 140.505 Highways... Administrative Settlement Costs-Contract Claims § 140.505 Reimbursable costs. (a) Federal funds may participate in administrative settlement costs which are: (1) Incurred after notice of claim, (2) Properly...

  18. 23 CFR 140.612 - Cash management.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Cash management. 140.612 Section 140.612 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PAYMENT PROCEDURES REIMBURSEMENT Reimbursement for Bond Issue Projects § 140.612 Cash management. By July 1 of each year the SHA will provide...

  19. 3 CFR 102.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

  20. 20 CFR 365.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Employment. 365.140 Section 365.140 Employees... § 365.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  1. 22 CFR 219.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 219.140 Section 219.140 Foreign... DEVELOPMENT § 219.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  2. 11 CFR 6.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Employment. 6.140 Section 6.140 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  3. 22 CFR 144.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Employment. 144.140 Section 144.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE UNITED STATES DEPARTMENT OF STATE § 144.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  4. 40 CFR 46.140 - Benefits.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Benefits. 46.140 Section 46.140 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE FELLOWSHIPS Applying for Fellowships § 46.140 Benefits. EPA fellowships may include funds to help you pay such things...

  5. 49 CFR 28.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Employment. 28.140 Section 28.140 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.140 Employment. (a) No qualified...

  6. 24 CFR 9.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Employment. 9.140 Section 9.140... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT § 9.140 Employment. No qualified individual with disabilities shall, on the basis of disability, be subjected to discrimination in employment under any program or...

  7. 28 CFR 39.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Employment. 39.140 Section 39.140... PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  8. 23 CFR 140.607 - Construction.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 140.607 Section 140.607 Highways FEDERAL... Bond Issue Projects § 140.607 Construction. Construction shall be supervised by the SHA in the same manner as for regularly financed Federal-aid projects. The FHWA will make construction inspections and...

  9. 25 CFR 140.21 - Gambling.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Gambling. 140.21 Section 140.21 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES LICENSED INDIAN TRADERS § 140.21 Gambling. Gambling, by dice, cards, or in any way whatever, is strictly prohibited in any licensed trader's store or...

  10. 23 CFR 140.807 - Reimbursable costs.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reimbursable costs. 140.807 Section 140.807 Highways... Highway Agency Audit Expense § 140.807 Reimbursable costs. (a) Federal funds may be used to reimburse an SHA for the following types of project related audit costs: (1) Salaries, wages, and related costs...

  11. 23 CFR 140.906 - Labor costs.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Labor costs. 140.906 Section 140.906 Highways FEDERAL... Railroad Work § 140.906 Labor costs. (a) General. (1) Salaries and wages, at actual or average rates, and... reimbursable when supported by adequate records. This shall include labor costs associated with preliminary...

  12. 25 CFR 140.19 - Drugs.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Drugs. 140.19 Section 140.19 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES LICENSED INDIAN TRADERS § 140.19 Drugs. Traders shall not keep for sale, or sell, give away, or use any opium, chloral, cocaine, peyote or mescal bean...

  13. Decay of quadrupole-octupole 1- states in 40Ca and 140Ce

    Science.gov (United States)

    Derya, V.; Tsoneva, N.; Aumann, T.; Bhike, M.; Endres, J.; Gooden, M.; Hennig, A.; Isaak, J.; Lenske, H.; Löher, B.; Pietralla, N.; Savran, D.; Tornow, W.; Werner, V.; Zilges, A.

    2016-03-01

    Background: Two-phonon excitations originating from the coupling of two collective one-phonon states are of great interest in nuclear structure physics. One possibility to generate low-lying E 1 excitations is the coupling of quadrupole and octupole phonons. Purpose: In this work, the γ -decay behavior of candidates for the (21+⊗31-)1- state in the doubly magic nucleus 40Ca and in the heavier and semimagic nucleus 140Ce is investigated. Methods: (γ ⃗,γ') experiments have been carried out at the High Intensity γ -ray Source (HI γ S ) facility in combination with the high-efficiency γ -ray spectroscopy setup γ3 consisting of HPGe and LaBr3 detectors. The setup enables the acquisition of γ -γ coincidence data and, hence, the detection of direct decay paths. Results: In addition to the known ground-state decays, for 40Ca the decay into the 31- state was observed, while for 140Ce the direct decays into the 21+ and the 02+ state were detected. The experimentally deduced transition strengths and excitation energies are compared to theoretical calculations in the framework of EDF theory plus QPM approach and systematically analyzed for N =82 isotones. In addition, negative parities for two J =1 states in 44Ca were deduced simultaneously. Conclusions: The experimental findings together with the theoretical calculations support the two-phonon character of the 11- excitation in the light-to-medium-mass nucleus 40Ca as well as in the stable even-even N =82 nuclei.

  14. 23 CFR 140.606 - Project agreements.

    Science.gov (United States)

    2010-04-01

    ... Reimbursement for Bond Issue Projects § 140.606 Project agreements. Project Agreements, Form PR-2, shall be... 23 Highways 1 2010-04-01 2010-04-01 false Project agreements. 140.606 Section 140.606 Highways... projects. 1 The text of FHWA Form PR-2 is found in 23 CFR part 630, subpart C, appendix A. ...

  15. Neodymium-140 DOTA-LM3: Evaluation of an In Vivo Generator for PET with a Non-Internalizing Vector

    Science.gov (United States)

    Severin, Gregory W.; Kristensen, Lotte K.; Nielsen, Carsten H.; Fonslet, Jesper; Jensen, Andreas I.; Frellsen, Anders F.; Jensen, K. M.; Elema, Dennis R.; Maecke, Helmut; Kjær, Andreas; Johnston, Karl; Köster, Ulli

    2017-01-01

    140Nd (t1/2 = 3.4 days), owing to its short-lived positron emitting daughter 140Pr (t1/2 = 3.4 min), has promise as an in vivo generator for positron emission tomography (PET). However, the electron capture decay of 140Nd is chemically disruptive to macrocycle-based radiolabeling, meaning that an in vivo redistribution of the daughter 140Pr is expected before positron emission. The purpose of this study was to determine how the delayed positron from the de-labeled 140Pr affects preclinical imaging with 140Nd. To explore the effect, 140Nd was produced at CERN-ISOLDE, reacted with the somatostatin analogue, DOTA-LM3 (1,4,7,10- tetraazacyclododecane, 1,4,7- tri acetic acid, 10- acetamide N - p-Cl-Phecyclo(d-Cys-Tyr-d-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)d-Tyr-NH2) and injected into H727 xenograft bearing mice. Comparative pre- and post-mortem PET imaging at 16 h postinjection was used to quantify the in vivo redistribution of 140Pr following 140Nd decay. The somatostatin receptor-positive pancreas exhibited the highest tissue accumulation of 140Nd-DOTA-LM3 (13% ID/g at 16 h) coupled with the largest observed redistribution rate, where 56 ± 7% (n = 4, mean ± SD) of the in situ produced 140Pr washed out of the pancreas before decay. Contrastingly, the liver, spleen, and lungs acted as strong sink organs for free 140Pr3+. Based upon these results, we conclude that 140Nd imaging with a non-internalizing vector convolutes the biodistribution of the tracer with the accumulation pattern of free 140Pr. This redistribution phenomenon may show promise as a probe of the cellular interaction with the vector, such as in determining tissue dependent internalization behavior. PMID:28748183

  16. Neodymium-140 DOTA-LM3: Evaluation of an In Vivo Generator for PET with a Non-Internalizing Vector

    Directory of Open Access Journals (Sweden)

    Gregory W. Severin

    2017-07-01

    Full Text Available 140Nd (t1/2 = 3.4 days, owing to its short-lived positron emitting daughter 140Pr (t1/2 = 3.4 min, has promise as an in vivo generator for positron emission tomography (PET. However, the electron capture decay of 140Nd is chemically disruptive to macrocycle-based radiolabeling, meaning that an in vivo redistribution of the daughter 140Pr is expected before positron emission. The purpose of this study was to determine how the delayed positron from the de-labeled 140Pr affects preclinical imaging with 140Nd. To explore the effect, 140Nd was produced at CERN-ISOLDE, reacted with the somatostatin analogue, DOTA-LM3 (1,4,7,10- tetraazacyclododecane, 1,4,7- tri acetic acid, 10- acetamide N - p-Cl-Phecyclo(d-Cys-Tyr-d-4-amino-Phe(carbamoyl-Lys-Thr-Cysd-Tyr-NH2 and injected into H727 xenograft bearing mice. Comparative pre- and post-mortem PET imaging at 16 h postinjection was used to quantify the in vivo redistribution of 140Pr following 140Nd decay. The somatostatin receptor-positive pancreas exhibited the highest tissue accumulation of 140Nd-DOTA-LM3 (13% ID/g at 16 h coupled with the largest observed redistribution rate, where 56 ± 7% (n = 4, mean ± SD of the in situ produced 140Pr washed out of the pancreas before decay. Contrastingly, the liver, spleen, and lungs acted as strong sink organs for free 140Pr3+. Based upon these results, we conclude that 140Nd imaging with a non-internalizing vector convolutes the biodistribution of the tracer with the accumulation pattern of free 140Pr. This redistribution phenomenon may show promise as a probe of the cellular interaction with the vector, such as in determining tissue dependent internalization behavior.

  17. 10 CFR 140.91 - Appendix A-Form of nuclear energy liability policy for facilities.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Appendix A-Form of nuclear energy liability policy for facilities. 140.91 Section 140.91 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) FINANCIAL PROTECTION... other matter not within the Commission's statutory jurisdiction under the Atomic Energy Act. Nuclear...

  18. 22-year surface salinity changes in the Seasonal Ice Zone near 140°E off Antarctica

    Science.gov (United States)

    Morrow, Rosemary; Kestenare, Elodie

    2017-11-01

    Seasonal and interannual variations in sea surface salinity (SSS) are analyzed in the Sea Ice Zone south of 60°S, from a 22-year time series of observations near 140°E. In the northern sea-ice zone during the warming, melting cycle from October to March, waters warm by an average of 3.5 °C and become fresher by 0.1 to 0.25. In the southern sea-ice zone, the surface temperatures vary from - 1 to 1 °C over summer, and the maximal SSS range occurs in December, with a minimum SSS of 33.65 near the Southern Boundary of the ACC, reaching 34.4 in the shelf waters close to the coast. The main fronts, normally defined at subsurface, are shown to have more distinct seasonal characteristics in SSS than in SST. The interannual variations in SSS are more closely linked to variations in upstream sea-ice cover than surface forcing. SSS and sea-ice variations show distinct phases, with large biannual variations in the early 1990s, weaker variations in the 2000s and larger variations again from 2009 onwards. The calving of the Mertz Glacier Tongue in February 2010 leads to increased sea-ice cover and widespread freshening of the surface layers from 2011 onwards. Summer freshening in the northern sea-ice zone is 0.05-0.07 per decade, increasing to 0.08 per decade in the southern sea-ice zone, largely influenced by the Mertz Glacier calving event at the end of our time series. The summer time series of SSS on the shelf at 140°E is in phase but less variable than the SSS observed upstream in the Adélie Depression, and thus represents a spatially integrated index of the wider SSS variations.

  19. Choline Modulation of the Aβ P1-40 Channel Reconstituted into a Model Lipid Membrane

    Directory of Open Access Journals (Sweden)

    Daniela Meleleo

    2010-01-01

    Full Text Available Nicotinic acetylcholine receptors (AChRs, implicated in memory and learning, in subjects affected by Alzheimer's disease result altered. Stimulation of α7-nAChRs inhibits amyloid plaques and increases ACh release. β-amyloid peptide (AβP forms ion channels in the cell and model phospholipid membranes that are retained responsible in Alzheimer disease. We tested if choline, precursor of ACh, could affect the AβP1-40 channels in oxidized cholesterol (OxCh and in palmitoyl-oleoyl-phosphatidylcholine (POPC:Ch lipid bilayers. Choline concentrations of 5 × 10−11 M–1.5 × 10−8 M added to the cis- or trans-side of membrane quickly increased AβP1-40 ion channel frequency (events/min and ion conductance in OxCh membranes, but not in POPC:Ch membranes. Circular Dichroism (CD spectroscopy shows that after 24 and 48 hours of incubation with AβP1-40, choline stabilizes the random coil conformation of the peptide, making it less prone to fibrillate. These actions seem to be specific in that ACh is ineffective either in solution or on AβP1-40 channel incorporated into PLMs.

  20. How cholesterol constrains glycolipid conformation for optimal recognition of Alzheimer's beta amyloid peptide (Abeta1-40).

    Science.gov (United States)

    Yahi, Nouara; Aulas, Anaïs; Fantini, Jacques

    2010-02-05

    Membrane lipids play a pivotal role in the pathogenesis of Alzheimer's disease, which is associated with conformational changes, oligomerization and/or aggregation of Alzheimer's beta-amyloid (Abeta) peptides. Yet conflicting data have been reported on the respective effect of cholesterol and glycosphingolipids (GSLs) on the supramolecular assembly of Abeta peptides. The aim of the present study was to unravel the molecular mechanisms by which cholesterol modulates the interaction between Abeta(1-40) and chemically defined GSLs (GalCer, LacCer, GM1, GM3). Using the Langmuir monolayer technique, we show that Abeta(1-40) selectively binds to GSLs containing a 2-OH group in the acyl chain of the ceramide backbone (HFA-GSLs). In contrast, Abeta(1-40) did not interact with GSLs containing a nonhydroxylated fatty acid (NFA-GSLs). Cholesterol inhibited the interaction of Abeta(1-40) with HFA-GSLs, through dilution of the GSL in the monolayer, but rendered the initially inactive NFA-GSLs competent for Abeta(1-40) binding. Both crystallographic data and molecular dynamics simulations suggested that the active conformation of HFA-GSL involves a H-bond network that restricts the orientation of the sugar group of GSLs in a parallel orientation with respect to the membrane. This particular conformation is stabilized by the 2-OH group of the GSL. Correspondingly, the interaction of Abeta(1-40) with HFA-GSLs is strongly inhibited by NaF, an efficient competitor of H-bond formation. For NFA-GSLs, this is the OH group of cholesterol that constrains the glycolipid to adopt the active L-shape conformation compatible with sugar-aromatic CH-pi stacking interactions involving residue Y10 of Abeta(1-40). We conclude that cholesterol can either inhibit or facilitate membrane-Abeta interactions through fine tuning of glycosphingolipid conformation. These data shed some light on the complex molecular interplay between cell surface GSLs, cholesterol and Abeta peptides, and on the influence

  1. How cholesterol constrains glycolipid conformation for optimal recognition of Alzheimer's beta amyloid peptide (Abeta1-40.

    Directory of Open Access Journals (Sweden)

    Nouara Yahi

    Full Text Available Membrane lipids play a pivotal role in the pathogenesis of Alzheimer's disease, which is associated with conformational changes, oligomerization and/or aggregation of Alzheimer's beta-amyloid (Abeta peptides. Yet conflicting data have been reported on the respective effect of cholesterol and glycosphingolipids (GSLs on the supramolecular assembly of Abeta peptides. The aim of the present study was to unravel the molecular mechanisms by which cholesterol modulates the interaction between Abeta(1-40 and chemically defined GSLs (GalCer, LacCer, GM1, GM3. Using the Langmuir monolayer technique, we show that Abeta(1-40 selectively binds to GSLs containing a 2-OH group in the acyl chain of the ceramide backbone (HFA-GSLs. In contrast, Abeta(1-40 did not interact with GSLs containing a nonhydroxylated fatty acid (NFA-GSLs. Cholesterol inhibited the interaction of Abeta(1-40 with HFA-GSLs, through dilution of the GSL in the monolayer, but rendered the initially inactive NFA-GSLs competent for Abeta(1-40 binding. Both crystallographic data and molecular dynamics simulations suggested that the active conformation of HFA-GSL involves a H-bond network that restricts the orientation of the sugar group of GSLs in a parallel orientation with respect to the membrane. This particular conformation is stabilized by the 2-OH group of the GSL. Correspondingly, the interaction of Abeta(1-40 with HFA-GSLs is strongly inhibited by NaF, an efficient competitor of H-bond formation. For NFA-GSLs, this is the OH group of cholesterol that constrains the glycolipid to adopt the active L-shape conformation compatible with sugar-aromatic CH-pi stacking interactions involving residue Y10 of Abeta(1-40. We conclude that cholesterol can either inhibit or facilitate membrane-Abeta interactions through fine tuning of glycosphingolipid conformation. These data shed some light on the complex molecular interplay between cell surface GSLs, cholesterol and Abeta peptides, and on the

  2. SP140L, an Evolutionarily Recent Member of the SP100 Family, Is an Autoantigen in Primary Biliary Cirrhosis

    Directory of Open Access Journals (Sweden)

    Mario Saare

    2015-01-01

    Full Text Available The SP100 family members comprise a set of closely related genes on chromosome 2q37.1. The widely expressed SP100 and the leukocyte-specific proteins SP110 and SP140 have been associated with transcriptional regulation and various human diseases. Here, we have characterized the SP100 family member SP140L. The genome sequence analysis showed the formation of SP140L gene through rearrangements of the two neighboring genes, SP100 and SP140, during the evolution of higher primates. The SP140L expression is interferon-inducible with high transcript levels in B cells and other peripheral blood mononuclear cells. Subcellularly, SP140L colocalizes with SP100 and SP140 in nuclear structures that are devoid of SP110, PML, or p300 proteins. Similarly to SP100 and SP140 protein, we detected serum autoantibodies to SP140L in patients with primary biliary cirrhosis using luciferase immunoprecipitation system and immunoblotting assays. In conclusion, our results show that SP140L is phylogenetically recent member of SP100 proteins and acts as an autoantigen in primary biliary cirrhosis patients.

  3. HSV-1 nucleocapsid egress mediated by UL31 in association with UL34 is impeded by cellular transmembrane protein 140

    Energy Technology Data Exchange (ETDEWEB)

    Guan, Ying [Department of Viral Immunology, Institute of Medical Biology, Chinese Academy of Medicine Science, Peking Union Medical College, Kunming 650118 (China); Yunnan Academy of Tobacco Science, Kunming, Yunnan 650106 (China); Guo, Lei; Yang, Erxia; Liao, Yun; Liu, Longding; Che, Yanchun; Zhang, Ying; Wang, Lichun; Wang, Jingjing [Department of Viral Immunology, Institute of Medical Biology, Chinese Academy of Medicine Science, Peking Union Medical College, Kunming 650118 (China); Li, Qihan, E-mail: imbcams.lq@gmail.com [Department of Viral Immunology, Institute of Medical Biology, Chinese Academy of Medicine Science, Peking Union Medical College, Kunming 650118 (China)

    2014-09-15

    During HSV-1 infection, the viral UL31 protein forms a complex with the UL34 protein at the cellular nuclear membrane, where both proteins play important roles in the envelopment of viral nucleocapsids and their egress into the cytoplasm. To characterize the mechanism of HSV-1 nucleocapsid egress, we screened host proteins to identify proteins that interacted with UL31 via yeast two-hybrid analysis. Transmembrane protein 140 (TMEM140), was identified and confirmed to bind to and co-localize with UL31 during viral infection. Further studies indicated that TMEM140 inhibits HSV-1 proliferation through selectively blocking viral nucleocapsid egress during the viral assembly process. The blockage function of TMEM140 is mediated by impeding the formation of the UL31–UL34 complex due to competitive binding to UL31. Collectively, these data suggest the essentiality of the UL31–UL34 interaction in the viral nucleocapsid egress process and provide a new anti-HSV-1 strategy in viral assembly process of nucleocapsid egress. - Highlights: • Cellular TMEM140 protein interacts with HSV-1 UL31 protein during viral infection. • Increasing expression of TMEM140 leads to inhibition of HSV-1 proliferation. • Increasing expression of TMEM140 blocks HSV-1 nucleocapsid egress process. • Binding to UL31 of TMEM140 impedes formation of HSV-1 UL31–UL34 complex.

  4. Investigation of two-phonon 1{sup -} states in {sup 40}Ca and {sup 140}Ce with the γ{sup 3} setup at HIγS

    Energy Technology Data Exchange (ETDEWEB)

    Wilhelmy, Julius; Derya, Vera; Endres, Janis; Hennig, Andreas; Zilges, Andreas [Institute for Nuclear Physics, University of Cologne (Germany); Loeher, Bastian; Savran, Deniz [ExtreMe Matter Institute EMMI and Research Division, GSI, Darmstadt (Germany); Frankfurt Institute for Advanced Studies FIAS, Frankfurt (Germany); Tornow, Werner [Department of Physics, Duke University (United States)

    2015-07-01

    The harmonic coupling of a quadrupole and an octupole vibrational excitation results in a quintuplet of J{sup π}=1{sup -} to 5{sup -} vibrational states at the sum of the constituent excitation energies. Their detailed γ-decay behavior can provide information about their structure. For {sup 40}Ca and {sup 140}Ce, possible two-phonon E1 excitations were studied with the high-efficiency γ{sup 3} setup at the High Intensity γ-ray Source facility at TUNL in Durham, USA. The γ{sup 3} setup consists of an array of HPGe and LaBr{sub 3} detectors with high efficiency and enables the measurement of γ-γ coincidences. The determination of the B(E2; 1{sub 1}{sup -} → 3{sub 1}{sup -}) value was possible showing a dominant two-phonon character of the 1{sup -}{sub 1} state in {sup 40}Ca. For the same decay in {sup 140}Ce, an upper limit for the reduced transition probability can be given and an unexpected E1 decay to the 0{sub 2}{sup +} state was observed. The experimental results are presented and discussed with regard to systematics and theoretical predictions.

  5. 44 CFR 19.140 - Dissemination of policy.

    Science.gov (United States)

    2010-10-01

    ... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 19.140 Dissemination of policy. (a... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Dissemination of policy. 19.140 Section 19.140 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT...

  6. 17 CFR 149.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Employment. 149.140 Section... COMMISSION § 149.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  7. 38 CFR 15.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Employment. 15.140... § 15.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under any program or activity conducted by the agency. The...

  8. 31 CFR 17.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Employment. 17.140 Section 17.140... Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the Department. The definitions...

  9. 13 CFR 136.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 136.140 Section 136....140 Employment. (a) No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program, or activity conducted by the Agency. (b) The...

  10. 2010 E-Government Act Report

    Data.gov (United States)

    Department of Veterans Affairs — This report describes VA’s accomplishments inimplementing the requirements of the E-Government Act of 2002, Section 202(g)and the Open Government Directive dated...

  11. 44 CFR 16.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Employment. 16.140 Section 16... CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under any program or...

  12. 17 CFR 270.22e-1 - Exemption from section 22(e) of the Act during annuity payment period of variable annuity...

    Science.gov (United States)

    2010-04-01

    ...) of the Act during annuity payment period of variable annuity contracts participating in certain... from section 22(e) of the Act during annuity payment period of variable annuity contracts participating... payment period of variable annuity contracts participating in such account, be exempt from the provisions...

  13. DPL-1 DP, LIN-35 Rb and EFL-1 E2F act with the MCD-1 zinc-finger protein to promote programmed cell death in Caenorhabditis elegans.

    Science.gov (United States)

    Reddien, Peter W; Andersen, Erik C; Huang, Michael C; Horvitz, H Robert

    2007-04-01

    The genes egl-1, ced-9, ced-4, and ced-3 play major roles in programmed cell death in Caenorhabditis elegans. To identify genes that have more subtle activities, we sought mutations that confer strong cell-death defects in a genetically sensitized mutant background. Specifically, we screened for mutations that enhance the cell-death defects caused by a partial loss-of-function allele of the ced-3 caspase gene. We identified mutations in two genes not previously known to affect cell death, dpl-1 and mcd-1 (modifier of cell death). dpl-1 encodes the C. elegans homolog of DP, the human E2F-heterodimerization partner. By testing genes known to interact with dpl-1, we identified roles in cell death for four additional genes: efl-1 E2F, lin-35 Rb, lin-37 Mip40, and lin-52 dLin52. mcd-1 encodes a novel protein that contains one zinc finger and that is synthetically required with lin-35 Rb for animal viability. dpl-1 and mcd-1 act with efl-1 E2F and lin-35 Rb to promote programmed cell death and do so by regulating the killing process rather than by affecting the decision between survival and death. We propose that the DPL-1 DP, MCD-1 zinc finger, EFL-1 E2F, LIN-35 Rb, LIN-37 Mip40, and LIN-52 dLin52 proteins act together in transcriptional regulation to promote programmed cell death.

  14. 33 CFR 118.140 - Painting bridge piers.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Painting bridge piers. 118.140 Section 118.140 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES BRIDGE LIGHTING AND OTHER SIGNALS § 118.140 Painting bridge piers. The District Commander may require...

  15. Socioeconomic Status Accounts for Rapidly Increasing Geographic Variation in the Incidence of Poor Fetal Growth

    Science.gov (United States)

    Ball, Stephen J.; Jacoby, Peter; Zubrick, Stephen R.

    2013-01-01

    Fetal growth is an important risk factor for infant morbidity and mortality. In turn, socioeconomic status is a key predictor of fetal growth; however, other sociodemographic factors and environmental effects may also be important. This study modelled geographic variation in poor fetal growth after accounting for socioeconomic status, with a fixed effect for socioeconomic status and a combination of spatially-correlated and spatially-uncorrelated random effects. The dataset comprised 88,246 liveborn singletons, aggregated within suburbs in Perth, Western Australia. Low socioeconomic status was strongly associated with an increased risk of poor fetal growth. An increase in geographic variation of poor fetal growth from 1999–2001 (interquartile odds ratio among suburbs = 1.20) to 2004–2006 (interquartile odds ratio = 1.40) indicated a widening risk disparity by socioeconomic status. Low levels of residual spatial patterns strengthen the case for targeting policies and practices in areas of low socioeconomic status for improved outcomes. This study indicates an alarming increase in geographic inequalities in poor fetal growth in Perth which warrants further research into the specific aspects of socioeconomic status that act as risk factors. PMID:23799513

  16. Incorporating population viability models into species status assessment and listing decisions under the U.S. Endangered Species Act

    Directory of Open Access Journals (Sweden)

    Conor P. McGowan

    2017-10-01

    Full Text Available Assessment of a species' status is a key part of management decision making for endangered and threatened species under the U.S. Endangered Species Act. Predicting the future state of the species is an essential part of species status assessment, and projection models can play an important role in developing predictions. We built a stochastic simulation model that incorporated parametric and environmental uncertainty to predict the probable future status of the Sonoran desert tortoise in the southwestern United States and North Central Mexico. Sonoran desert tortoise was a Candidate species for listing under the Endangered Species Act, and decision makers wanted to use model predictions in their decision making process. The model accounted for future habitat loss and possible effects of climate change induced droughts to predict future population growth rates, abundances, and quasi-extinction probabilities. Our model predicts that the population will likely decline over the next few decades, but there is very low probability of quasi-extinction less than 75 years into the future. Increases in drought frequency and intensity may increase extinction risk for the species. Our model helped decision makers predict and characterize uncertainty about the future status of the species in their listing decision. We incorporated complex ecological processes (e.g., climate change effects on tortoises in transparent and explicit ways tailored to support decision making processes related to endangered species.

  17. Incorporating population viability models into species status assessment and listing decisions under the U.S. Endangered Species Act

    Science.gov (United States)

    McGowan, Conor P.; Allan, Nathan; Servoss, Jeff; Hedwall, Shaula J.; Wooldridge, Brian

    2017-01-01

    Assessment of a species' status is a key part of management decision making for endangered and threatened species under the U.S. Endangered Species Act. Predicting the future state of the species is an essential part of species status assessment, and projection models can play an important role in developing predictions. We built a stochastic simulation model that incorporated parametric and environmental uncertainty to predict the probable future status of the Sonoran desert tortoise in the southwestern United States and North Central Mexico. Sonoran desert tortoise was a Candidate species for listing under the Endangered Species Act, and decision makers wanted to use model predictions in their decision making process. The model accounted for future habitat loss and possible effects of climate change induced droughts to predict future population growth rates, abundances, and quasi-extinction probabilities. Our model predicts that the population will likely decline over the next few decades, but there is very low probability of quasi-extinction less than 75 years into the future. Increases in drought frequency and intensity may increase extinction risk for the species. Our model helped decision makers predict and characterize uncertainty about the future status of the species in their listing decision. We incorporated complex ecological processes (e.g., climate change effects on tortoises) in transparent and explicit ways tailored to support decision making processes related to endangered species.

  18. Monomeric Aβ(1-40) and Aβ(1-42) Peptides in Solution Adopt Very Similar Ramachandran Map Distributions That Closely Resemble Random Coil.

    Science.gov (United States)

    Roche, Julien; Shen, Yang; Lee, Jung Ho; Ying, Jinfa; Bax, Ad

    2016-02-09

    The pathogenesis of Alzheimer's disease is characterized by the aggregation and fibrillation of amyloid peptides Aβ(1-40) and Aβ(1-42) into amyloid plaques. Despite strong potential therapeutic interest, the structural pathways associated with the conversion of monomeric Aβ peptides into oligomeric species remain largely unknown. In particular, the higher aggregation propensity and associated toxicity of Aβ(1-42) compared to that of Aβ(1-40) are poorly understood. To explore in detail the structural propensity of the monomeric Aβ(1-40) and Aβ(1-42) peptides in solution, we recorded a large set of nuclear magnetic resonance (NMR) parameters, including chemical shifts, nuclear Overhauser effects (NOEs), and J couplings. Systematic comparisons show that at neutral pH the Aβ(1-40) and Aβ(1-42) peptides populate almost indistinguishable coil-like conformations. Nuclear Overhauser effect spectra collected at very high resolution remove assignment ambiguities and show no long-range NOE contacts. Six sets of backbone J couplings ((3)JHNHα, (3)JC'C', (3)JC'Hα, (1)JHαCα, (2)JNCα, and (1)JNCα) recorded for Aβ(1-40) were used as input for the recently developed MERA Ramachandran map analysis, yielding residue-specific backbone ϕ/ψ torsion angle distributions that closely resemble random coil distributions, the absence of a significantly elevated propensity for β-conformations in the C-terminal region of the peptide, and a small but distinct propensity for αL at K28. Our results suggest that the self-association of Aβ peptides into toxic oligomers is not driven by elevated propensities of the monomeric species to adopt β-strand-like conformations. Instead, the accelerated disappearance of Aβ NMR signals in D2O over H2O, particularly pronounced for Aβ(1-42), suggests that intermolecular interactions between the hydrophobic regions of the peptide dominate the aggregation process.

  19. 23 CFR 140.609 - Progress and final vouchers.

    Science.gov (United States)

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Progress and final vouchers. 140.609 Section 140.609 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION PAYMENT PROCEDURES REIMBURSEMENT Reimbursement for Bond Issue Projects § 140.609 Progress and final vouchers. (a) Progress vouchers may be...

  20. 40 CFR 45.140 - Budget and project period.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Budget and project period. 45.140 Section 45.140 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE TRAINING ASSISTANCE § 45.140 Budget and project period. The budget and project periods for...

  1. The transcriptional co-factor RIP140 regulates mammary gland development by promoting the generation of key mitogenic signals.

    Science.gov (United States)

    Nautiyal, Jaya; Steel, Jennifer H; Mane, Meritxell Rosell; Oduwole, Olayiwola; Poliandri, Ariel; Alexi, Xanthippi; Wood, Nicholas; Poutanen, Matti; Zwart, Wilbert; Stingl, John; Parker, Malcolm G

    2013-03-01

    Nuclear receptor interacting protein (Nrip1), also known as RIP140, is a co-regulator for nuclear receptors that plays an essential role in ovulation by regulating the expression of the epidermal growth factor-like family of growth factors. Although several studies indicate a role for RIP140 in breast cancer, its role in the development of the mammary gland is unclear. By using RIP140-null and RIP140 transgenic mice, we demonstrate that RIP140 is an essential factor for normal mammary gland development and that it functions by mediating oestrogen signalling. RIP140-null mice exhibit minimal ductal elongation with no side-branching, whereas RIP140-overexpressing mice show increased cell proliferation and ductal branching with age. Tissue recombination experiments demonstrate that RIP140 expression is required in both the mammary epithelial and stromal compartments for ductal elongation during puberty and that loss of RIP140 leads to a catastrophic loss of the mammary epithelium, whereas RIP140 overexpression augments the mammary basal cell population and shifts the progenitor/differentiated cell balance within the luminal cell compartment towards the progenitors. For the first time, we present a genome-wide global view of oestrogen receptor-α (ERα) binding events in the developing mammary gland, which unravels 881 ERα binding sites. Unbiased evaluation of several ERα binding sites for RIP140 co-occupancy reveals selectivity and demonstrates that RIP140 acts as a co-regulator with ERα to regulate directly the expression of amphiregulin (Areg), the progesterone receptor (Pgr) and signal transducer and activator of transcription 5a (Stat5a), factors that influence key mitogenic pathways that regulate normal mammary gland development.

  2. Mod 1 ICS TI Report: ICS Conversion of a 140% HPGe Detector

    Energy Technology Data Exchange (ETDEWEB)

    Bounds, John Alan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-07-05

    This report evaluates the Mod 1 ICS, an electrically cooled 140% HPGe detector. It is a custom version of the ORTEC Integrated Cooling System (ICS) modified to make it more practical for us to use in the field. Performance and operating characteristics of the Mod 1 ICS are documented, noting both pros and cons. The Mod 1 ICS is deemed a success. Recommendations for a Mod 2 ICS, a true field prototype, are provided.

  3. 41 CFR 51-10.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Employment. 51-10.140... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity...

  4. Design and operation of 140 GHz gyrotron oscillators for power levels up to 1 MW CW

    Energy Technology Data Exchange (ETDEWEB)

    Jory, H.; Bier, R.; Craig, L.J.; Felch, K.; Ives, L.; Lopez, N.; Spang, S.

    1986-12-01

    Varian has designed and tested 140 GHz gyrotron oscillators that have generated output powers of 100 kW CW and 200 kW for 1 ms pulses. Upcoming tubes will be designed to operate at power levels of 200 kW CW and ultimately up to 1 MW CW. The important design considerations which are addressed in the higher power tubes include the design of the electron gun, interaction circuit, and output window. These issues will be discussed and the results of the earlier 140 GHz gyrotron work at Varian will be summarized.

  5. Design and operation of 140 GHz gyrotron oscillators for power levels up to 1 MW CW

    International Nuclear Information System (INIS)

    Jory, H.; Bier, R.; Craig, L.J.; Felch, K.; Ives, L.; Lopez, N.; Spang, S.

    1986-12-01

    Varian has designed and tested 140 GHz gyrotron oscillators that have generated output powers of 100 kW CW and 200 kW for 1 ms pulses. Upcoming tubes will be designed to operate at power levels of 200 kW CW and ultimately up to 1 MW CW. The important design considerations which are addressed in the higher power tubes include the design of the electron gun, interaction circuit, and output window. These issues will be discussed and the results of the earlier 140 GHz gyrotron work at Varian will be summarized

  6. microRNA-140 Inhibits Inflammation and Stimulates Chondrogenesis in a Model of Interleukin 1β-induced Osteoarthritis

    Directory of Open Access Journals (Sweden)

    Tommy A Karlsen

    2016-01-01

    Full Text Available Osteoarthritis is a serious disease of articular cartilage. The pathogenic factors contributing to this disorder are inflammation, extracellular matrix degradation and failure to rebuild the articular cartilage. Preclinical studies suggest that microRNA-140 may play a protective role in osteoarthritis development, but little is known about the mechanism by which this occurs. Here we present the results of forced expression of microRNA-140 in an in vitro model of osteoarthritis, evaluated by global proteomics analysis. We show that inflammation was reduced through the altered levels of multiple proteins involved in the nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 pathway. microRNA-140 upregulated many of the components involved in the synthesis of hyaline extracellular matrix and reduced the levels of aggrecanases and syndecan 4, thus potentially both increasing cartilage repair and reducing cartilage breakdown. These results show how forced expression of microRNA-140 is likely to counteract all three pathogenic processes, and support the idea that intra-articular injection of microRNA-140 may benefit patients suffering from early osteoarthritis.

  7. 46 CFR 133.140 - Stowage of rescue boats.

    Science.gov (United States)

    2010-10-01

    ... SYSTEMS Requirements for All OSVs § 133.140 Stowage of rescue boats. (a) Rescue boats must be stowed as follows: (1) Each rescue boat must be ready for launching in not more than 5 minutes. (2) Each rescue boat... 46 Shipping 4 2010-10-01 2010-10-01 false Stowage of rescue boats. 133.140 Section 133.140...

  8. 7 CFR 35.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Act. 35.1 Section 35.1 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices... Definitions § 35.1 Act. Act or Export Grape and Plum Act means “An Act to promote the foreign trade of the...

  9. Activation of the endoplasmic reticulum stress response by the amyloid-beta 1-40 peptide in brain endothelial cells.

    Science.gov (United States)

    Fonseca, Ana Catarina R G; Ferreiro, Elisabete; Oliveira, Catarina R; Cardoso, Sandra M; Pereira, Cláudia F

    2013-12-01

    Neurovascular dysfunction arising from endothelial cell damage is an early pathogenic event that contributes to the neurodegenerative process occurring in Alzheimer's disease (AD). Since the mechanisms underlying endothelial dysfunction are not fully elucidated, this study was aimed to explore the hypothesis that brain endothelial cell death is induced upon the sustained activation of the endoplasmic reticulum (ER) stress response by amyloid-beta (Aβ) peptide, which deposits in the cerebral vessels in many AD patients and transgenic mice. Incubation of rat brain endothelial cells (RBE4 cell line) with Aβ1-40 increased the levels of several markers of ER stress-induced unfolded protein response (UPR), in a time-dependent manner, and affected the Ca(2+) homeostasis due to the release of Ca(2+) from this intracellular store. Finally, Aβ1-40 was shown to activate both mitochondria-dependent and -independent apoptotic cell death pathways. Enhanced release of cytochrome c from mitochondria and activation of the downstream caspase-9 were observed in cells treated with Aβ1-40 concomitantly with caspase-12 activation. Furthermore, Aβ1-40 activated the apoptosis effectors' caspase-3 and promoted the translocation of apoptosis-inducing factor (AIF) to the nucleus demonstrating the involvement of caspase-dependent and -independent mechanisms during Aβ-induced endothelial cell death. In conclusion, our data demonstrate that ER stress plays a significant role in Aβ1-40-induced apoptotic cell death in brain endothelial cells suggesting that ER stress-targeted therapeutic strategies might be useful in AD to counteract vascular defects and ultimately neurodegeneration. © 2013.

  10. 7 CFR 930.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Act. 930.1 Section 930.1 Agriculture Regulations of... Definitions § 930.1 Act. Act means Public Act No. 10, 73d Congress (May 12, 1933), as amended, and as reenacted and amended by the Agricultural Marketing Agreement Act of 1937, as amended (48 Stat. 31, as...

  11. Viscosity Measurements and Correlations for 1,1,1,2-tetrafluoroethane (HFC-134a) up to 140 MPa

    DEFF Research Database (Denmark)

    Comuñas, M.J.P.; Baylaucq, A.; Cisneros, Sergio

    2003-01-01

    In spite of being one of the most studied refrigerants, large discrepancies in the experimental determination of the dynamic viscosity of 1, 1, 1,2-tetrafluoroethane (HFC-134a) prevail. Additionally, there is a need for supplementary high-pressure measurements that can help to derive sound general...... correlations for the viscosity of this compound. Hence, in this work new dynamic viscosity measurements for HFC-134a using a falling-body viscometer in the temperature range of 293.15-373.15 K and pressures up to 140 MPa are presented. This work high-pressure data in combination with already published data...

  12. Crosstalk between oral and general health status in e-smokers.

    Science.gov (United States)

    Tatullo, Marco; Gentile, Stefano; Paduano, Francesco; Santacroce, Luigi; Marrelli, Massimo

    2016-12-01

    Electronic cigarette (e-cigarette) simulates the act of tobacco smoking by vaporizing a mixture of propylene glycol, nicotine, and flavoring agents. e-cigarette has been proposed as a product able to aid to stop smoking. The aim of the study is to verify the clinical variations of periodontal health induced by e-cigarettes use and, moreover, to investigate about the awareness of the e-smokers about their health variations and about their hypothetical need to turn back to smoke combustible cigarettes.This clinical observational pilot study involved 110 out of 350 smokers, who switched to e-cigarette. Patients were subjected to oral examinations. A questionnaire to self-assess the variations of some parameters of general health, and to self-assess the need to smoke combustible cigarettes, was distributed to such subjects involved in the study.At the end of the study, we registered a progressive improvement in the periodontal indexes, as well as in the general health perception. Finally, many patients reported an interesting reduction in the need to smoke.In the light of this pilot study, the e-cigarette can be considered as a valuable alternative to tobacco cigarettes, but with a positive impact on periodontal and general health status.

  13. 34 CFR 5.1 - Act.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Act. 5.1 Section 5.1 Education Office of the Secretary...-10) Definitions § 5.1 Act. As used in this part, Act means section 552 of title 5, United States Code, as amended by Pub. L. 90-23, codifying the Act of July 4, 1966, sometimes referred to as the “Freedom...

  14. [CII] dynamics in the S140 region

    International Nuclear Information System (INIS)

    Dedes, C.; Röllig, M.; Okada, Y.; Ossenkopf, V.; Mookerjea, B.

    2015-01-01

    We report the observation of [C II] emission in a cut through the S140 region together with single pointing observations of several molecular tracers, including hydrides, in key regions of the photon-dominated region (PDR) and molecular cloud [1]. At a distance of 910 pc, a BOV star ionizes the edge of the molecular cloud L1204, creating S140. In addition, the dense molecular cloud hosts a cluster of embedded massive young stellar objects only 75' from the H II region [e.g. 2, 3]. We used HIFI on Herschel to observe [CII] in a strip following the direction of the impinging radiation across the ionisation front and through the cluster of embedded YSOs. With [C II], we can trace the ionising radiation and, together with the molecular tracers such as CO isotopologues and HCO + , study the dynamical processes in the region. Combining HIFIs high spectral resolution data with ground based molecular data allows us to study the dynamics and excitation conditions both in the ionization front and the dense molecular star forming region and model their physical conditions [4

  15. 9 CFR 3.140 - Care in transit.

    Science.gov (United States)

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Care in transit. 3.140 Section 3.140 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL...

  16. 31 CFR 28.140 - Dissemination of policy.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Dissemination of policy. 28.140 Section 28.140 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON... elementary and secondary school students, employees, sources of referral of applicants for admission and...

  17. 7 CFR 1221.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1221.1 Section 1221.1 Agriculture Regulations of... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Definitions § 1221.1 Act. Act means the Commodity Promotion, Research, and Information Act of 1996 (7 U.S.C. 7411-7425), and any amendments thereto. ...

  18. 7 CFR 1218.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1218.1 Section 1218.1 Agriculture Regulations of... INFORMATION ORDER Blueberry Promotion, Research, and Information Order Definitions § 1218.1 Act. Act means the Commodity Promotion, Research, and Information Act of 1996 (7 U.S.C. 7401-7425; Pub. L. 104-127; 110 Stat...

  19. 7 CFR 1216.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1216.1 Section 1216.1 Agriculture Regulations of... ORDER Peanut Promotion, Research, and Information Order Definitions § 1216.1 Act. Act means the Commodity Promotion, Research, and Information Act of 1996 (7 U.S.C. 7401-7425; Public Law 104-127, 110 Stat...

  20. 7 CFR 1206.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1206.1 Section 1206.1 Agriculture Regulations of... Mango Promotion, Research, and Information Order Definitions § 1206.1 Act. Act means the Commodity Promotion, Research, and Information Act of 1996 (7 U.S.C. 7411-7425; Public Law 104-127; 110 Stat. 1029...

  1. 7 CFR 1212.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1212.1 Section 1212.1 Agriculture Regulations of..., Consumer Education, and Industry Information Order Definitions § 1212.1 Act. “Act” means the Commodity Promotion, Research, and Information Act of 1996, (7 U.S.C. 7411-7425), and any amendments to that Act. ...

  2. 7 CFR 1219.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1219.1 Section 1219.1 Agriculture Regulations of... INFORMATION Hass Avocado Promotion, Research, and Information Order Definitions § 1219.1 Act. Act means the Hass Avocado Promotion, Research, and Information Act of 2000, Public Law 106-387, 7 U.S.C. 7801-7813...

  3. South Pacific Nuclear Free Zone Treaty Act 1986 - No. 140 of 1986

    International Nuclear Information System (INIS)

    1986-01-01

    The purpose of this Act is to give effect to Australia's obligations as a Party to the South Pacific Nuclear Free Zone Treaty of 6 August 1985. The Act is supplemented by the provisions of the Environment Protection (Sea Dumping) Act 1981 as amended in 1986 as regards dumping of radioactive material into the sea. The Act repeats the substantive provisions of the Treaty and lays down prohibitions in relation to nuclear explosive devices. (NEA) [fr

  4. 22 CFR 140.5 - Overview.

    Science.gov (United States)

    2010-04-01

    ...). Section 140.7 establishes the procedures applicable to multilateral institutions and international organizations. Section 140.8 establishes the procedures applicable to recipients of scholarships and fellowships and participant trainees. Section 140.9 establishes the procedures applicable to non-governmental...

  5. Segmentation and Contrasting Magma Supply Along the South-East Indian Ridge, 130°E to 140°E: Results of the STORM Cruise

    Science.gov (United States)

    Briais, A.; Ruellan, E.; Maia, M.; Hemond, C.; Hanan, B. B.; Ceuleneer, G.; Graham, D. W.; Park, S. H.

    2017-12-01

    We present observations of the South-East Indian Ridge (SEIR) between 130°E to 140°E, mostly collected during the STORM cruise (South Tasmania Ocean Ridge and Mantle) on the N/O L'Atalante. The SEIR displays large variations of axial depth despite an almost constant intermediate full spreading rate of 75 km/m.y. In the study area the analysis of multibeam bathymetry maps shows that the axis displays a rise morphology to the east away from the discontinuities, and a rifted high morphology in the west and near the OSCs, as often observed along intermediate-spreading mid-ocean ridges. The ridge axis is offset by 27 km at 131°E and 20 km at 135°E by two large-offset overlapping spreading centers (OSCs) propagating westward, and by a smaller OSC at 137°17'E. These OSCs define four second-order ridge segments (A2 to A5 from west to east). We observe a general shallowing of the ridge axis from 3100 m depth in the west to 2400 m depth in the east, and a prominent deepening of the axis near the large OSCs. The easternmost segment A5 shows a very shallow axial ridge suggesting a robust magma supply despite its proximity to the George V transform fault (140°E). Major element variations in basalt glasses are systematically related to morphotectonic segmentation of the ridge axis, showing contrasts in crystal fractionation from one segment to another that may relate to differences in replenishment of axial melt lenses by primitive melts. Along segment A5, crystallization increases with proximity to the George V transform fault, consistent with an expected cold edge effect. In contrast, along segment A3 the extent of crystallization increases progressively from east to west in the direction of ridge propagation. *STORM Cruise Scientific Party: F. Barrere, C. Boulart, A. Briais, D. Brunelli, G. Ceuleneer, N. Ferreira, D. Graham, B. Hanan, C. Hémond, S. Macleod, M. Maia, A. Maillard, S. Merkuryev, S.H. Park, S. Révillon, E. Ruellan, A. Schohn, S. Watson, and Y.S. Yang.

  6. Helicobacter pylori seropositivity's association with markers of iron, 1-carbon metabolism, and antioxidant status among US adults: a structural equations modeling approach.

    Directory of Open Access Journals (Sweden)

    May A Beydoun

    Full Text Available We tested a model in which Helicobacter pylori seropositivity (Hps predicted iron status, which in turn acted as a predictor for markers of 1-C metabolism that were then allowed to predict antioxidant status.National Health and Nutrition Examination Surveys (NHANES 1999-2000 cross-sectional data among adults aged 20-85 y were analyzed (n = 3,055. Markers of Hps, iron status (serum ferritin and transferrin saturation (TS; 1-C metabolism (serum folate (FOLserum, B-12, total homocysteine (tHcy, methylmalonic acid (MMA and antioxidant status (vitamins A and E were entered into a structural equations model (SEM.Predictors of Hps included older age, lower education and income, racial/ethnic groups (lowest among Non-Hispanic Whites, and lifetime cigarette smoking. SEM modeling indicated that Hps had a direct inverse relationship with iron status (combining serum ferritin and TS which in turn was positively related to 1-C metabolites (higher serum folate, B-12 or lower tHcy/MMA that were positively associated with antioxidant status (combining serum vitamins A and E. Another pathway that was found bypassed 1-C metabolites (Hps → Iron_st → Antiox. The sum of all indirect effects from Hps combining both pathways and the other indirect pathways in the model (Hps → Iron_st → OneCarbon; Hps →OneCarbon →Antiox was estimated at β = -0.006±0.003, p<0.05.In sum, of the total effect of H. pylori seropositivity on antioxidant status, two significant indirect pathways through Iron status and 1-Carbon metabolites were found. Randomized controlled trials should be conducted to uncover the concomitant causal effect of H. pylori eradication on improving iron status, folate, B-12 and antioxidant status among H. pylori seropositive individuals.

  7. Present status of an integrated software system for HASP (Human Acts Simulation Program)

    International Nuclear Information System (INIS)

    Otani, Takayuki; Ebihara, Ken-ichi; Kambayashi, Shaw; Kume, Etsuo; Higuchi, Kenji; Fujii, Minoru; Akimoto, Masayuki

    1994-01-01

    In Human Acts Simulation Program (HASP), human acts to be realized by a human-shaped intelligent robot in a nuclear power plant are simulated by computers. The major purpose of HASP is to develop basic and underlying design technologies for intelligent and automatic power plant. The objectives of this paper is to show the present status of the HASP, with particular emphasis on activities targetted at the integration of developed subsystems to simulate the important capabilities of the intelligent robot such as planning, robot dynamics, and so on. (author)

  8. 10 CFR 140.5 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Communications. 140.5 Section 140.5 Energy NUCLEAR... Provisions § 140.5 Communications. Except where otherwise specified, all communications and reports... Reactors, Director, Office of Federal and State Materials and Environmental Management Programs, or...

  9. 5 CFR 2416.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Employment. 2416.140 Section 2416.140....140 Employment. No qualified individual with disabilities shall, on the basis of disability, be subject to discrimination in employment under any program or activity conducted by the agency. The...

  10. 49 CFR 1014.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Employment. 1014.140 Section 1014.140... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE SURFACE TRANSPORTATION BOARD § 1014.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  11. 45 CFR 1214.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Employment. 1214.140 Section 1214.140 Public....140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  12. 5 CFR 1850.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Employment. 1850.140 Section 1850.140... PROGRAMS OR ACTIVITIES CONDUCTED BY THE OFFICE OF SPECIAL COUNSEL § 1850.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under...

  13. 45 CFR 1175.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Employment. 1175.140 Section 1175.140 Public... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL ENDOWMENT FOR THE HUMANITIES § 1175.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  14. 49 CFR 807.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Employment. 807.140 Section 807.140 Transportation... TRANSPORTATION SAFETY BOARD § 807.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency...

  15. 34 CFR 1200.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Employment. 1200.140 Section 1200.140 Education... COUNCIL ON DISABILITY § 1200.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the...

  16. 5 CFR 723.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Employment. 723.140 Section 723.140... PERSONNEL MANAGEMENT § 723.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under any program or activity conducted by the agency...

  17. 22 CFR 1005.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 1005.140 Section 1005.140 Foreign... ACTIVITIES CONDUCTED BY THE INTER-AMERICAN FOUNDATION § 1005.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  18. 45 CFR 2104.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Employment. 2104.140 Section 2104.140 Public....140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

  19. 5 CFR 1636.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Employment. 1636.140 Section 1636.140... § 1636.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  20. 50 CFR 550.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Employment. 550.140 Section 550.140... IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  1. 45 CFR 1706.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Employment. 1706.140 Section 1706.140 Public... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  2. 29 CFR 2205.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Employment. 2205.140 Section 2205.140 Labor Regulations... REVIEW COMMISSION § 2205.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency...

  3. 45 CFR 2490.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Employment. 2490.140 Section 2490.140 Public... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity...

  4. 22 CFR 1701.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 1701.140 Section 1701.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE UNITED STATES INSTITUTE OF PEACE § 1701.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...

  5. 22 CFR 1103.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 1103.140 Section 1103.140 Foreign... BOUNDARY AND WATER COMMISSION, UNITED STATES AND MEXICO, UNITED STATES SECTION § 1103.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  6. 22 CFR 1510.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 1510.140 Section 1510.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE AFRICAN DEVELOPMENT FOUNDATION § 1510.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under...

  7. 46 CFR 507.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 9 2010-10-01 2010-10-01 false Employment. 507.140 Section 507.140 Shipping FEDERAL... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE FEDERAL MARITIME COMMISSION § 507.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  8. 29 CFR 4907.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Employment. 4907.140 Section 4907.140 Labor Regulations... THE PENSION BENEFIT GUARANTY CORPORATION § 4907.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity...

  9. 29 CFR 2706.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Employment. 2706.140 Section 2706.140 Labor Regulations... REVIEW COMMISSION § 2706.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency...

  10. STX140, but not paclitaxel, inhibits mammary tumour initiation and progression in C3(1/SV40 T/t-antigen transgenic mice.

    Directory of Open Access Journals (Sweden)

    Florence Meyer-Losic

    Full Text Available Despite paclitxael's clinical success, treating hormone-refractory breast cancer remains challenging. Paclitaxel has a poor pharmacological profile, characterized by a low therapeutic index (TIX caused by severe dose limiting toxicities, such as neutropenia and peripheral neuropathy. Consequently, new drugs are urgently required. STX140, a compound previously shown to have excellent efficacy against many tumors, is here compared to paclitaxel in three translational in vivo breast cancer models, a rat model of peripheral neuropathy, and through pharmacological testing. Three different in vivo mouse models of breast cancer were used; the metastatic 4T1 orthotopic model, the C3(1/SV40 T-Ag model, and the MDA-MB-231 xenograft model. To determine TIX and pharmacological profile of STX140, a comprehensive dosing regime was performed in mice bearing MDA-MD-231 xenografts. Finally, peripheral neuropathy was examined using a rat plantar thermal hyperalgesia model. In the 4T1 metastatic model, STX140 and paclitaxel significantly inhibited primary tumor growth and lung metastases. All C3(1/SV40 T-Ag mice in the control and paclitaxel treated groups developed palpable mammary cancer. STX140 blocked 47% of tumors developing and significantly inhibited growth of tumors that did develop. STX140 treatment caused a significant (P<0.001 survival advantage for animals in early and late intervention groups. Conversely, in C3(1/SV40 T-Ag mice, paclitaxel failed to inhibit tumor growth and did not increase survival time. Furthermore, paclitaxel, but not STX140, induced significant peripheral neuropathy and neutropenia. These results show that STX140 has a greater anti-cancer efficacy, TIX, and reduced neurotoxicity compared to paclitaxel in C3(1/SV40 T-Ag mice and therefore may be of significant benefit to patients with breast cancer.

  11. [CII] dynamics in the S140 region

    Energy Technology Data Exchange (ETDEWEB)

    Dedes, C. [ETH Zurich, Institute for Astronomy, Zurich (Switzerland); Röllig, M.; Okada, Y.; Ossenkopf, V. [1. Physikalisches Institut Universität Köln (Germany); Mookerjea, B. [Tata Institute of Fundamental Research, Mumbai (India); Collaboration: WADI Team

    2015-01-22

    We report the observation of [C II] emission in a cut through the S140 region together with single pointing observations of several molecular tracers, including hydrides, in key regions of the photon-dominated region (PDR) and molecular cloud [1]. At a distance of 910 pc, a BOV star ionizes the edge of the molecular cloud L1204, creating S140. In addition, the dense molecular cloud hosts a cluster of embedded massive young stellar objects only 75' from the H II region [e.g. 2, 3]. We used HIFI on Herschel to observe [CII] in a strip following the direction of the impinging radiation across the ionisation front and through the cluster of embedded YSOs. With [C II], we can trace the ionising radiation and, together with the molecular tracers such as CO isotopologues and HCO{sup +}, study the dynamical processes in the region. Combining HIFIs high spectral resolution data with ground based molecular data allows us to study the dynamics and excitation conditions both in the ionization front and the dense molecular star forming region and model their physical conditions [4].

  12. 45 CFR 2301.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false Employment. 2301.140 Section 2301.140 Public... COMMISSION § 2301.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  13. 22 CFR 711.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 711.140 Section 711.140 Foreign... CORPORATION § 711.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under any program or activity conducted by the agency. The...

  14. 45 CFR 1153.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Employment. 1153.140 Section 1153.140 Public... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL ENDOWMENT FOR THE ARTS § 1153.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  15. 19 CFR 201.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Employment. 201.140 Section 201.140 Customs Duties... Commission § 201.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  16. 22 CFR 530.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 530.140 Section 530.140 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...

  17. 25 CFR 720.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Employment. 720.140 Section 720.140 Indians THE OFFICE OF... OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment...

  18. 10 CFR 1041.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Employment. 1041.140 Section 1041.140 Energy DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE DEPARTMENT OF ENERGY § 1041.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity...

  19. 7 CFR 33.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices... AUTHORITY OF THE EXPORT APPLE ACT Definitions § 33.1 Act. Act and Export Apple Act are synonymous and mean “An act to promote the foreign trade of the United States in apples to protect the reputation of...

  20. 42 CFR 457.140 - Budget.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Budget. 457.140 Section 457.140 Public Health... Child Health Insurance Programs and Outreach Strategies § 457.140 Budget. The State plan, or plan amendment that has a significant impact on the approved budget, must include a budget that describes the...

  1. 12 CFR 410.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Employment. 410.140 Section 410.140 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.140 Employment...

  2. miR-140-5p regulates hypoxia-mediated human pulmonary artery smooth muscle cell proliferation, apoptosis and differentiation by targeting Dnmt1 and promoting SOD2 expression

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yanwei; Xu, Jing, E-mail: xujingdoc@163.com

    2016-04-22

    miR-140-5p is down-regulated in patients with pulmonary arterial hypertension (PAH) and experimental models of PAH, and inhibits hypoxia-mediated pulmonary artery smooth muscle cell (PASMC) proliferation in vitro. Delivery of synthetic miR-140-5p prevents and treats established, experimental PAH. DNA methyltransferase 1 (Dnmt1) is up-regulated in PAH associated human PASMCs (HPASMCs), which promotes the development of PAH by hypermethylation of CpG islands within the promoter for superoxide dismutase 2 (SOD2) and down-regulating SOD2 expression. We searched for miR-140-5p targets using TargetScan, PicTar and MiRanda tools, and found that Dnmt1 is a potential target of miR-140-5p. Based on these findings, we speculated that miR-140-5p might target Dnmt1 and regulate SOD2 expression to regulate hypoxia-mediated HPASMC proliferation, apoptosis and differentiation. We detected the expression of miR-140-5p, Dnmt1 and SOD2 by quantitative real-time polymerase chain reaction (qRT-PCR) and western blot assays, respectively, and found down-regulation of miR-140-5p and SOD2 and up-regulation of Dnmt1 exist in PAH tissues and hypoxia-mediated HPASMCs. Cell proliferation, apoptosis and differentiation detection showed that miR-140-5p inhibits proliferation and promotes apoptosis and differentiation of HPASMCs in hypoxia, while the effect of Dnmt1 on hypoxia-mediated HPASMCs is reversed. Luciferase assay confirmed that miR-140-5p targets Dnmt1 directly. An inverse correlation is also found between miR-140-5p and Dnmt1 in HPASMCs. In addition, we further investigated whether miR-140-5p and Dnmt1 regulate HPASMC proliferation, apoptosis and differentiation by regulating SOD2 expression, and the results confirmed our speculation. Taken together, these results indicated that miR-140-5p at least partly targets Dnmt1 and regulates SOD2 expression to inhibit proliferation and promote apoptosis and differentiation of HPASMCs in hypoxia. - Highlights: • miR-140-5p and SOD2 are down

  3. Amyloid beta(1-40-induced astrogliosis and the effect of genistein treatment in rat: a three-dimensional confocal morphometric and proteomic study.

    Directory of Open Access Journals (Sweden)

    Maryam Bagheri

    Full Text Available Astrocytes are highly involved in regulation and homeostasis of the extracellular environment in the healthy brain. In pathological conditions, these cells play a major role in the inflammatory response seen in CNS tissues, which is called reactive astrogliosis and includes hypertrophy and proliferation of astrocytes. Here, we performed 3D confocal microscopy to evaluate the morphological response of reactive astrocytes positive for glial fibrillary acidic protein (GFAP in rats, to the presence of Aβ(1-40 in the rat brain before and after treatment with genistein. In 50 astrocytes per animal, we measured the volume and surface area for the nucleus, cell body, the entire cell, the tissue covered by single astrocytes and quantified the number and length of branches, the density of the astrocytes and the intensity of GFAP immunoreactivity. Injecting Aβ(1-40 into the brain of rats caused astrogliosis indicated by increased values for all measured parameters. Mass spectrometric analysis of hippocampal tissue in Aβ(1-40-injected brain showed decreased amounts of tubulins, enolases and myelin basic protein, and increased amounts of dihydropyrimidinase-related protein 2. In Aβ(1-40-injected rats pretreated with genistein, GFAP intensity was decreased to the sham-operated group level, and Aβ(1-40-induced astrogliosis was significantly ameliorated.

  4. 30 CFR 62.140 - Dual hearing protection level.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Dual hearing protection level. 62.140 Section... HEALTH REGULATIONS OCCUPATIONAL NOISE EXPOSURE § 62.140 Dual hearing protection level. If during any work shift a miner's noise exposure exceeds the dual hearing protection level, the mine operator must, in...

  5. Observation of a resonance at 4.4 GeV and additional structure near 4.1 GeV in e+e- annihilation

    International Nuclear Information System (INIS)

    Siegrist, J.; Abrams, G.S.; Boyarski, A.M.; Breidenbach, M.; Bulos, F.; Chinowsky, W.; Feldman, G.J.; Friedberg, C.E.; Fryberger, D.; Goldhaber, G.; Hanson, G.; Hartill, D.L.; Jaros, J.; Jean-Marie, B.; Kadyk, J.A.; Larsen, R.R.; Luke, D.; Luth, V.; Lynch, H.L.; Madaras, R.; Morehouse, C.C.; Nguyen, H.K.; Paterson, J.M.; Perl, M.L.; Peruzzi, I.; Pierre, F.M.; Piccolo, M.; Pun, T.P.; Rapidis, P.; Richter, B.; Sadoulet, B.; Schwitters, R.F.; Tanenbaum, W.; Trilling, G.H.; Vannucci, F.; Whitaker, J.S.; Winkelman, F.C.; Wiss, J.E.

    1976-01-01

    We observe a resonancelike structure in the total cross section for hadron production by e + e - colliding beams at a mass of 4414 +- 7 MeV having a total width GAMMA = 33 +- 10 MeV. From the area under this resonance, we deduce the partial width to electron pairs to be GAMMA/sub ee/ = 440 +- 140 eV. Further structure of comparable width is present near 4.1 GeV

  6. 25 CFR 140.23 - Credit at trader's risk.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Credit at trader's risk. 140.23 Section 140.23 Indians....23 Credit at trader's risk. Credit given Indians will be at the trader's own risk, as no assistance... accept pawns or pledges of personal property by Indians to obtain credit or loans. ...

  7. NMR structure of the Arctic mutation of the Alzheimer's Aβ(1-40) peptide docked to SDS micelles

    Science.gov (United States)

    Usachev, K. S.; Filippov, A. V.; Khairutdinov, B. I.; Antzutkin, O. N.; Klochkov, V. V.

    2014-11-01

    The “Arctic” point mutation of the Alzheimer's amyloid β-peptide is a rare mutation leading to an early onset of Alzheimer's disease. The peptide may interact with neuronal membranes, where it can provide its toxic effects. We used 2D NMR spectroscopy to investigate the conformation of the “Arctic” mutant of Aβ1-40 Alzheimer's amyloid peptide in sodium dodecyl sulfate micelle solutions, which are the type of amphiphilic structures mimicking some properties of biomembranes. The study showed that the Arctic mutant of Aβ1-40 interacts with the surface of SDS micelles mainly through the Leu17-Asn27 310-helical region, while the Ile31-Val40 region is buried in the hydrophobic interior of the micelle. In contrast, wild-type Aβ1-40 interacts with SDS micelles through the Lys16-Asp23 α-helical region and Gly29-Met35. Both the Arctic mutant and the wild-type Aβ1-40 peptides interactions with SDS micelles are hydrophobic in nature. Aβ peptides are thought to be capable of forming pores in biomembranes that can cause changes in neuronal and endothelial cell membrane permeability. It has also been shown that Aβ peptides containing the “Arctic” mutation are more neurotoxic and aggregate more readily than the wild-type Aβ peptides at physiological conditions. Here, we propose that the extension of the helical structure of Leu17-Asn27 and a high aliphaticity (neutrality) of the C-terminal region in the Arctic Aβ peptides are consistent with the idea that formation of ion-permeable pores by Aβ oligomers may be one of prevailing mechanisms of a larger neuronal toxicity of the Arctic Aβ compared to the wild-type Aβ peptides, independent of oxidative damage and lipid peroxidation.

  8. 29 CFR 550.1 - “Talent fees” as used in section 7(e)(3)(c) of the Fair Labor Standards Act, as amended.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false âTalent feesâ as used in section 7(e)(3)(c) of the Fair...) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND DELIMITING THE TERM âTALENT FEESâ § 550.1 “Talent fees” as used in section 7(e)(3)(c) of the Fair Labor Standards Act, as amended. The...

  9. Web based machine status display for INDUS-1 And INDUS-2

    International Nuclear Information System (INIS)

    Srivastava, B.S.K.; Fatnani, P.

    2003-01-01

    Web based machine status display for Indus-1 and Indus-2 is designated to provide on-line status of Indus-1 and Indus-2 to the clients located at various places of CAT premises. Presently, this system provides Indus-1 machine status (e.g. beam current, integrated current, beam life-time etc) to the users working in Indus-1 building, but using the web browsers the same information can be accessed throughout the CAT network. This system is basically a part of Indus-1 Control System Web Site which is under construction (partially constructed). (author)

  10. Role of Receptor-Interacting Protein 140 in human fat cells

    Directory of Open Access Journals (Sweden)

    Stenson Britta M

    2010-01-01

    Full Text Available Abstract Background Mice lacking Receptor-interacting protein 140 (RIP140 have reduced body fat which at least partly is mediated through increased lipid and glucose metabolism in adipose tissue. In humans, RIP140 is lower expressed in visceral white adipose tissue (WAT of obese versus lean subjects. We investigated the role of RIP140 in human subcutaneous WAT, which is the major fat depot of the body. Methods Messenger RNA levels of RIP140 were measured in samples of subcutaneous WAT from women with a wide variation in BMI and in different human WAT preparations. RIP140 mRNA was knocked down with siRNA in in vitro differentiated adipocytes and the impact on glucose transport and mRNA levels of target genes determined. Results RIP140 mRNA levels in subcutaneous WAT were decreased among obese compared to lean women and increased by weight-loss, but did not associate with mitochondrial DNA copy number. RIP140 expression increased during adipocyte differentiation in vitro and was higher in isolated adipocytes compared to corresponding pieces of WAT. Knock down of RIP140 increased basal glucose transport and mRNA levels of glucose transporter 4 and uncoupling protein-1. Conclusions Human RIP140 inhibits glucose uptake and the expression of genes promoting energy expenditure in the same fashion as the murine orthologue. Increased levels of human RIP140 in subcutaneous WAT of lean subjects may contribute to economize on energy stores. By contrast, the function and expression pattern does not support that RIP140 regulate human obesity.

  11. A comparative immunogenicity study in rabbits of disulfide-stabilized, proteolytically cleaved, soluble trimeric human immunodeficiency virus type 1 gp140, trimeric cleavage-defective gp140 and monomeric gp120

    International Nuclear Information System (INIS)

    Beddows, Simon; Franti, Michael; Dey, Antu K.; Kirschner, Marc; Iyer, Sai Prasad N.; Fisch, Danielle C.; Ketas, Thomas; Yuste, Eloisa; Desrosiers, Ronald C.; Klasse, Per Johan; Maddon, Paul J.; Olson, William C.; Moore, John P.

    2007-01-01

    The human immunodeficiency virus type 1 (HIV-1) surface envelope glycoprotein (Env) complex, a homotrimer containing gp120 surface glycoprotein and gp41 transmembrane glycoprotein subunits, mediates the binding and fusion of the virus with susceptible target cells. The Env complex is the target for neutralizing antibodies (NAbs) and is the basis for vaccines intended to induce NAbs. Early generation vaccines based on monomeric gp120 subunits did not confer protection from infection; one alternative approach is therefore to make and evaluate soluble forms of the trimeric Env complex. We have directly compared the immunogenicity in rabbits of two forms of soluble trimeric Env and monomeric gp120 based on the sequence of HIV-1 JR-FL . Both protein-only and DNA-prime, protein-boost immunization formats were evaluated, DNA-priming having little or no influence on the outcome. One form of trimeric Env was made by disrupting the gp120-gp41 cleavage site by mutagenesis (gp140 UNC ), the other contains an intramolecular disulfide bond to stabilize the cleaved gp120 and gp41 moieties (SOSIP.R6 gp140). Among the three immunogens, SOSIP.R6 gp140 most frequently elicited neutralizing antibodies against the homologous, neutralization-resistant strain, HIV-1 JR-FL . All three proteins induced NAbs against more sensitive strains, but the breadth of activity against heterologous primary isolates was limited. When antibodies able to neutralize HIV-1 JR-FL were detected, antigen depletion studies showed they were not directed at the V3 region but were targeted at other, undefined gp120 and also non-gp120 epitopes

  12. Structure and Dynamics of the Southeast Indian Ridge, 129°E to 140°E, and Off-axis Volcanism: Preliminary Results of the STORM Cruise

    Science.gov (United States)

    Briais, Anne; Barrère, Fabienne; Boulart, Cédric; Ceuleneer, Georges; Ferreira, Nicolas; Hanan, Barry; Hémond, Christophe; Macleod, Sarah; Maia, Marcia; Maillard, Agnès; Merkuryev, Sergey; Park, Sung-Hyun; Révillon, Sidonie; Ruellan, Etienne; Schohn, Alexandre; Watson, Sally; Yang, Yun-Seok

    2016-04-01

    We present observations of the South-East Indian Ridge (SEIR) collected during the STORM cruise (South Tasmania Ocean Ridge and Mantle) on the N/O L'Atalante early 2015. The SEIR between Australia and Antarctica displays large variations of axial morphology despite an almost constant intermediate spreading rate. The Australia-Antarctic Discordance (AAD) between 120°E and 128°E is a section of the mid-ocean ridge where the magma budget is abnormally low, and which marks the boundary between Indian and Pacific mantle domains with distinct geochemical isotopic compositions. The STORM project focuses on the area east of the discordance from 128 to 140°E, where gravity highs observed on satellite-derived maps of the flanks of the SEIR reveal numerous volcanic seamounts. A major objective of the STORM cruise was to test the hypothesis of a mantle flow from the Pacific to the Indian domains. We collected multibeam bathymetry and magnetic data between 136 and 138°E to map off-axis volcanic ridges up to 10 Ma-old crust. We mapped the SEIR axis between 129 and 140°E, and the northern part of the George V transform fault. We collected rock samples on seamounts and in the transform fault, basaltic glass samples along the ridge axis, and near-bottom samples and in-situ measurements in the water column. Our observations reveal that the off-axis seamounts form near the SEIR axis, are not associated to off-axis deformation of the ocean floor, and are often located near the traces of ridge axis discontinuities. We also observe a general shallowing of the ridge axis from the AAD to the George V TF and the presence of robust axial segments near the transform fault. Our new data allow us to describe the complex evolution of the transform fault system. They also permit to locate new hydrothermal systems along the ridge axis.

  13. Design, synthesis and biological evaluation of benzo[e][1,2,4]triazin-7(1H)-one and [1,2,4]-triazino[5,6,1-jk]carbazol-6-one derivatives as dual inhibitors of beta-amyloid aggregation and acetyl/butyryl cholinesterase.

    Science.gov (United States)

    Catto, Marco; Berezin, Andrey A; Lo Re, Daniele; Loizou, Georgia; Demetriades, Marina; De Stradis, Angelo; Campagna, Francesco; Koutentis, Panayiotis A; Carotti, Angelo

    2012-12-01

    Alzheimer's disease (AD) onset and progression are associated with the dysregulation of multiple and complex physiological processes and a successful therapeutic approach should therefore address more than one target. Two new chemical entities, the easily accessible heterocyclic scaffolds 1,3-diphenylbenzo[e][1,2,4]triazin-7(1H)-one (benzotriazinone I) and 2-phenyl-6H-[1,2,4]triazino[5,6,1-jk]carbazol-6-one (triazafluoranthenone II), were explored for their multitarget-directed inhibition of beta-amyloid (Aβ) fibrillization and acetyl- (AChE) and/or butyryl- (BChE) cholinesterase, three valuable targets for AD therapy. Introduction of appropriate amine substituents at positions 6 and 5 on scaffold I and II, respectively, allowed the preparation of a series of compounds that were tested as Aβ(1-40) aggregation and cholinesterase inhibitors. Potent inhibitors of Aβ self-aggregation were discovered and among them benzotriazinone 7 exhibited an outstanding IC(50) equal to 0.37 μM. Compounds bearing a basic amine linked to the heterocyclic scaffold through a linear alkyl chain of varying length also afforded good ChE inhibitors. In particular, benzotriazinone 24 and triazafluoranthenone 38 were endowed with an interesting multiple activity, the former displaying IC(50) values of 1.4, 1.5 and 1.9 μM on Aβ aggregation and AChE and BChE inhibition, respectively, and the latter showing IC(50) values of 1.4 and an outstanding 0.025 μM in the Aβ aggregation and BChE inhibition, respectively. Benzotriazinone 24 and triazafluoranthenone 29, selected owing to their suitable aqueous solubility and Aβ aggregation inhibition, were submitted to a time course kinetic assay followed with thioflavin T (ThT) spectrofluorimetry, circular dichroism (CD) and transmission electron microscopy (TEM). Experimental data indicated that 24 acted at a low concentration ratio (10 μM 24 vs. 50 μM Aβ), stabilizing the unstructured Aβ peptide and inhibiting fibrillogenesis, and that 29

  14. 5 CFR 185.140 - Stays ordered by the Department of Justice.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stays ordered by the Department of Justice. 185.140 Section 185.140 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.140 Stays ordered by the Department of Justice. If, at any time...

  15. Prevalência e fatores associados a fogachos em mulheres climatéricas e pós-climatéricas Prevalence and factors associated with hot flashes in climacteric and post-climacteric women

    Directory of Open Access Journals (Sweden)

    Iândora Krolow Timm Sclowitz

    2005-04-01

    Full Text Available Com o objetivo de determinar a prevalência de fogachos e fatores associados, em mulheres entre 40 e 69 anos de idade, provenientes de uma amostra representativa da população da cidade de Pelotas, Rio Grande do Sul, Brasil, realizou-se um estudo transversal. O processo de amostragem foi em múltiplos estágios, e a coleta de dados, realizada através de entrevista e questionário auto-aplicado. Foram incluídas 879 mulheres. A prevalência ponto e a prevalência de episódio de fogachos foram, respectivamente, de 30,1% e 53,2%. Os fatores estatisticamente associados a fogachos atuais foram a categoria menopausal de pré-menopausa (RP = 2,33 e pós-menopausa (RP = 2,66; idade de 45 a 49 anos (RP = 1,34 e de 50 a 54 anos (RP = 1,42; status sócio-econômico mais baixo (RP = 2,16; não uso de anticoncepção hormonal após os 40 anos (RP = 1,40; obesidade (RP = 1,39; sobrepeso (RP = 1,32 e viver sem companheiro (RP = 0,80. Dada a alta prevalência do sintoma, é necessário que os serviços de saúde se organizem para lidar com a mulher climatérica.A cross-sectional study was conducted on the prevalence of hot flashes and associated factors among women from 40 to 69 years old, from a population-based sample in the city of Pelotas, southern Brazil. A multi-stage sampling process was used, and data were collected through an interview and a self-applied questionnaire. A total of 879 women were included. Point prevalence and lifetime prevalence were 30.1% and 53.2%, respectively. Factors associated with hot flashes were: pre-menopausal status (RP = 2.33 and post-menopausal status (RP = 2.66; age 45-49 years (RP = 1.34 and 50-54 years (RP = 1.42; lower social class (RP = 2.16; no use of a hormonal contraception method after 40 years of age (RP = 1.40; obesity (RP = 1.39 and overweight (RP = 1.32; and not having a partner (RP = 0.80. High prevalence of this symptom indicates that health facilities should be prepared to deal with problems encountered

  16. 17 CFR 240.14e-1 - Unlawful tender offer practices.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unlawful tender offer... Securities Exchange Act of 1934 Regulation 14e § 240.14e-1 Unlawful tender offer practices. As a means... section 14(e) of the Act, no person who makes a tender offer shall: (a) Hold such tender offer open for...

  17. 7 CFR 4280.140 - Financial statements.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Financial statements. 4280.140 Section 4280.140... Efficiency Improvements Program Section B. Guaranteed Loans § 4280.140 Financial statements. (a) The... financial statements, at its sole discretion when the Agency is concerned about the applicant's credit risk. ...

  18. Coulomb Excitation of Neutron-Rich $A\\approx$140 Nuclei

    CERN Multimedia

    Van duppen, P L E

    2002-01-01

    Investigating the isospin dependence of the product between the B( E2; 0$_{1}^{+} \\rightarrow 2_{1}^{+}$)-value and the 2$_{1}^{+}$-excitation energy E$_{2^{+}}$ in even-even nuclei around $A\\!\\approx$140 one observes a rather smooth trend close to the valley of stability but clear indication for a reduction from the extrapolated B(E2)-values by one order of magnitude for some very neutron-rich nuclei. While close to the valley of stability the strong neutron-proton interaction results in an equilibration of the neutron and proton deformations with a predominate isoscalar character of the collective 2$^{+}$ excitation, it is conceivable that more loosely bound neutrons cannot polarize a close-to-magic proton core that well any more. This might result in a decoupling of the shape of the outer neutrons from the core and in a strong isovector admixture to the lowest lying 2$^{+}$ level. In this way the 2$^{+}$ -energies could be further lowered in neutron-rich nuclei, while the quadrupole moments of the proton c...

  19. 32 CFR 644.140 - Physical protection.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 4 2010-07-01 2010-07-01 true Physical protection. 644.140 Section 644.140... ESTATE HANDBOOK Acquisition Acquisition by Leasing § 644.140 Physical protection. It is essential that the Division or District Engineer make provision for the physical protection for all facilities under...

  20. 12 CFR 313.140 - Future benefits.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Future benefits. 313.140 Section 313.140 Banks... CORPORATE DEBT COLLECTION Civil Service Retirement and Disability Fund Offset § 313.140 Future benefits. Unless otherwise prohibited by law, the FDIC may request that a debtor's anticipated or future benefit...

  1. 20 CFR 401.140 - General principles.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false General principles. 401.140 Section 401.140... INFORMATION Disclosure of Official Records and Information § 401.140 General principles. When no law... follow FOIA principles to resolve that question. We do this to insure uniform treatment in all situations...

  2. SCM-198 inhibits microglial overactivation and attenuates Aβ(1-40)-induced cognitive impairments in rats via JNK and NF-кB pathways.

    Science.gov (United States)

    Hong, Zhen-Yi; Shi, Xue-Ru; Zhu, Kai; Wu, Ting-Ting; Zhu, Yi-Zhun

    2014-08-19

    Neuroinflammation mediated by overactivated microglia plays a key role in many neurodegenerative diseases, including Alzheimer's disease (AD). In this study, we investigated for the first time the anti-neuroinflammatory effects and possible mechanisms of SCM-198 (an alkaloid extracted from Herbaleonuri), which was previously found highly cardioprotective, both in vitro and in vivo. For in vitro experiments, lipopolysaccharide (LPS) or β-amyloid(1-40) (Aβ(1-40)) was applied to induce microglial overactivation. Proinflammatory mediators were measured and activations of NF-κB and mitogen-activated protein kinases' (MAPKs) pathways were investigated. Further protective effect of SCM-198 was evaluated in microglia-neuron co-culture assay and Sprague-Dawley (SD) rats intrahippocampally-injected with Aβ(1-40). SCM-198 reduced expressions of nitric oxide (NO), TNF-α, IL-1β and IL-6 possibly via, at least partially, inhibiting c-Jun N-terminal kinase (JNK) and NF-κB signaling pathways in microglia. Co-culture assay showed that activated microglia pretreated with SCM-198 led to less neuron loss and decreased phosphorylation of tau and extracellular signal-regulated kinase (ERK) in neurons. Besides, SCM-198 also directly protected against Aβ(1-40)-induced neuronal death and lactate dehydrogenase (LDH) release in primary cortical neurons. For in vivo studies, SCM-198 significantly enhanced cognitive performances of rats 12 days after intrahippocampal injections of aged Aβ(1-40) peptides in the Morris water maze (MWM), accompanied by less hippocampal microglial activation, decreased synaptophysin loss and phosphorylation of ERK and tau. Co-administration of donepezil and SCM-198 resulted in a slight cognitive improvement in SD rats 50 days after intrahippocampal injections of aged Aβ(1-40) peptides as compared to only donepezil or SCM-198 treated group. Our findings are the first to report that SCM-198 has considerable anti-neuroinflammatory effects on inhibiting

  3. E-4 Test Facility Design Status

    Science.gov (United States)

    Ryan, Harry; Canady, Randy; Sewell, Dale; Rahman, Shamim; Gilbrech, Rick

    2001-01-01

    Combined-cycle propulsion technology is a strong candidate for meeting NASA space transportation goals. Extensive ground testing of integrated air-breathing/rocket system (e.g., components, subsystems and engine systems) across all propulsion operational modes (e.g., ramjet, scramjet) will be needed to demonstrate this propulsion technology. Ground testing will occur at various test centers based on each center's expertise. Testing at the NASA John C. Stennis Space Center will be primarily concentrated on combined-cycle power pack and engine systems at sea level conditions at a dedicated test facility, E-4. This paper highlights the status of the SSC E-4 test Facility design.

  4. 40 CFR 1033.140 - Rated power.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Rated power. 1033.140 Section 1033.140... EMISSIONS FROM LOCOMOTIVES Emission Standards and Related Requirements § 1033.140 Rated power. This section describes how to determine the rated power of a locomotive for the purposes of this part. (a) A locomotive...

  5. 7 CFR 905.140 - Gift packages.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Gift packages. 905.140 Section 905.140 Agriculture... TANGELOS GROWN IN FLORIDA Rules and Regulations Non-Regulated Fruit § 905.140 Gift packages. Any handler..., ship any varieties for the following purpose and types of shipment: (a) To any person gift packages...

  6. Standard Test Method for Measuring Reaction Rates by Analysis of Barium-140 From Fission Dosimeters

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2008-01-01

    1.1 This test method describes two procedures for the measurement of reaction rates by determining the amount of the fission product 140Ba produced by the non-threshold reactions 235U(n,f), 241Am(n,f), and 239Pu(n,f), and by the threshold reactions 238U(n,f), 237Np(n,f), and 232Th(n,f). 1.2 These reactions produce many fission products, among which is 140Ba, having a half-life of 12.752 days. 140Ba emits gamma rays of several energies; however, these are not easily detected in the presence of other fission products. Competing activity from other fission products requires that a chemical separation be employed or that the 140Ba activity be determined indirectly by counting its daughter product 140La. This test method describes both procedure (a), the nondestructive determination of 140Ba by the direct counting of 140La several days after irradiation, and procedure (b), the chemical separation of 140Ba and the subsequent counting of 140Ba or its daughter 140La. 1.3 With suitable techniques, fission neutron fl...

  7. Structure and Dynamics of the Southeast Indian Ridge and Off-axis Volcanism, 129°E to 140°E: Preliminary Results of the STORM Cruise

    Science.gov (United States)

    Maia, M.; Briais, A.; Barrere, F.; Boulart, C.; Ceuleneer, G.; Ferreira, N.; Hanan, B. B.; Hemond, C.; MacLeod, S.; Maillard, A. L.; Merkuryev, S. A.; Park, S. H.; Revillon, S.; Ruellan, E.; Schohn, A.; Watson, S. J.; Yang, Y. S.

    2015-12-01

    We present observations of the South-East Indian Ridge (SEIR) collected during the STORM cruise (South Tasmania Ocean Ridge and Mantle) on the N/O L'Atalante early 2015. The SEIR between Australia and Antarctica displays large variations of axial morphology despite an almost constant intermediate spreading rate. The Australia-Antarctic Discordance (AAD) between 120°E and 128°E is a section of the mid-ocean ridge where the magma budget is abnormally low, and which marks the boundary between Indian and Pacific mantle domains with distinct geochemical isotopic compositions. The STORM project focuses on the area east of the discordance from 128 to 140°E, where gravity highs observed on satellite-derived maps of the flanks of the SEIR reveal numerous volcanic seamounts. A major objective of the STORM cruise was to test the hypothesis of a mantle flow from the Pacific to the Indian domains. We collected multibeam bathymetry and magnetic data between 136 and 138°E to map off-axis volcanic ridges up to 10 Ma-old crust. We mapped the SEIR axis between 129 and 140°E, and the northern part of the George V transform fault. We collected rock samples on seamounts and in the transform fault, basaltic glass samples along the ridge axis, and near-bottom samples and in-situ measurements in the water column. Our observations reveal that the off-axis seamounts form near the SEIR axis, and are not associated to off-axis deformation of the ocean floor. They show a general shallowing of the ridge axis from the AAD to the George V TF and the presence of robust axial segments near the transform fault. They allow us to describe the complex evolution of the transform fault system. They also permit to locate new hydrothermal systems along the ridge axis. STORM cruise scientific party: F. Barrere, C. Boulart, G. Ceuleneer, N. Ferreira, B. Hanan, C. Hémond, S. Macleod, M. Maia, A. Maillard, S. Merkuryev, S.H. Park, S. Révillon, E. Ruellan, A. Schohn, S. Watson, and Y.S. Yang.

  8. MicroRNA-140-5p attenuated oxidative stress in Cisplatin induced acute kidney injury by activating Nrf2/ARE pathway through a Keap1-independent mechanism.

    Science.gov (United States)

    Liao, Weitang; Fu, Zongjie; Zou, Yanfang; Wen, Dan; Ma, Hongkun; Zhou, Fangfang; Chen, Yongxi; Zhang, Mingjun; Zhang, Wen

    2017-11-15

    Oxidative stress was predominantly involved in the pathogenesis of acute kidney injury (AKI). Recent studies had reported the protective role of specific microRNAs (miRNAs) against oxidative stress. Hence, we investigated the levels of miR140-5p and its functional role in the pathogenesis of Cisplatin induced AKI. A mice Cisplatin induced-AKI model was established. We found that miR-140-5p expression was markedly increased in mice kidney. Bioinformatics analysis revealed nuclear factor erythroid 2-related factor (Nrf2) was a potential target of miR-140-5p, We demonstrated that miR-140-5p did not affect Kelch-like ECH-associated protein 1 (Keap1) level but directly targeted the 3'-UTR of Nrf2 mRNA and played a positive role in the regulation of Nrf2 expression which was confirmed by luciferase activity assay and western blot. What was more, consistent with miR140-5p expression, the mRNA and protein levels of Nrf2, as well as antioxidant response element (ARE)-driven genes Heme Oxygenase-1 (HO-1) and NAD(P)H:quinone oxidoreductase l (NQO1) were significantly increased in mice kidney tissues. In vitro study, Enforced expression of miR-140-5p in HK2 cells significantly attenuated oxidative stress by decreasing ROS level and increasing the expression of manganese superoxide dismutase (MnSOD). Simultaneously, miR-140-5p decreased lactate dehydrogenase (LDH) leakage and improved cell vitality in HK2 cells under Cisplatin-induced oxidative stress. However, HK2 cells transfected with a siRNA targeting Nrf2 abrogated the protective effects of miR-140-5p against oxidative stress. These results indicated that miR-140-5p might exert its anti-oxidative stress function via targeting Nrf2. Our findings showed the novel transcriptional role of miR140-5p in the expression of Nrf2 and miR-140-5p protected against Cisplatin induced oxidative stress by activating Nrf2-dependent antioxidant pathway, providing a potentially therapeutic target in acute kidney injury. Copyright © 2017

  9. 21 CFR 168.140 - Maple sirup.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Maple sirup. 168.140 Section 168.140 Food and... § 168.140 Maple sirup. (a) Maple sirup is the liquid food derived by concentration and heat treatment of the sap of the maple tree (Acer) or by solution in water of maple sugar (mapel concrete) made from...

  10. 25 CFR 900.140 - Can any provision of the regulations under this part be waived?

    Science.gov (United States)

    2010-04-01

    ... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES CONTRACTS UNDER THE INDIAN SELF-DETERMINATION AND EDUCATION ASSISTANCE ACT Waiver Procedures § 900.140 Can any provision of the regulations under this part be... 25 Indians 2 2010-04-01 2010-04-01 false Can any provision of the regulations under this part be...

  11. 45 CFR 503.1 - Definitions-Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Definitions-Privacy Act. 503.1 Section 503.1... THE UNITED STATES, DEPARTMENT OF JUSTICE RULES OF PRACTICE PRIVACY ACT AND GOVERNMENT IN THE SUNSHINE REGULATIONS Privacy Act Regulations § 503.1 Definitions—Privacy Act. For the purpose of this part: Agency...

  12. 29 CFR 1615.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Employment. 1615.140 Section 1615.140 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF DISABILITY IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE EQUAL EMPLOYMENT OPPORTUNITY...

  13. Status of 2XIIB plasma confinement experiments

    International Nuclear Information System (INIS)

    Coensgen, F.J.; Clauser, J.F.; Correll, D.L.

    1976-01-01

    This report describes the status of 2XIIB neutral beam injection experiments with stabilizing plasma. The stream suppresses ion-cyclotron fluctuations and permits density to 5 x 10 13 cm -3 . The ion energy is 13 keV, and electron temperature reaches 140 eV. Plasma confinement increases with ion energy and n tau reaches 7 x 10 10 cm -3 .s at 13 keV. The n tau energy scaling is consistent with electron drag and ion-ion scattering losses. Buildup on a streaming plasma in a steady-state magnetic field is described

  14. 76 FR 11764 - Sunshine Act Notice

    Science.gov (United States)

    2011-03-03

    .... Additionally, as a part of the Board's E-Government initiative, the meeting will be presented live through... Safety Board. ACTION: Notice of public meeting. SUMMARY: Pursuant to the provisions of the Government in....dnfsb.gov ). STATUS: Open. While the Government in the Sunshine Act does not require that the scheduled...

  15. 78 FR 69086 - Sunshine Act Meeting

    Science.gov (United States)

    2013-11-18

    ... FEDERAL ELECTION COMMISSION Sunshine Act Meeting AGENCY: Federal Election Commission. Federal... 19, 2013 at 10:00 a.m. PLACE: 999 E Street NW., Washington, DC. STATUS: This meeting will be closed to the public. CHANGES IN THE MEETING: The meeting will begin at 11:00 a.m. ITEMS TO BE DISCUSSED...

  16. Longitudinal survey of two serotine bat (Eptesicus serotinus maternity colonies exposed to EBLV-1 (European Bat Lyssavirus type 1: Assessment of survival and serological status variations using capture-recapture models.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Robardet

    2017-11-01

    Full Text Available This study describes two longitudinal serological surveys of European Bat Lyssavirus type 1 (EBLV-1 antibodies in serotine bat (Eptesicus serotinus maternity colonies located in the North-East of France. This species is currently considered as the main EBLV-1 reservoir. Multievent capture-recapture models were used to determine the factors influencing bat rabies transmission as this method accounts for imperfect detection and uncertainty in disease states. Considering the period of study, analyses revealed that survival and recapture probabilities were not affected by the serological status of individuals, confirming the capacity of bats to be exposed to lyssaviruses without dying. Five bats have been found with EBLV-1 RNA in the saliva at the start of the study, suggesting they were caught during virus excretion period. Among these bats, one was interestingly recaptured one year later and harbored a seropositive status. Along the survey, some others bats have been observed to both seroconvert (i.e. move from a negative to a positive serological status and serorevert (i.e. move from a positive to a negative serological status. Peak of seroprevalence reached 34% and 70% in site A and B respectively. On one of the 2 sites, global decrease of seroprevalence was observed all along the study period nuanced by oscillation intervals of approximately 2-3 years supporting the oscillation infection dynamics hypothesized during a previous EBLV-1 study in a Myotis myotis colony. Seroprevalence were affected by significantly higher seroprevalence in summer than in spring. The maximum time observed between successive positive serological statuses of a bat demonstrated the potential persistence of neutralizing antibodies for at least 4 years. At last, EBLV-1 serological status transitions have been shown driven by age category with higher seroreversion frequencies in adults than in juvenile. Juveniles and female adults seemed indeed acting as distinct drivers

  17. Longitudinal survey of two serotine bat (Eptesicus serotinus) maternity colonies exposed to EBLV-1 (European Bat Lyssavirus type 1): Assessment of survival and serological status variations using capture-recapture models.

    Science.gov (United States)

    Robardet, Emmanuelle; Borel, Christophe; Moinet, Marie; Jouan, Dorothée; Wasniewski, Marine; Barrat, Jacques; Boué, Franck; Montchâtre-Leroy, Elodie; Servat, Alexandre; Gimenez, Olivier; Cliquet, Florence; Picard-Meyer, Evelyne

    2017-11-01

    This study describes two longitudinal serological surveys of European Bat Lyssavirus type 1 (EBLV-1) antibodies in serotine bat (Eptesicus serotinus) maternity colonies located in the North-East of France. This species is currently considered as the main EBLV-1 reservoir. Multievent capture-recapture models were used to determine the factors influencing bat rabies transmission as this method accounts for imperfect detection and uncertainty in disease states. Considering the period of study, analyses revealed that survival and recapture probabilities were not affected by the serological status of individuals, confirming the capacity of bats to be exposed to lyssaviruses without dying. Five bats have been found with EBLV-1 RNA in the saliva at the start of the study, suggesting they were caught during virus excretion period. Among these bats, one was interestingly recaptured one year later and harbored a seropositive status. Along the survey, some others bats have been observed to both seroconvert (i.e. move from a negative to a positive serological status) and serorevert (i.e. move from a positive to a negative serological status). Peak of seroprevalence reached 34% and 70% in site A and B respectively. On one of the 2 sites, global decrease of seroprevalence was observed all along the study period nuanced by oscillation intervals of approximately 2-3 years supporting the oscillation infection dynamics hypothesized during a previous EBLV-1 study in a Myotis myotis colony. Seroprevalence were affected by significantly higher seroprevalence in summer than in spring. The maximum time observed between successive positive serological statuses of a bat demonstrated the potential persistence of neutralizing antibodies for at least 4 years. At last, EBLV-1 serological status transitions have been shown driven by age category with higher seroreversion frequencies in adults than in juvenile. Juveniles and female adults seemed indeed acting as distinct drivers of the rabies

  18. 42 CFR 410.140 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Definitions. 410.140 Section 410.140 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM... condition of abnormal glucose metabolism diagnosed using the following criteria: A fasting blood sugar...

  19. 7 CFR 948.140 - Application.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Application. 948.140 Section 948.140 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... packing facilities are located in an area where inspection is not readily available or the actual cost for...

  20. 21 CFR 820.140 - Handling.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Handling. 820.140 Section 820.140 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES... manufacturer shall establish and maintain procedures to ensure that mixups, damage, deterioration...

  1. 22 CFR 1600.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Employment. 1600.140 Section 1600.140 Foreign... Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

  2. 45 CFR 1181.140 - Employment.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 3 2010-10-01 2010-10-01 false Employment. 1181.140 Section 1181.140 Public... Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

  3. 16 CFR 1034.140 - Employment.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Employment. 1034.140 Section 1034.140... Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

  4. Investigation of electrostatic waves in the ion cyclotron range of frequencies in L-4 and ACT-1

    International Nuclear Information System (INIS)

    Ono, Masayuki.

    1993-05-01

    Electrostatic waves in the ion cyclotron range of frequencies (ICRF) were studied in the Princeton L-4 and ACT-1 devices for approximately ten years, from 1975 to 1985. The investigation began in the L-4 linear device, looking for the parametric excitation of electrostatic ion cyclotron waves in multi-ion-species plasmas. In addition, this investigation verified multi-ion-species effects on the electrostatic ion cyclotron wave dispersion religion including the ion-ion hybrid resonance. Finite-Larmor-radius modification of the wave dispersion relation was also observed, even for ion temperatures of T i ∼ 1/40 eV. Taking advantage of the relatively high field and long device length of L-4, the existence of the cold electrostatic ion cyclotron wave (CES ICW) was verified. With the arrival of the ACT-1 toroidal device, finite-Larmor-radius (FLR) waves were studied in a relatively collisionless warm-ion hydrogen plasma. Detailed investigations of ion Bernstein waves (IBW) included the verification of mode-transformation in their launching, their wave propagation characteristics, their absorption, and the resulting ion heating. This basic physics activity played a crucial role in developing a new reactor heating concept termed ion Bernstein wave heating. Experimental research in the lower hybrid frequency range confirmed the existence of FLR effects near the lower hybrid resonance, predicted by Stix in 1965. In a neon plasma with a carefully placed phased wave exciter, the neutralized ion Bernstein wave was observed for the first time. Using a fastwave ICRF antenna, two parasitic excitation processes for IBW -- parametric instability and density-gradient-driven excitation -- were also discovered. In the concluding section of this paper, a possible application of externally launched electrostatic waves is suggested for helium ash removal from fusion reactor plasmas

  5. 36 CFR 909.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Employment. 909.140 Section... DEVELOPMENT CORPORATION § 909.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency...

  6. 36 CFR 812.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Employment. 812.140 Section... PRESERVATION § 812.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  7. 36 CFR 406.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Employment. 406.140 Section... COMMISSION § 406.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The...

  8. 36 CFR 1208.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Employment. 1208.140 Section... ARCHIVES AND RECORDS ADMINISTRATION § 1208.140 Employment. No qualified individual with handicaps shall, on the basis of handicap, be subject to discrimination in employment under any program or activity...

  9. 36 CFR 1154.140 - Employment.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Employment. 1154.140 Section... ARCHITECTURAL AND TRANSPORTATION BARRIERS COMPLIANCE BOARD § 1154.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or...

  10. 40 CFR 52.140 - Monitoring transportation trends.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Monitoring transportation trends. 52.140 Section 52.140 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS Arizona § 52.140 Monitoring transportation...

  11. 21 CFR 812.140 - Records.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Records. 812.140 Section 812.140 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES... disposed of. (3) Records of each subject's case history and exposure to the device. Case histories include...

  12. 18 CFR 1313.140 - Employment.

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Employment. 1313.140... § 1313.140 Employment. No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...

  13. 7 CFR 1209.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE MUSHROOM PROMOTION, RESEARCH, AND CONSUMER INFORMATION ORDER Mushroom Promotion, Research, and Consumer Information Order Definitions § 1209.1 Act. Act...

  14. 7 CFR 1215.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE POPCORN PROMOTION, RESEARCH, AND CONSUMER INFORMATION Popcorn Promotion, Research, and Consumer Information Order Definitions § 1215.1 Act. Act means...

  15. 7 CFR 1230.1 - Act.

    Science.gov (United States)

    2010-01-01

    ... the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE PORK PROMOTION, RESEARCH, AND CONSUMER INFORMATION Pork Promotion, Research, and Consumer Information Order Definitions § 1230.1 Act. Act means the...

  16. 10 CFR 140.6 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Reports. 140.6 Section 140.6 Energy NUCLEAR REGULATORY... Reports. (a) In the event of bodily injury or property damage arising out of or in connection with the... records and furnish such reports to the Commission as the Commission deems necessary for the...

  17. The Influence of Deaf People's Dual Category Status on Sign Language Planning: The British Sign Language (Scotland) Act (2015)

    Science.gov (United States)

    De Meulder, Maartje

    2017-01-01

    Through the British Sign Language (Scotland) Act, British Sign Language (BSL) was given legal status in Scotland. The main motives for the Act were a desire to put BSL on a similar footing with Gaelic and the fact that in Scotland, BSL signers are the only group whose first language is not English who must rely on disability discrimination…

  18. Present status of cryogenic system for e-linac at VECC

    International Nuclear Information System (INIS)

    Ahammed, Manir; Mondal, Manas; Pal, Sandip; Duttagupta, Anjan; Bandyopadhyay, Arup; Naik, Vaishali; Chakrabarti, Alok; Laxdal, Robert E.; Koveshnikov, Alexy

    2015-01-01

    VECC is constructing a 50 MeV, 100 kW, superconducting electron linear accelerator (e-Linac) for the upcoming ANURIB (Advanced National facility for Unstable and Rare Isotope Beams) project at the new campus. Presently a 10 MeV injector for the e-Linac is being developed in collaboration with TRIUMF laboratory in Canada.The Injector comprises a 300 kV electron gun, low energy beam transport (LEBT) line and an injector cryo-module (ICM) that houses one 9-cell beta=1, 1.3 GHz niobium elliptical cavity operated at 2K. Alternatively, a capture cryo-module (CCM) having two single cell beta=1, 1.3 GHz niobium cavities that will allow the electron gun to be operated at 100 kV is also being developed. The e-Linac has been jointly designed by VECC and TRIUMF. The ICM is being built by TRIUMF whereas front-end of the injector is being built indigenously at VECC. In this report the details and present status of the cryogenic system for the e-Linac will be presented

  19. 7 CFR 65.140 - Food service establishment.

    Science.gov (United States)

    2010-01-01

    ... retail establishments that provide ready-to-eat foods that are consumed either on or outside of the... 7 Agriculture 3 2010-01-01 2010-01-01 false Food service establishment. 65.140 Section 65.140..., PEANUTS, AND GINSENG General Provisions Definitions § 65.140 Food service establishment. Food service...

  20. An UHPLC-MS/MS method for simultaneous quantification of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid using micro-elution solid phase extraction.

    Science.gov (United States)

    Lin, Ping-Ping; Chen, Wei-Li; Yuan, Fei; Sheng, Lei; Wu, Yu-Jia; Zhang, Wei-Wei; Li, Guo-Qing; Xu, Hong-Rong; Li, Xue-Ning

    2017-12-01

    Amyloid beta (Aβ) peptides in cerebrospinal fluid are extensively estimated for identification of Alzheimer's disease (AD) as diagnostic biomarkers. Unfortunately, their pervasive application is hampered by interference from Aβ propensity of self-aggregation, nonspecifically bind to surfaces and matrix proteins, and by lack of quantitive standardization. Here we report on an alternative Ultra-high performance liquid chromatography-tandem mass spectrometry (UHPLC-MS/MS) method for simultaneous measurement of human amyloid beta peptides Aβ1-38, Aβ1-40 and Aβ1-42 in cerebrospinal fluid (CSF) using micro-elution solid phase extraction (SPE). Samples were pre-processing by the mixed-mode micro-elution solid phase extraction and quantification was performed in the positive ion multiple reaction monitoring (MRM) mode using electrospray ionization. The stable-isotope labeled Aβ peptides 15 N 51 - Aβ1-38, 15 N 53 - Aβ1-40 and 15 N 55 - Aβ1-42 peptides were used as internal standards. And the artificial cerebrospinal fluid (ACSF) containing 5% rat plasma was used as a surrogate matrix for calibration curves. The quality control (QC) samples at 0.25, 2 and 15ng/mL were prepared. A "linear" regression (1/x 2 weighting): y=ax+b was used to fit the calibration curves over the concentration range of 0.1-20ng/mL for all three peptides. Coefficient of variation (CV) of intra-batch and inter-batch assays were all less than 6.44% for Aβ1-38, 6.75% for Aβ1-40 and 10.74% for Aβ1-42. The precision values for all QC samples of three analytes met the acceptance criteria. Extract recoveries of Aβ1-38, Aβ1-40 and Aβ1-42 were all greater than 70.78%, both in low and high QC samples. The stability assessments showed that QC samples at both low and high levels could be stable for at least 24h at 4°C, 4h at room temperature and through three freeze-thaw cycles without sacrificing accuracy or precision. And no significant carryover effect was observed. This validated UHPLC

  1. 24 CFR 990.140 - Occupied dwelling units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Occupied dwelling units. 990.140 Section 990.140 Housing and Urban Development Regulations Relating to Housing and Urban Development... Eligible Unit Months § 990.140 Occupied dwelling units. A PHA is eligible to receive operating subsidy for...

  2. 40 CFR 35.1605-1 - The Act.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false The Act. 35.1605-1 Section 35.1605-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GRANTS AND OTHER FEDERAL ASSISTANCE STATE AND LOCAL... The Act. The Clean Water Act, as amended (33 U.S.C. 1251 et seq.). ...

  3. Synaptic Interactome Mining Reveals p140Cap as a New Hub for PSD Proteins Involved in Psychiatric and Neurological Disorders

    Directory of Open Access Journals (Sweden)

    Annalisa Alfieri

    2017-06-01

    Full Text Available Altered synaptic function has been associated with neurological and psychiatric conditions including intellectual disability, schizophrenia and autism spectrum disorder (ASD. Amongst the recently discovered synaptic proteins is p140Cap, an adaptor that localizes at dendritic spines and regulates their maturation and physiology. We recently showed that p140Cap knockout mice have cognitive deficits, impaired long-term potentiation (LTP and long-term depression (LTD, and immature, filopodia-like dendritic spines. Only a few p140Cap interacting proteins have been identified in the brain and the molecular complexes and pathways underlying p140Cap synaptic function are largely unknown. Here, we isolated and characterized the p140Cap synaptic interactome by co-immunoprecipitation from crude mouse synaptosomes, followed by mass spectrometry-based proteomics. We identified 351 p140Cap interactors and found that they cluster to sub complexes mostly located in the postsynaptic density (PSD. p140Cap interactors converge on key synaptic processes, including transmission across chemical synapses, actin cytoskeleton remodeling and cell-cell junction organization. Gene co-expression data further support convergent functions: the p140Cap interactors are tightly co-expressed with each other and with p140Cap. Importantly, the p140Cap interactome and its co-expression network show strong enrichment in genes associated with schizophrenia, autism, bipolar disorder, intellectual disability and epilepsy, supporting synaptic dysfunction as a shared biological feature in brain diseases. Overall, our data provide novel insights into the molecular organization of the synapse and indicate that p140Cap acts as a hub for postsynaptic complexes relevant to psychiatric and neurological disorders.

  4. Reduced neuronal size and mTOR pathway activity in the Mecp2 A140V Rett syndrome mouse model [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    Sampathkumar Rangasamy

    2016-09-01

    Full Text Available Rett syndrome (RTT is a neurodevelopmental disorder caused by mutation in the X-linked MECP2 gene, encoding methyl-CpG-binding protein 2. We have created a mouse model (Mecp2 A140V “knock-in” mutant expressing the recurrent human MECP2 A140V mutation linked to an X-linked mental retardation/Rett syndrome phenotype. Morphological analyses focused on quantifying soma and nucleus size were performed on primary hippocampus and cerebellum granule neuron (CGN cultures from mutant (Mecp2A140V/y and wild type (Mecp2+/y male mice. Cultured hippocampus and cerebellar granule neurons from mutant animals were significantly smaller than neurons from wild type animals. We also examined soma size in hippocampus neurons from individual female transgenic mice that express both a mutant  (maternal allele and a wild type Mecp2 gene linked to an eGFP transgene (paternal allele. In cultures from such doubly heterozygous female mice, the size of neurons expressing the mutant (A140V allele also showed a significant reduction compared to neurons expressing wild type MeCP2, supporting a cell-autonomous role for MeCP2 in neuronal development. IGF-1 (insulin growth factor-1 treatment of neuronal cells from Mecp2 mutant mice rescued the soma size phenotype. We also found that Mecp2  mutation leads to down-regulation of the mTOR signaling pathway, known to be involved in neuronal size regulation. Our results suggest that i reduced neuronal size is an important in vitro cellular phenotype of Mecp2 mutation in mice, and ii MeCP2 might play a critical role in the maintenance of neuronal structure by modulation of the mTOR pathway. The definition of a quantifiable cellular phenotype supports using neuronal size as a biomarker in the development of a high-throughput, in vitro assay to screen for compounds that rescue small neuronal phenotype (“phenotypic assay”.

  5. The Muon g-2 Experiment Overview and Status

    Energy Technology Data Exchange (ETDEWEB)

    Holzbauer, J. L. [Mississippi U.

    2017-12-16

    The Muon g-2 experiment at Fermilab will measure the anomalous magnetic moment of the muon to a precision of 140 parts per billion, which is a factor of four improvement over the previous E821 measurement at Brookhaven. The experiment will also extend the search for the muon electric dipole moment (EDM) by approximately two orders of magnitude. Both of these measurements are made by combining a precise measurement of the 1.45T storage ring magnetic field with an analysis of the modulation of the decay rate of the higher-energy positrons from the (anti-)muon decays recorded by 24 calorimeters and 3 straw tracking detectors. The current status of the experiment as well as results from the initial beam delivery and commissioning run in the summer of 2017 will be discussed.

  6. 21 CFR 146.140 - Pasteurized orange juice.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Pasteurized orange juice. 146.140 Section 146.140... and Beverages § 146.140 Pasteurized orange juice. (a) Pasteurized orange juice is the food prepared from unfermented juice obtained from mature oranges as specified in § 146.135, to which may be added...

  7. Autoantibodies to a 140-kd protein in juvenile dermatomyositis are associated with calcinosis.

    LENUS (Irish Health Repository)

    Gunawardena, H

    2009-06-01

    OBJECTIVE: The identification of novel autoantibodies in juvenile dermatomyositis (DM) may have etiologic and clinical implications. The aim of this study was to describe autoantibodies to a 140-kd protein in children recruited to the Juvenile DM National Registry and Repository for UK and Ireland. METHODS: Clinical data and sera were collected from children with juvenile myositis. Sera that recognized a 140-kd protein by immunoprecipitation were identified. The identity of the p140 autoantigen was investigated by immunoprecipitation\\/immunodepletion, using commercial monoclonal antibodies to NXP-2, reference anti-p140, and anti-p155\\/140, the other autoantibody recently described in juvenile DM. DNA samples from 100 Caucasian children with myositis were genotyped for HLA class II haplotype associations and compared with those from 864 randomly selected UK Caucasian control subjects. RESULTS: Sera from 37 (23%) of 162 patients with juvenile myositis were positive for anti-p140 autoantibodies, which were detected exclusively in patients with juvenile DM and not in patients with juvenile DM-overlap syndrome or control subjects. No anti-p140 antibody-positive patients were positive for other recognized autoantibodies. Immunodepletion suggested that the identity of p140 was consistent with NXP-2 (the previously identified MJ autoantigen). In children with anti-p140 antibodies, the association with calcinosis was significant compared with the rest of the cohort (corrected P < 0.005, odds ratio 7.0, 95% confidence interval 3.0-16.1). The clinical features of patients with anti-p140 autoantibodies were different from those of children with anti-p155\\/140 autoantibodies. The presence of HLA-DRB1*08 was a possible risk factor for anti-p140 autoantibody positivity. CONCLUSION: This study has established that anti-p140 autoantibodies represent a major autoantibody subset in juvenile DM. This specificity may identify a further immunogenetic and clinical phenotype within the

  8. Current meter data from moored current meter casts in the SW Pacific (limit-147 E to 140 W) as part of the Equatorial Pacific Ocean Climate Studies (EPOCS) project from 1985-09-29 to 1986-04-01 (NODC Accession 8800136)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Current meter data were collected using moored current meter casts in the SW Pacific (limit-147 E to 140 W) from September 29, 1985 to June 1, 1986. Data were...

  9. Características agronômicas e o estado nutricional de cultivares de girassol irrigado Agronomic characteristics and nutritional status of irrigated sunflower cultivars

    Directory of Open Access Journals (Sweden)

    Leonardo A. de Aquino

    2013-05-01

    Full Text Available Objetivou-se, neste trabalho, avaliar o estado nutricional, caracteres agronômicos e a produtividade de cultivares de girassol sob irrigação. Os cultivares Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, Dow Agroscience M 734 e MG 02, foram semeados em blocos ao acaso, com quatro repetições. O número de folhas por planta no florescimento foi maior nos híbridos Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02, em relação aos cultivares de polinização aberta Embrapa 122 V-2000 e IAC Iarama. Os teores foliares de N, P, K, Ca, Mg e S foram 40,91; 3,51; 35,91; 33,91; 6,23 e 7,88 g kg-1, respectivamente. Os cultivares Embrapa 122 V-2000 e IAC-Iarama apresentaram teor de P na folha índice menor que os demais cultivares. Os teores foliares de Zn, Cu, Fe e o Mn foram 75,15; 24,11; 98,39 e 348,10 mg kg-1, respectivamente. O teor médio de B na folha índice nos híbridos e nas variedades de polinização aberta foi de 119,25 e 140,35 mg kg-1, respectivamente. Os cultivares Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, Dow Agroscience M 734 e MG 02 apresentaram maior produtividade que o Embrapa 122 V-2000 e o IAC Iarama.This work aimed to assess nutritional status, agronomic characteristics, and productivity of sunflower cultivars under irrigation. Embrapa 122 V-2000, Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360, IAC Iarama, and Dow Agroscience M 734 and MG 02 cultivars were sown in randomized block design with four replications. The number of leaves per plant in full bloom was higher in hybrid Hélio 250, Hélio 251, Hélio 253, Hélio 358, Hélio 360 and Dow Agroscience MG 734 and M 02 related to open-pollinated cultivars Embrapa 122 V-2000 and IAC Iarama. Foliar contents of N, P, K, Ca, Mg, and S were 40.91, 3.51, 35.91, 33.91, 6.23, and 7.88 g kg-1, respectively. Embrapa 122 V-2000 and IAC-Iarama cultivars showed an average

  10. 26 CFR 1.943-1 - Withholding by a China Trade Act corporation.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Withholding by a China Trade Act corporation. 1...) INCOME TAX (CONTINUED) INCOME TAXES China Trade Act Corporations § 1.943-1 Withholding by a China Trade Act corporation. Dividends paid by a China Trade Act corporation to a nonresident alien individual...

  11. Injection of Aβ1-40 into hippocampus induced cognitive lesion associated with neuronal apoptosis and multiple gene expressions in the tree shrew.

    Science.gov (United States)

    Lin, Na; Xiong, Liu-Lin; Zhang, Rong-Ping; Zheng, Hong; Wang, Lei; Qian, Zhong-Yi; Zhang, Piao; Chen, Zhi-Wei; Gao, Fa-Bao; Wang, Ting-Hua

    2016-05-01

    Alzheimer's disease (AD) can incur significant health care costs to the patient, their families, and society; furthermore, effective treatments are limited, as the mechanisms of AD are not fully understood. This study utilized twelve adult male tree shrews (TS), which were randomly divided into PBS and amyloidbetapeptide1-40 (Aβ1-40) groups. AD model was established via an intracerebroventricular (icv) injection of Aβ1-40 after being incubated for 4 days at 37 °C. Behavioral, pathophysiological and molecular changes were evaluated by hippocampal-dependent tasks, magnetic resonance imaging (MRI), silver staining, hematoxylin-eosin (HE) staining, TUNEL assay and gene sequencing, respectively. At 4 weeks post-injection, as compared with the PBS group, in Aβ1-40 injected animals: cognitive impairments happened, and the hippocampus had atrophied indicated by MRI findings; meanwhile, HE staining showed the cells of the CA3 and DG were significantly thinner and smaller. The average number of cells in the DG, but not the CA3, was also significantly reduced; furthermore, silver staining revealed neurotic plaques and neurofibrillary tangles (NFTs) in the hippocampi; TUNEL assay showed many cells exhibited apoptosis, which was associated with downregulated BCL-2/BCL-XL-associated death promoter (Bad), inhibitor of apoptosis protein (IAP), Cytochrome c (CytC) and upregulated tumor necrosis factor receptor 1 (TNF-R1); lastly, gene sequencing reported a total of 924 mobilized genes, among which 13 of the downregulated and 19 of the upregulated genes were common to the AD pathway. The present study not only established AD models in TS, but also reported on the underlying mechanism involved in neuronal apoptosis associated with multiple gene expression.

  12. Leisure activities, apolipoprotein E e4 status, and the risk of dementia.

    Science.gov (United States)

    Yang, Sheng-Ying; Weng, Pei-Hsuan; Chen, Jen-Hau; Chiou, Jeng-Min; Lew-Ting, Chih-Yin; Chen, Ta-Fu; Sun, Yu; Wen, Li-Li; Yip, Ping-Keung; Chu, Yi-Min; Chen, Yen-Ching

    2015-12-01

    Leisure activities have been associated with a decreased risk of dementia. However, to date, no study has explored how apolipoprotein E (ApoE) e4 status or vascular risk factors modified the association between leisure activities and dementia risks. This case-control study recruited patients (age ≥ 60 years) with Alzheimer's disease (AD; n = 292) and vascular dementia (VaD; n = 144) and healthy controls (n = 506) from three teaching hospitals in Taiwan between 2007 and 2010. Information on patient's leisure activities were obtained through a questionnaire. Conditional logistic regression models were used to assess the association of leisure activities and ApoE e4 status with the risk of dementia. High-frequency physical activity was associated with a decreased risk of AD [adjusted odds ratio (AOR) = 0.45], and the results become more evident among ApoE e4 carriers with AD (AOR = 0.30) and VaD (AOR = 0.26). Similar findings were observed for cognitive (AOR = 0.42) and social activities (AOR = 0.55) for AD. High-frequency physical, cognitive, and social activities were associated with a decreased risk of VaD (AOR = 0.29-0.60). Physical and social activities significantly interacted with each other on the risk of VaD (pinteraction = 0.04). Physical activity consistently protects against AD and VaD. Significant interactions were identified across different types of leisure activities in lowering dementia risk. Copyright © 2014. Published by Elsevier B.V.

  13. E-cigarette use and disparities by race, citizenship status and language among adolescents.

    Science.gov (United States)

    Alcalá, Héctor E; Albert, Stephanie L; Ortega, Alexander N

    2016-06-01

    E-cigarette use among adolescents is on the rise in the U.S. However, limited attention has been given to examining the role of race, citizenship status and language spoken at home in shaping e-cigarette use behavior. Data are from the 2014 Adolescent California Health Interview Survey, which interviewed 1052 adolescents ages 12-17. Lifetime e-cigarette use was examined by sociodemographic characteristics. Separate logistic regression models predicted odds of ever-smoking e-cigarettes from race, citizenship status and language spoken at home. Sociodemographic characteristics were then added to these models as control variables and a model with all three predictors and controls was run. Similar models were run with conventional smoking as an outcome. 10.3% of adolescents ever used e-cigarettes. E-cigarette use was higher among ever-smokers of conventional cigarettes, individuals above 200% of the Federal Poverty Level, US citizens and those who spoke English-only at home. Multivariate analyses demonstrated that citizenship status and language spoken at home were associated with lifetime e-cigarette use, after accounting for control variables. Only citizenship status was associated with e-cigarette use, when controls variables race and language spoken at home were all in the same model. Ever use of e-cigarettes in this study was higher than previously reported national estimates. Action is needed to curb the use of e-cigarettes among adolescents. Differences in lifetime e-cigarette use by citizenship status and language spoken at home suggest that less acculturated individuals use e-cigarettes at lower rates. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Strongly coupled band in 140Gd

    International Nuclear Information System (INIS)

    Falla-Sotelo, F.; Oliveira, J.R.B.; Rao, M.N.

    2005-01-01

    Several high-K states are known to exist in the mass 130-140 region. For the N=74 even-even isotopes, Kπ = 8 - isomers, with lifetimes ranging from ns to ms, are known in 128 Xe, 130 Ba, 132 Ce, 134 Nd, 136 Sm, and 138 Gd[. In 140 Gd, we have observed for the first time a band also based on an Iπ = 8 - state. This could be the first case of a Kπ = 8 - state observed in an N=76 even-even isotope. The systematics of the Kπ = 8 - isomeric states in N=74 isotopes has been studied by A.M. Bruce et al. These states decay towards the K = 0 ground state band, and the transitions are K-forbidden. The 140 Gd case presents strong similarities but also some significant differences with relation to the N=74 isotopes. We propose the same configuration but with larger deformation in 140 Gd

  15. 41 CFR 101-4.140 - Dissemination of policy.

    Science.gov (United States)

    2010-07-01

    ... EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 101-4.140... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Dissemination of policy. 101-4.140 Section 101-4.140 Public Contracts and Property Management Federal Property Management...

  16. Measurement of hadron and lepton-pair production at 130 GeV $<$ $\\sqrt{s}$ $<$ 140 GeV at LEP

    CERN Document Server

    Acciarri, M; Adriani, O; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Ball, R C; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bencze, G L; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Boucham, A; Bourilkov, D; Bourquin, Maurice; Boutigny, D; Brambilla, Elena; Branson, J G; Brigljevic, V; Brock, I C; Buijs, A; Bujak, A T; Burger, J D; Burger, W J; Burgos, C; Busenitz, J K; Buytenhuijs, A O; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Castello, R; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chemarin, M; Chen, A; Chen, C; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Coan, T E; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Dai, T S; D'Alessandro, R; De Asmundis, R; De Boeck, H; Degré, A; Deiters, K; Dénes, E; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dorne, I; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabbretti, R; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Felcini, Marta; Ferguson, T; Fernández, D; Fernández, G; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Gailloud, M; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gerald, J; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; González, E; Gougas, Andreas; Goujon, D; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gustafson, H R; Gutay, L J; Hangarter, K; Hartmann, B; Hasan, A; He, J T; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Ilyas, M M; Innocente, Vincenzo; Janssen, H; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamyshkov, Yu A; Kapinos, P; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Koffeman, E; Köngeter, A; Koutsenko, V F; Koulbardis, A; Krämer, R W; Kramer, T; Krenz, W; Kuijten, H; Kunin, A; Ladrón de Guevara, P; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Leggett, C; Le Goff, J M; Leiste, R; Lenti, M; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lindemann, B; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Ludovici, L; Luminari, L; Lustermann, W; Ma Wen Gan; Macchiolo, A; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangla, S; Maolinbay, M; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; Mazumdar, K; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Möller, M; Monteleoni, B; Moore, R; Morganti, S; Mount, R; Müller, S; Muheim, F; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nippe, A; Nowak, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Raghavan, R; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Redaelli, M; Ren, D; Rescigno, M; Reucroft, S; Ricker, A; Riemann, S; Riemers, B C; Riles, K; Rind, O; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Röhner, S; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Salicio, J M; Sánchez, E; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Schöneich, B; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schulte, R; Schultze, K; Schwenke, J; Schwering, G; Sciacca, C; Seiler, P G; Sens, Johannes C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Siedenburg, T; Son, D; Sopczak, André; Soulimov, V; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Sticozzi, F; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Toker, O; Tonisch, F; Tonutti, M; Tonwar, S C; Tóth, J; Tsaregorodtsev, A Yu; Tully, C; Tuchscherer, H; Tung, K L; Ulbricht, J; Urbàn, L; Uwer, U; Valente, E; Van de Walle, R T; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vuilleumier, L; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Y F; Wang, Z M; Weber, A; Weill, R; Willmott, C; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zaccardelli, C; Zalite, A; Zemp, P; Zeng, J Y; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhou, G J; Zhou, Y; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Van der Zwaan, B C C

    1996-01-01

    We report on the first measurements of e+e- annihilations into hadrons and lepton pairs at center-of-mass energies between 130 GeV and 140 GeV. In a total luminosity of 5 pb-1 collected with the L3 detector at LEP we select 1577 hadronic and 401 lepton-pair events. The measured cross sections and leptonic forward-backward asymmetries agree well with the Standard Model predictions.

  17. Dicty_cDB: Contig-U11443-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cal protei... 141 8e-32 BC051184_1( BC051184 |pid:none) Mus musculus USP6 N-terminal like,... 140 1e-31 (Q80...XC3) RecName: Full=USP6 N-terminal-like protein; &AL845275_... 140 1e-31 AL845275...ns clone peg2130 HHL (HH... 140 1e-31 ( Q92738 ) RecName: Full=USP6 N-terminal-like protein; AltName: ...ns cDNA FLJ57209 complet... 110 2e-22 G88391( G88391 )protein R06B10.5 [imported...hnaafngyktvmqllldagadvnshdidfntalhktsftgyhkcaelli ergsqveardnhgitpliksassknfkclsvliergwckcklkr***

  18. 27 CFR 27.140 - Certification requirements for wine.

    Science.gov (United States)

    2010-04-01

    ... for wine. 27.140 Section 27.140 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Importer's Records and Reports Other Records § 27.140 Certification requirements for wine. (a) Definitions...

  19. 21 CFR 189.140 - Diethylpyrocarbonate (DEPC).

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Diethylpyrocarbonate (DEPC). 189.140 Section 189.140 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... alcoholic and nonalcoholic beverages. (b) Food containing any added or detectable level of DEPC is deemed to...

  20. Ion exchange separation of carrier-free 140Ba and 140La from their equilibrium mixture using nitrilotriacetic acid and ascorbic acid as eluents

    International Nuclear Information System (INIS)

    Das, N.R.; Bhattacharyya, S.N.

    1982-01-01

    A simple cation exchange procedure for separation of 140 Ba- 140 La using Dowex 50W-X8 and nitrilotriacetic acid or ascorbic acid as the eluent has been described. The optimal separation of the daughter from the parent has been achieved using a 4% Na-nitrilotriacetate or Na-ascorbate solution at pH 7. The parent, 140 Ba, left in the column can be eluted with dilute hydrochloric acid or it can be retained in the column for milking off the daughter, 140 La, when needed. The radiochemical purity of the separated isotopes, 140 Ba and 140 La, were verified by γ-ray spectrometry. (author)

  1. Search for excited leptons at 130-140 GeV

    Science.gov (United States)

    Buskulic, D.; de Bonis, I.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Odier, P.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Crespo, J. M.; Delfino, M.; Efthymiopoulos, I.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Orteu, S.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Girone, M.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Alemany, R.; Bazarko, A. O.; Cattaneo, M.; Comas, P.; Coyle, P.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Martin, E. B.; Mato, P.; Minten, A.; Miquel, R.; Mir, Ll. M.; Moneta, L.; Oest, T.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rensing, P.; Rolandi, L.; Schlatter, D.; Schmelling, M.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Venturi, A.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. B.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Zachariadou, K.; Blondel, A.; Brient, J. C.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Corden, M.; Georgiopoulos, C.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Reeves, P.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, F.; Thorn, S.; Turnbull, R. M.; Becker, U.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Schmidt, M.; Sommer, J.; Stenzel, H.; Tittel, K.; Werner, S.; Wunsch, M.; Abbaneo, D.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Stacey, A. M.; Williams, M. D.; Dissertori, G.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Sloan, T.; Whelan, E. P.; Williams, M. I.; Galla, A.; Greene, A. M.; Hoffmann, C.; Jacobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Bencheikh, A. M.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Diaconu, C.; Konstantinidis, N.; Payre, P.; Rousseau, D.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Bauer, C.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Dydak, F.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; Denis, R. St.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Park, H. J.; Schune, M.-H.; Simion, S.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Batignani, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Carpinelli, M.; Ciocci, M. A.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Rizzo, G.; Sanguinetti, G.; Sciabà, A.; Spagnolo, P.; Steinberger, J.; Tenchini, R.; Tonelli, G.; Vannini, C.; Verdini, P. G.; Walsh, J.; Blair, G. A.; Bryant, L. M.; Cerutti, F.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Emery, S.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Marx, B.; Perez, P.; Rander, J.; Renardy, J.-F.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Johnson, R. P.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Koksal, A.; Letho, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Böhrer, A.; Brandt, S.; Cowan, G.; Grupen, C.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Elmer, P.; Feng, Z.; Ferguson, D. P. S.; Gao, Y. S.; González, S.; Grahl, J.; Greening, T. C.; Hayes, O. J.; Hu, H.; McNamara, P. A.; Nachtman, J. M.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, A. M.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zheng, M.; Zobernig, G.; Aleph Collaboration

    1996-02-01

    A search for the radiative decay of excited charged leptons, ℓ ∗, and for radiative and weak decays of excited electron neutrinos, ν e∗, is performed, using the 5.8 pb -1 of data collected by ALEPH at 130-140 GeV. No evidence for a signal is found in single or pair production. Excluded mass limits from pair production are close to 65 GeV/ c2 for all excited lepton species. Limits on the couplings, {λ}/{m ℓ ∗}, of excited leptons are derived from single production. For an excited lepton mass of 130 GeV/ c2, these limits are 0.04 GeV -1 for μ ∗ and τ ∗, and 0.0007 GeV -1 for e ∗. For ν e∗, the limit is at the level of 0.03 GeV -1 for a mass of 120 GeV/ c2, independent of the decay branching ratios.

  2. Mass Spectrometry Analysis of Wild-Type and Knock-in Q140/Q140 Huntington's Disease Mouse Brains Reveals Changes in Glycerophospholipids Including Alterations in Phosphatidic Acid and Lyso-Phosphatidic Acid.

    Science.gov (United States)

    Vodicka, Petr; Mo, Shunyan; Tousley, Adelaide; Green, Karin M; Sapp, Ellen; Iuliano, Maria; Sadri-Vakili, Ghazaleh; Shaffer, Scott A; Aronin, Neil; DiFiglia, Marian; Kegel-Gleason, Kimberly B

    2015-01-01

    Huntington's disease (HD) is a neurodegenerative disease caused by a CAG expansion in the HD gene, which encodes the protein Huntingtin. Huntingtin associates with membranes and can interact directly with glycerophospholipids in membranes. We analyzed glycerophospholipid profiles from brains of 11 month old wild-type (WT) and Q140/Q140 HD knock-in mice to assess potential changes in glycerophospholipid metabolism. Polar lipids from cerebellum, cortex, and striatum were extracted and analyzed by liquid chromatography and negative ion electrospray tandem mass spectrometry analysis (LC-MS/MS). Gene products involved in polar lipid metabolism were studied using western blotting, immuno-electron microscopy and qPCR. Significant changes in numerous species of glycerophosphate (phosphatidic acid, PA) were found in striatum, cerebellum and cortex from Q140/Q140 HD mice compared to WT mice at 11 months. Changes in specific species could also be detected for other glycerophospholipids. Increases in species of lyso-PA (LPA) were measured in striatum of Q140/Q140 HD mice compared to WT. Protein levels for c-terminal binding protein 1 (CtBP1), a regulator of PA biosynthesis, were reduced in striatal synaptosomes from HD mice compared to wild-type at 6 and 12 months. Immunoreactivity for CtBP1 was detected on membranes of synaptic vesicles in striatal axon terminals in the globus pallidus. These novel results identify a potential site of molecular pathology caused by mutant Huntingtin that may impart early changes in HD.

  3. The Japanese Mutant Aβ (ΔE22-Aβ1–39) Forms Fibrils Instantaneously, with Low-Thioflavin T Fluorescence: Seeding of Wild-Type Aβ1-40 into Atypical Fibrils by ΔE22-Aβ1-39

    Science.gov (United States)

    Cloe, Adam L.; Orgel, Joseph P.R.O.; Sachleben, Joseph R.; Tycko, Robert; Meredith, Stephen C.

    2012-01-01

    The ΔE693 (Japanese) mutation of the β-amyloid precursor protein leads to production of ΔE22-Aβ peptides such as ΔE22-Aβ1–39. Despite reports that these peptides do not form fibrils, here we show that, on the contrary, the peptide forms fibrils essentially instantaneously. The fibrils are typical amyloid fibrils in all respects except that they cause only low levels of thioflavin T (ThT) fluorescence, which, however, develops with no lag phase. The fibrils bind ThT, but with a lower affinity and a smaller number of binding sites than wild-type (WT) Aβ1–40. Fluorescence depolarization confirms extremely rapid aggregation of ΔE22-Aβ1–39. Size exclusion chromatography (SEC) indicates very low concentrations of soluble monomer and oligomer, but only in the presence of some organic solvent, e.g., 2% (v/v) DMSO. The critical concentration is approximately 1 order of magnitude lower for ΔE22-Aβ1–39 than for WTAβ1–40. Several lines of evidence point to an altered structure for ΔE22-Aβ1–39 compared to that of WT Aβ1–40 fibrils. In addition to differences in ThT binding and fluorescence, PITHIRDS-CT solid-state nuclear magnetic resonance (NMR) measurements of ΔE22-Aβ1–39 are not compatible with the parallel in-register β-sheet generally observed for WT Aβ1–40 fibrils. X-ray fibril diffraction showed different D spacings: 4.7 and 10.4 Å for WT Aβ1–40 and 4.7 and 9.6 Å for ΔE22-Aβ1–39. Equimolar mixtures of ΔE22-Aβ1–39 and WT Aβ1–40 also produced fibrils extremely rapidly, and by the criteria of ThT fluorescence and electron microscopic appearance, they were the same as fibrils made from pure ΔE22-Aβ1–39. X-ray diffraction of fibrils formed from 1:1 molar mixtures of ΔE22-Aβ1–39 and WT Aβ1–40 showed the same D spacings as fibrils of the pure mutant peptide, not the wild-type peptide. These findings are consistent with extremely rapid nucleation by ΔE22-Aβ1–39, followed by fibril extension by WT Aβ1–40, and

  4. Differential Antibody Responses to Conserved HIV-1 Neutralizing Epitopes in the Context of Multivalent Scaffolds and Native-Like gp140 Trimers

    Directory of Open Access Journals (Sweden)

    Charles D. Morris

    2017-02-01

    Full Text Available Broadly neutralizing antibodies (bNAbs have provided valuable insights into the humoral immune response to HIV-1. While rationally designed epitope scaffolds and well-folded gp140 trimers have been proposed as vaccine antigens, a comparative understanding of their antibody responses has not yet been established. In this study, we probed antibody responses to the N332 supersite and the membrane-proximal external region (MPER in the context of heterologous protein scaffolds and native-like gp140 trimers. Ferritin nanoparticles and fragment crystallizable (Fc regions were utilized as multivalent carriers to display scaffold antigens with grafted N332 and MPER epitopes, respectively. Trimeric scaffolds were also identified to stabilize the MPER-containing BG505 gp140.681 trimer in a native-like conformation. Following structural and antigenic evaluation, a subset of scaffold and trimer antigens was selected for immunization in BALB/c mice. Serum binding revealed distinct patterns of antibody responses to these two bNAb targets presented in different structural contexts. For example, the N332 nanoparticles elicited glycan epitope-specific antibody responses that could also recognize the native trimer, while a scaffolded BG505 gp140.681 trimer generated a stronger and more rapid antibody response to the trimer apex than its parent gp140.664 trimer. Furthermore, next-generation sequencing (NGS of mouse splenic B cells revealed expansion of antibody lineages with long heavy-chain complementarity-determining region 3 (HCDR3 loops upon activation by MPER scaffolds, in contrast to the steady repertoires primed by N332 nanoparticles and a soluble gp140.664 trimer. These findings will facilitate the future development of a coherent vaccination strategy that combines both epitope-focused and trimer-based approaches.

  5. Dicty_cDB: Contig-U11302-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 304 e-140 EU128481_1( EU128481 |pid:none) Tanichthys albonubes beta-actin mR... 304 e-140 AF368030_1( AF3...actin gene... 307 e-139 EU128482_1( EU128482 |pid:none) Tanichthys albonubes beta

  6. Neodymium-140 DOTA-LM3: Evaluation of an In Vivo Generator for PET with a Non-Internalizing Vector

    CERN Document Server

    Severin, Gregory W.; Nielsen, Carsten H.; Fonslet, Jesper; Jensen, Andreas I.; Frellsen, Anders F.; Jensen, K. M.; Elema, Dennis R.; Maecke, Helmut; Kjær, Andreas; Johnston, Karl; Köster, Ulli

    2017-01-01

    140Nd (t1/2 = 3.4 days), owing to its short-lived positron emitting daughter 140Pr (t1/2 = 3.4 min), has promise as an in vivo generator for positron emission tomography (PET). However, the electron capture decay of 140Nd is chemically disruptive to macrocycle-based radiolabeling, meaning that an in vivo redistribution of the daughter 140Pr is expected before positron emission. The purpose of this study was to determine how the delayed positron from the de-labeled 140Pr affects preclinical imaging with 140Nd. To explore the effect, 140Nd was produced at CERN-ISOLDE, reacted with the somatostatin analogue, DOTA-LM3 (1,4,7,10- tetraazacyclododecane, 1,4,7- tri acetic acid, 10- acetamide N - p-Cl-Phecyclo(d-Cys-Tyr-d-4-amino-Phe(carbamoyl)-Lys-Thr-Cys)d-Tyr-NH2) and injected into H727 xenograft bearing mice. Comparative pre- and post-mortem PET imaging at 16 h postinjection was used to quantify the in vivo redistribution of 140Pr following 140Nd decay. The somatostatin receptor-positive pancreas exhibited the hi...

  7. An accurate method for computer-generating tungsten anode x-ray spectra from 30 to 140 kV.

    Science.gov (United States)

    Boone, J M; Seibert, J A

    1997-11-01

    A tungsten anode spectral model using interpolating polynomials (TASMIP) was used to compute x-ray spectra at 1 keV intervals over the range from 30 kV to 140 kV. The TASMIP is not semi-empirical and uses no physical assumptions regarding x-ray production, but rather interpolates measured constant potential x-ray spectra published by Fewell et al. [Handbook of Computed Tomography X-ray Spectra (U.S. Government Printing Office, Washington, D.C., 1981)]. X-ray output measurements (mR/mAs measured at 1 m) were made on a calibrated constant potential generator in our laboratory from 50 kV to 124 kV, and with 0-5 mm added aluminum filtration. The Fewell spectra were slightly modified (numerically hardened) and normalized based on the attenuation and output characteristics of a constant potential generator and metal-insert x-ray tube in our laboratory. Then, using the modified Fewell spectra of different kVs, the photon fluence phi at each 1 keV energy bin (E) over energies from 10 keV to 140 keV was characterized using polynomial functions of the form phi (E) = a0[E] + a1[E] kV + a2[E] kV2 + ... + a(n)[E] kVn. A total of 131 polynomial functions were used to calculate accurate x-ray spectra, each function requiring between two and four terms. The resulting TASMIP algorithm produced x-ray spectra that match both the quality and quantity characteristics of the x-ray system in our laboratory. For photon fluences above 10% of the peak fluence in the spectrum, the average percent difference (and standard deviation) between the modified Fewell spectra and the TASMIP photon fluence was -1.43% (3.8%) for the 50 kV spectrum, -0.89% (1.37%) for the 70 kV spectrum, and for the 80, 90, 100, 110, 120, 130 and 140 kV spectra, the mean differences between spectra were all less than 0.20% and the standard deviations were less than approximately 1.1%. The model was also extended to include the effects of generator-induced kV ripple. Finally, the x-ray photon fluence in the units of

  8. 11 CFR 101.1 - Candidate designations (2 U.S.C. 432(e)(1)).

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Candidate designations (2 U.S.C. 432(e)(1)). 101.1 Section 101.1 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CANDIDATE STATUS AND... and address, party affiliation, and office sought, the District and State in which Federal office is...

  9. Effects of Tang Niao Ning decoction on ET-1, GMP-140 and TXB2 in diabetic rats

    International Nuclear Information System (INIS)

    Song Jumin; Wang Lifen; Liao Han; Wang Wei; Hua Weiguo

    2003-01-01

    To investigate the effects of Tang Niao Ning decoction on fasting blood glucose (FBG), total cholesterol (TC), triglyceride (TG), endothelin (ET-1), platelet granule membrane protein (GMP-140), thromboxane B 2 (TXB 2 ), 6-keto-prostaglandin F 1α (6-keto-PGF 1α ), the selected female Wistar rats were modeled by streptozotocin (STZ) and high fat diets, and were randomly divided into two groups as Tang Niao Ning and model group, while the normal control group was set up. The Tang Niao Ning group started to supply decoctions after these rats had been fed one week with high fat diets. The rats were killed after six weeks. Above items were examed. The results showed that the model group displayed marked difference when the experiment finished compared with the normal group. The contents of fasting blood glucose and blood lipid were increased, accompanied with the phenomena of hoisting ET-1, enhancing GMP-140, increasing TXB 2 and droping 6-Keto-PGF 1α . After treatment in time with Tang Niao Ning decoction, all kinds of items were adjusted to normal level gradually. It suggested that the treatment with Tang Niao Ning decoction might decrease FBG and blood lipid. In some ways, the decoction could improve the signs of blood stasis. The regulation mechanisms of the decoction was characteristic of wholism through many channels

  10. Determination of the magnetic moment of $^{140}$Pr

    CERN Multimedia

    Kowalska, M; Kreim, K D; Krieger, A R; Litvinov, Y

    We propose to measure the nuclear magnetic moment of the neutron-deficient isotope $^{140}$Pr using collinear laser spectroscopy at the COLLAPS experiment. This nuclide is one of two nuclear systems for which a modulated electron capture decay has been observed in hydrogen-like ions in a storage ring. The firm explanation of the observed phenomenon is still missing but some hypotheses suggest an interaction of the unpaired electron with the surrounding magnetic fields of the ring. In order to verify or discard these hypotheses the magnetic moment of $^{140}$Pr is required since this determines the energy of the 1s hyperfine splitting.

  11. 34 CFR 21.1 - Equal Access to Justice Act.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Equal Access to Justice Act. 21.1 Section 21.1 Education Office of the Secretary, Department of Education EQUAL ACCESS TO JUSTICE General § 21.1 Equal Access to Justice Act. (a) The Equal Access to Justice Act (the Act) provides for the award of fees and...

  12. γ-γ directional angular correlations measurements for transitions in 140 Ce

    International Nuclear Information System (INIS)

    Zamboni, C.B.; Lapolli, A.L.; Silva Figueira, M.C. da; Yoneama, M.L.; Dias, J.F.; Medeiros, J.A.G. de.

    1990-01-01

    The directional correlations of coincident gamma transitions have been measured in 140 Ce following the β - decay of 140 La, with T 1/2 = 40,3 hs, using a spectrometer consisting of two Ge detectors. The measurements were carried out for 8 gamma cascades and the multipole mixing ratios, δ, for the majority gamma transitions were extracted from the present results. (author)

  13. Differential Antibody Responses to Conserved HIV-1 Neutralizing Epitopes in the Context of Multivalent Scaffolds and Native-Like gp140 Trimers.

    Science.gov (United States)

    Morris, Charles D; Azadnia, Parisa; de Val, Natalia; Vora, Nemil; Honda, Andrew; Giang, Erick; Saye-Francisco, Karen; Cheng, Yushao; Lin, Xiaohe; Mann, Colin J; Tang, Jeffrey; Sok, Devin; Burton, Dennis R; Law, Mansun; Ward, Andrew B; He, Linling; Zhu, Jiang

    2017-02-28

    Broadly neutralizing antibodies (bNAbs) have provided valuable insights into the humoral immune response to HIV-1. While rationally designed epitope scaffolds and well-folded gp140 trimers have been proposed as vaccine antigens, a comparative understanding of their antibody responses has not yet been established. In this study, we probed antibody responses to the N332 supersite and the membrane-proximal external region (MPER) in the context of heterologous protein scaffolds and native-like gp140 trimers. Ferritin nanoparticles and fragment crystallizable (Fc) regions were utilized as multivalent carriers to display scaffold antigens with grafted N332 and MPER epitopes, respectively. Trimeric scaffolds were also identified to stabilize the MPER-containing BG505 gp140.681 trimer in a native-like conformation. Following structural and antigenic evaluation, a subset of scaffold and trimer antigens was selected for immunization in BALB/c mice. Serum binding revealed distinct patterns of antibody responses to these two bNAb targets presented in different structural contexts. For example, the N332 nanoparticles elicited glycan epitope-specific antibody responses that could also recognize the native trimer, while a scaffolded BG505 gp140.681 trimer generated a stronger and more rapid antibody response to the trimer apex than its parent gp140.664 trimer. Furthermore, next-generation sequencing (NGS) of mouse splenic B cells revealed expansion of antibody lineages with long heavy-chain complementarity-determining region 3 (HCDR3) loops upon activation by MPER scaffolds, in contrast to the steady repertoires primed by N332 nanoparticles and a soluble gp140.664 trimer. These findings will facilitate the future development of a coherent vaccination strategy that combines both epitope-focused and trimer-based approaches. IMPORTANCE Both epitope-focused and trimer-based strategies are currently being explored in HIV-1 vaccine development, which aims to elicit broadly neutralizing

  14. Method of producing a solution of radioactive lanthanum-140 from radioactive barium-140 in an isotope generator and installation to carry out the method

    International Nuclear Information System (INIS)

    Akerman, K.; Jacobs, G.; Sauerwein, K.

    1979-01-01

    A method of separating radioactive lanthanum-140 from radioactive Ba-140 is proposed. The lanthanum-140 will be washed out of a sulphate precipitate and separated from Ba-140-sulphate by a granular filter mass of CaSO 4 and BaSO 4 . Details of the process are given. (UWI) [de

  15. Distribution pattern of macrozooplankton along the 140°E meridian in the Southern Ocean during austral summer 2002 and 2003

    Directory of Open Access Journals (Sweden)

    Atsushi Tanimura

    2008-03-01

    Full Text Available Field surveys were conducted along 140°E in the Southern Ocean north of Terre Adelie during three cruises: the KH cruise by RV Hakuho Maru, and TC1 and TC2 cruises by RV Tangaroa during the austral summers of 2002 and 2003. Macrozooplankton were sampled using a Rectangular Midwater Trawl (RMT 8: mesh size: 4.5mm; effective mouth area: 8m2 along each transect. Macrozooplankton communities were separated by the Southern Boundary of the Antarctic Circumpolar Current (SB-ACC based on cluster analysis. North of the SB-ACC, macrozooplankton assemblages comprised species of the northern oceanic community characterized by Salpa thompsoni, Euphausia frigida and Themisto gaudichaudii, while south of the SB-ACC, macrozooplankton assemblages were numerically dominated by Euphausia superba and/or Euphausia crystallorophias. It is suggested that the SB-ACC functions as the major biogeographic barrier to separate the macrozooplankton communities, and the contributions of macro- and meso-zooplankton to total zooplankton abundance varies seasonally as well as regionally in the Indian sector of the Southern Ocean crossing the SB-ACC.

  16. 28 CFR 0.140 - Authority relating to advertisements, and purchase of certain supplies and services.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Authority relating to advertisements, and purchase of certain supplies and services. 0.140 Section 0.140 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Authorizations With Respect to Personnel and Certain Administrative Matters § 0.140 Authority...

  17. Annual Hanford Site Environmental Permitting Status Report

    International Nuclear Information System (INIS)

    HOMAN, N.A.

    2000-01-01

    The information contained in, and/or referenced in, this Annual Hanford Site Environmental Permitting Status Report addresses Permit Condition II.W (Other Permits and/or Approvals) of the Dangerous Waste Portion of the Resource Conservation and Recovery Act Permit for the Treatment, Storage, and Disposal of Dangerous Waste, issued by the Washington State Department of Ecology (WA7890008967). Condition II.W specifies that the Permittees are responsible for obtaining all other applicable federal, state, and local permits authorizing the development and operation of the Hanford Facility. This status report also addresses Permit Condition I.E.22, as interpreted in Section 12.1.25 of the Hanford Facility Dangerous Waste Permit Application, General Information Portion (DOE/RL-91-28, Rev. 4), that states this report will be prepared annually and a copy of this report will be placed in the Facility Operating Record, General Information file by October 1 of each year

  18. 9 CFR 381.140 - Relabeling poultry products.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Relabeling poultry products. 381.140... AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Labeling and Containers § 381.140...

  19. P.L. 110-140, "Energy Independence and Security Act of 2007", 2007

    Energy Technology Data Exchange (ETDEWEB)

    None

    2007-12-19

    The Energy Independence and Security Act of 2007 (EISA), signed into law on December 19, 2007, set forth an agenda for improving U.S. energy security across the entire economy. While industrial energy efficiency is specifically called out in Title IV, Subtitle D, other EISA provisions also apply to AMO activities.

  20. Nutritional Status Assessment (SMO 016E)

    Science.gov (United States)

    Smith, S. M.; Zwart, S. R.; Heer, M.; Ericson, K.; Coburn, S. P.; Booth, S. A.; Jones, J. A.; Lupton, J.

    2009-01-01

    Until 2006, it was not been possible to assess nutritional status of crewmembers on the ISS during flight because blood and urine could not be collected during ISS missions. Postflight observations of alterations in status of several nutrients are troubling, and we require the ability to monitor the status of these nutrients during flight to determine if there is a specific impetus or timeframe for these changes. In addition to the monitoring of crew nutritional status during flight, in-flight sample collection would allow better assessment of countermeasure effectiveness. Collecting samples during flight is one of the objectives of SMO 016E, and it is also designed to expand the current medical requirement for nutritional assessment (MR016L) to include additional normative markers for assessing crew health and countermeasure effectiveness. Additional markers of bone metabolism will be measured to better monitor bone health and the effectiveness of countermeasures to prevent bone resorption. New markers of oxidative damage will be measured to better assess the type of oxidative insults that occur during space flight. The array of nutritional assessment variables will be expanded to include ones that will allow us to better understand changes in folate, vitamin K, and vitamin B6 status, as well as risk factors for cardiovascular and oxidative damage during and after flight. Stress hormones and hormones that affect bone and muscle metabolism will also be measured. Measuring these additional variables will allow us to better monitor the health of crewmembers and make more accurate recommendations for their rehabilitation. Several nutritional assessment variables are altered at landing, but it is not known how long these changes persist. We extended the original protocol to include an additional postflight blood and urine sample collection 30 days after landing. Data are being collected before, during, and after flight. These data will provide a complete survey of how

  1. A study on relations between the levels of GMP-140 and microangiopathy in NIDDM

    International Nuclear Information System (INIS)

    Du Tongxin; Wang Zizheng; Shi Hongzhen

    1995-01-01

    The relations between the level of GMP-140 and microangiopathy in NIDDM for earlier diagnosis or better treatment are investigated, the level of GMP-140 in both platelet and plasma was measured. The level of GMP-140 in both platelet and plasma in 104 cases with NIDDM (55 with and 49 without microagiopathy) and 38 controls were assayed by RIA and also simultaneously with direct platelet count. The level of GMP-140 in both platelet and plasma in NIDDM was remarkably higher than that in controls (P 1 = 0.69, r 2 = 0.75). No differences existed in platelet count between NIDDM and controls. The level of GMP-140 and ophthalmoscopic study had no change after decreasing the concentration of blood glucose (<7.8 mmol/L) and administrating aspirin for 6 months. Microangiopathy in NIDDM had close relation with platelet function and the level of GMP-140

  2. Mapping of p140Cap phosphorylation sites

    DEFF Research Database (Denmark)

    Repetto, Daniele; Aramu, Simona; Boeri Erba, Elisabetta

    2013-01-01

    phosphorylation and tunes its interactions with other regulatory molecules via post-translation modification. In this work, using mass spectrometry, we found that p140Cap is in vivo phosphorylated on tyrosine (Y) within the peptide GEGLpYADPYGLLHEGR (from now on referred to as EGLYA) as well as on three serine...... residues. Consistently, EGLYA has the highest score of in silico prediction of p140Cap phosphorylation. To further investigate the p140Cap function, we performed site specific mutagenesis on tyrosines inserted in EGLYA and EPLYA, a second sequence with the same highest score of phosphorylation. The mutant...

  3. 26 CFR 1.941-1 - Special deduction for China Trade Act corporations.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES China Trade Act Corporations § 1.941-1 Special deduction for China Trade Act corporations. In addition to the deductions from taxable income otherwise allowed such a corporation, a China Trade Act corporation is, under certain conditions, allowed an additional deduction in...

  4. The relationship of socioeconomic status with coronary artery calcification and pericardial fat.

    Science.gov (United States)

    Nafakhi, Hussein; Almosawi, Abdulameer; Alnafakh, Hasan; Mousa, Widad

    2017-01-01

    Little data currently exist supporting the correlation of socioeconomic status (SES) to markers of subclinical coronary atherosclerosis. The main aim was to investigate the relationship of SES measured by economic status and educational level with coronary artery calcification (CAC) and pericardial fat volume (PFV) assessed by multi-detector computed tomography (MDCT). A total of 220 consecutive patients with suspected coronary artery disease, who underwent 64-slice MDCT angiography for assessment of coronary atherosclerosis, were recruited between January 2014 and March 2015. Of these, 186 patients were enrolled in this cross sectional study. Low economic status patients showed higher PFV values; median (inter-quartile range [IQR] was 94 [50-140] cm3, p = 0.00001 and r = 0.37, compared to patients with high economic status, and this association persisted even after multiple logistic regression to conventional cardiac risk factors (p = 0.004, CI 7.3-30.4), while patients with low economic status reported a higher calcium score (but statistically non significant) (p = 0.12) compared to high economic status patients. Pa-tients with no formal education showed higher PFV (median [IQR] was 93 [48-140] cm3, p = 0.01) compared to patients with bachelor's degree (median [IQR] was 56 [28-92] cm3), but this association was attenuated after further adjustment for conventional cardiac risk factors (p = 0.1, CI -9.52-10.88), while CAC showed no significant correlation with educational level (p = 0.2, r = 0.117). Socioeconomic status, particularly economic status measure, reported a significant inverse relationship with PFV independent of conventional cardiac risk factors.

  5. P.L. 110-140, "Energy Independence and Security Act of 2007" (2007)

    Energy Technology Data Exchange (ETDEWEB)

    None

    2007-12-13

    An act to move the United States toward greater energy independence and security, to increase the production of clean renewable fuels, to protect consumers, to increase the efficiency of products, buildings, and vehicles, to promote research on and deploy greenhouse gas capture and storage options, and to improve the energy performance of the Federal Government, and for other purposes.

  6. The Na+/K+-ATPase and the amyloid-beta peptide aβ1-40 control the cellular distribution, abundance and activity of TRPC6 channels.

    Science.gov (United States)

    Chauvet, Sylvain; Boonen, Marielle; Chevallet, Mireille; Jarvis, Louis; Abebe, Addis; Benharouga, Mohamed; Faller, Peter; Jadot, Michel; Bouron, Alexandre

    2015-11-01

    The Na(+)/K(+)-ATPase interacts with the non-selective cation channels TRPC6 but the functional consequences of this association are unknown. Experiments performed with HEK cells over-expressing TRPC6 channels showed that inhibiting the activity of the Na(+)/K(+)-ATPase with ouabain reduced the amount of TRPC6 proteins and depressed Ca(2+) entry through TRPC6. This effect, not mimicked by membrane depolarization with KCl, was abolished by sucrose and bafilomycin-A, and was partially sensitive to the intracellular Ca(2+) chelator BAPTA/AM. Biotinylation and subcellular fractionation experiments showed that ouabain caused a multifaceted redistribution of TRPC6 to the plasma membrane and to an endo/lysosomal compartment where they were degraded. The amyloid beta peptide Aβ(1-40), another inhibitor of the Na(+)/K(+)-ATPase, but not the shorter peptide Aβ1-16, reduced TRPC6 protein levels and depressed TRPC6-mediated responses. In cortical neurons from embryonic mice, ouabain, veratridine (an opener of voltage-gated Na(+) channel), and Aβ(1-40) reduced TRPC6-mediated Ca(2+) responses whereas Aβ(1-16) was ineffective. Furthermore, when Aβ(1-40) was co-added together with zinc acetate it could no longer control TRPC6 activity. Altogether, this work shows the existence of a functional coupling between the Na(+)/K(+)-ATPase and TRPC6. It also suggests that the abundance, distribution and activity of TRPC6 can be regulated by cardiotonic steroids like ouabain and the naturally occurring peptide Aβ(1-40) which underlines the pathophysiological significance of these processes. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Toxic Substances Control Act (TSCA) 8(e) Notices and FYI Submissions

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 8(e) of the Toxic Substances Control Act (TSCA) requires U.S. chemical manufacturers, importers, processors and distributors to notify EPA within 30 calendar...

  8. Evaluation of the excitation function for the dosimetry reaction La-139(n,g)La-140

    International Nuclear Information System (INIS)

    Zolotarev, K.

    1997-01-01

    The activation detectors on the basis of La-139(n,g)La-140 reaction are used very often in the reactor dosimetry for determination of thermal and epithermal components of neutron spectra. At present, the cross section data for this reaction are absent in the IRDF-90 ver.2 file and in the national dosimetry files such as ENDF/B-VI Dosimetry File and JENDL-3.2 Dosimetry File. The evaluation of the La-139(n,g)La-140 reaction excitation function for the Russian Reactor Dosimetry File (RRDF-96) was carried out in the energy region 1.000E-05 eV - 20 MeV. The capture cross section in the energy range from 0.00001 eV to 160 keV is given through the evaluated MLBW resolved and unresolved resonance parameters. Small background cross section was added in the resolved resonance region for taking into account the non-statistical reaction mechanism contribution. Data for En=160 keV - 1.2 MeV were obtained from evaluated average parameters in the unresolved resonance region with taking into account the competition with the neutron inelastic channels. The La-139 radiative capture cross section between 1.2 MeV and 7.6 MeV was evaluated by means of statistical analysis of the experimental data. Above 7.6 MeV the data fit was joint to the theoretical capture cross sections calculated between 7.6 and 20 MeV. Theoretical results were normalized to the evaluated value obtained from analysis experimental data at En= 14.4 - 14.8 MeV. The results of the present evaluation were compared with the ENDF/B-VI cross section data and the recommended values of resonance integral and capture cross section at En=0.0253 eV. (author)

  9. E-Commerce Education in China: Driving Forces, Status, and Strategies

    OpenAIRE

    Xianfeng Zhang; Qi Li; Z. Lin

    2005-01-01

    With an explosive growth of e-businesses worldwide, e-commerce in China is booming, leading to the development of e-commerce education. This paper is intended to investigate whether the education system in China accords well with the market demand and the status of e-commerce programs in China in order to seek strategies for China to cope with the challenges of global e-commerce empowered by fast updated information technologies. First, we construct a four-layer conceptual model to describe t...

  10. Unconstitutionality of Section 170 (e) of the price Anderson Act

    International Nuclear Information System (INIS)

    1977-01-01

    Several environmental protection groups in the State of North Carolina have recently contested the conformity with the United States Constitution of Section 170 (e) of the Atomic Energy Act (Price-Anderson Act). The court seized of the question (the United States District Court for the western district of North Carolina, Charlotte Division) held in March 1977 that this Section and the other provisions of the Atomic Energy Act concerning implementation of the $560 million limitation of liability for nuclear damage were unconstitutional and unenforceable insofar as they applied to nuclear incidents occurring inside the United States. The defendants, the former United States Atomic Energy Commission and its then Commissioners as well as the Duke Power Company (the local electricity company) will appeal this decision. The note on case law analyses the arguments retained by the court. (NEA) [fr

  11. 40 CFR 96.140 - State trading budgets.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false State trading budgets. 96.140 Section...) NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS FOR STATE IMPLEMENTATION PLANS CAIR NOX Allowance Allocations § 96.140 State trading budgets. The State trading budgets for annual...

  12. The E-ELT program status

    Science.gov (United States)

    Tamai, Roberto; Cirasuolo, Michele; González, Juan Carlos; Koehler, Bertrand; Tuti, Mauro

    2016-07-01

    ESO is now fully engaged in building the European Extremely Large Telescope (E-ELT), a 40-m class optical nearinfrared telescope to be installed on top of Cerro Armazones, Chile and become operational around 2025. The Programme was formally approved by ESO Council back in 2012. However the required funding level for starting construction was actually reached in 2014, leading to a Green Light to start large construction contracts in December of that year. Since then, the programme has entered a very busy phase leading to the signature of the first major industrial contracts as well as the agreements with scientific institutes in ESO Member States to design and built the first suite of science instruments. This paper summarizes the current status of the E-ELT Programme and presents some aspects related to scientific objectives, managerial organization, programmatic aspects and system engineering approach. It also outlines the procurement strategies put in place to achieve the goal of the Programme: building the 'world's biggest eye on the sky' within the next decade.

  13. 40 CFR 97.140 - State trading budgets.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false State trading budgets. 97.140 Section...) FEDERAL NOX BUDGET TRADING PROGRAM AND CAIR NOX AND SO2 TRADING PROGRAMS CAIR NOX Allowance Allocations § 97.140 State trading budgets. The State trading budgets for annual allocations of CAIR NOX allowances...

  14. 21 CFR 163.140 - Skim milk chocolate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Skim milk chocolate. 163.140 Section 163.140 Food... milk chocolate. (a) Description. Skim milk chocolate is the food that conforms to the standard of identity, and is subject to the requirements for label declaration of ingredients for milk chocolate in...

  15. 40 CFR 1054.140 - What is my engine's maximum engine power and displacement?

    Science.gov (United States)

    2010-07-01

    ... internal diameter of 6.00 cm and a 6.25 cm stroke length, the rounded displacement would be: (1) × (6.00/2... power and displacement? 1054.140 Section 1054.140 Protection of Environment ENVIRONMENTAL PROTECTION... engine power and displacement? This section describes how to quantify your engine's maximum engine power...

  16. Changes of platelet GMP-140 in diabetic nephropathy and its multi-factor regression analysis

    International Nuclear Information System (INIS)

    Wang Zizheng; Du Tongxin; Wang Shukui

    2001-01-01

    The relation of platelet GMP-140 and its related factors with diabetic nephropathy was studied. 144 patients of diabetic mellitus without nephropathy (group without DN, mean suffering duration of 25.5 +- 18.6 months); 80 with diabetic nephropathy (group DN, mean suffering duration of 58.7 +- 31.6 months) and 50 normal controls were chosen in the research. Platelet GMP-140, plasma α 1 -MG, β 2 -MG, and 24 hour urine albumin (ALB), IgG, α 1 -MG, β 2 -MG were detected by RIA, while HBA 1 C via chromatographic separation and FBG, PBG, Ch, TG, HDL, FG via biochemical methods. All the data had been processed with software on computer with t-test and linear regression, and multi-factor analysis were done also. The levels of platelet GMP-140, FG, DBP, TG, HBA 1 C and PBG in group DN were significantly higher than those of group without DN and normal control (P 0.05), while they were higher than those of normal controls. Multi-factor analysis of platelet GMP-140 with TG, DBP and HBA 1 C were performed in 80 patients with DN (P 1 C are the independent factors enhancing the activation of platelets. The disturbance of lipid metabolism in type II diabetic mellitus may also enhance the activation of platelets. Elevation of blood pressure may accelerate the initiation and deterioration of DN in which change of platelet GMP-140 is an independent factor. Elevation of HBA 1 C and blood glucose are related closely to the diabetic nephropathy

  17. Construction and expression of a functional monoclonal antibody SZ-51 specific for GMP-140 chimeric fab fragment in Escherichia coli

    International Nuclear Information System (INIS)

    Gu Jianming; Zhang Xiaomin; Xia Lijun; Wan Haiying; Liu Yue; Li Peixia; Ruan Changgeng

    1996-04-01

    The variable region cDNAs of a monoclonal antibody SZ-51 specific for α-granule membrane protein (GMP-140) on the surface of activated human platelets were spliced with the constant region cDNA of the heavy chain CH1 and light chain k of human Ig G by means of the gene recombination techniques. The above recombinant gene was amplified by the polymerase chain reaction (PCR). The expression vector of phage plasmid pHEN1 SZ-51 Fab/Hu was constructed. The pHEN1-51 Fab/Hu was introduced into non-suppressor E. coli HB2151. The amount of expression of SZ-51 chimeric Fab/Hu measured by quantitative ELISA was about 500 μg/L. Western blot demonstrated that the SZ-51 chimeric Fab fragment could specifically bind to GMP-140. (2 figs.)

  18. GP140/CDCPI in the Development of Prostate Cancer Metastasis

    Science.gov (United States)

    2013-09-01

    localization of Gp140 to the plasma membrane of prostate epithelial cells is decreased or lost in PIN, invasive and metastatic prostate cancers when...Matrigel (BD Biosciences, Franklin Lakes, NJ) at 2000 cells per well. Spheroid structures were extracted and expanded in regu- lar tissue culture, and...cell surface (Figure 2A). Some surface-negative cells express E-cadherin in the cytoplasm. Cells were cultured in Matrigel, and spheroid structures

  19. Strongly coupled band in {sup 140}Gd

    Energy Technology Data Exchange (ETDEWEB)

    Falla-Sotelo, F.; Oliveira, J.R.B.; Rao, M.N. [Instituto de Fisica, Universidade de Sao Paulo, Sao Paulo (Brazil)] (and others)

    2005-07-01

    Several high-K states are known to exist in the mass 130-140 region. For the N=74 even-even isotopes, K{pi} = 8{sup -} isomers, with lifetimes ranging from ns to ms, are known in {sup 128}Xe, {sup 130}Ba, {sup 132}Ce, {sup 134}Nd, {sup 136}Sm, and {sup 138}Gd[. In {sup 140}Gd, we have observed for the first time a band also based on an I{pi} = 8{sup -} state. This could be the first case of a K{pi} = 8{sup -} state observed in an N=76 even-even isotope. The systematics of the K{pi} = 8{sup -} isomeric states in N=74 isotopes has been studied by A.M. Bruce et al. These states decay towards the K = 0 ground state band, and the transitions are K-forbidden. The {sup 140}Gd case presents strong similarities but also some significant differences with relation to the N=74 isotopes. We propose the same configuration but with larger deformation in {sup 140}Gd.

  20. 33 CFR 106.140 - Maritime Security (MARSEC) Directive.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Maritime Security (MARSEC... SECURITY MARITIME SECURITY MARINE SECURITY: OUTER CONTINENTAL SHELF (OCS) FACILITIES General § 106.140 Maritime Security (MARSEC) Directive. All OCS facility owners or operators subject to this part must comply...

  1. The Human Papillomavirus Type 16 E6 Oncoprotein Activates mTORC1 Signaling and Increases Protein Synthesis ▿ †

    OpenAIRE

    Spangle, Jennifer M.; Münger, Karl

    2010-01-01

    The mammalian target of rapamycin (mTOR) kinase acts as a cellular rheostat that integrates signals from a variety of cellular signal transduction pathways that sense growth factor and nutrient availability as well as intracellular energy status. It was previously reported that the human papillomavirus type 16 (HPV16) E6 oncoprotein may activate the S6 protein kinase (S6K) through binding and E6AP-mediated degradation of the mTOR inhibitor tuberous sclerosis complex 2 (TSC2) (Z. Lu, X. Hu, Y....

  2. Whole Genome DNA Methylation Analysis of Obstructive Sleep Apnea: IL1R2, NPR2, AR, SP140 Methylation and Clinical Phenotype.

    Science.gov (United States)

    Chen, Yung-Che; Chen, Ting-Wen; Su, Mao-Chang; Chen, Chung-Jen; Chen, Kuang-Den; Liou, Chia-Wei; Tang, Petrus; Wang, Ting-Ya; Chang, Jen-Chieh; Wang, Chin-Chou; Lin, Hsin-Ching; Chin, Chien-Hung; Huang, Kuo-Tung; Lin, Meng-Chih; Hsiao, Chang-Chun

    2016-04-01

    We hypothesized that DNA methylation patterns may contribute to disease severity or the development of hypertension and excessive daytime sleepiness (EDS) in patients with obstructive sleep apnea (OSA). Illumina's (San Diego, CA, USA) DNA methylation 27-K assay was used to identify differentially methylated loci (DML). DNA methylation levels were validated by pyrosequencing. A discovery cohort of 15 patients with OSA and 6 healthy subjects, and a validation cohort of 72 patients with sleep disordered breathing (SDB). Microarray analysis identified 636 DMLs in patients with OSA versus healthy subjects, and 327 DMLs in patients with OSA and hypertension versus those without hypertension. In the validation cohort, no significant difference in DNA methylation levels of six selected genes was found between the primary snoring subjects and OSA patients (primary outcome). However, a secondary outcome analysis showed that interleukin-1 receptor 2 (IL1R2) promoter methylation (-114 cytosine followed by guanine dinucleotide sequence [CpG] site) was decreased and IL1R2 protein levels were increased in the patients with SDB with an oxygen desaturation index > 30. Androgen receptor (AR) promoter methylation (-531 CpG site) and AR protein levels were both increased in the patients with SDB with an oxygen desaturation index > 30. Natriuretic peptide receptor 2 (NPR2) promoter methylation (-608/-618 CpG sites) were decreased, whereas levels of both NPR2 and serum C type natriuretic peptide protein were increased in the SDB patients with EDS. Speckled protein 140 (SP140) promoter methylation (-194 CpG site) was increased, and SP140 protein levels were decreased in the patients with SDB and EDS. IL1R2 hypomethylation and AR hypermethylation may constitute an important determinant of disease severity, whereas NPR2 hypomethylation and SP140 hypermethylation may provide a biomarker for vulnerability to EDS in OSA. A commentary on this article appears in this issue on page 723. © 2016

  3. 8 CFR 245.3 - Adjustment of status under section 13 of the Act of September 11, 1957, as amended.

    Science.gov (United States)

    2010-01-01

    ..., any alien who is prima facie eligible for adjustment of status to that of a lawful permanent resident... Act who performed diplomatic or semi-diplomatic duties and to their immediate families, and who... residence would be in the national interest. Aliens whose duties were of a custodial, clerical, or menial...

  4. 8 CFR 1245.3 - Adjustment of status under section 13 of the Act of September 11, 1957, as amended.

    Science.gov (United States)

    2010-01-01

    ... whose status may be adjusted under section 13, any alien who is prima facie eligible for adjustment of...)(15)(G)(ii) of the Immigration and Nationality Act who performed diplomatic or semi-diplomatic duties... duties were of a custodial, clerical, or menial nature, and members of their immediate families, are not...

  5. PML nuclear body component Sp140 is a novel autoantigen in primary biliary cirrhosis.

    Science.gov (United States)

    Granito, Alessandro; Yang, Wei-Hong; Muratori, Luigi; Lim, Mark J; Nakajima, Ayako; Ferri, Silvia; Pappas, Georgios; Quarneti, Chiara; Bianchi, Francesco B; Bloch, Donald B; Muratori, Paolo

    2010-01-01

    Some patients with primary biliary cirrhosis (PBC) have antinuclear antibodies (ANAs). These ANAs include the "multiple nuclear dots" (MND) staining pattern, targeting promyelocytic leukemia protein (PML) nuclear body (NB) components, such as "speckled 100-kD" protein (Sp100) and PML. A new PML NB protein, designated as Sp140, was identified using serum from a PBC patient. The aim of this study was to analyze the immune response against Sp140 protein in PBC patients. We studied 135 PBC patients and 157 pathological controls with type 1 autoimmune hepatitis, primary sclerosing cholangitis, and systemic lupus erythematosus. We used indirect immunofluorescence and a neuroblastoma cell line expressing Sp140 for detecting anti-Sp140 antibodies, and a commercially available immunoblot for detecting anti-Sp100 and anti-PML antibodies. Anti-Sp140 antibodies were present in 20 (15%) PBC patients but not in control samples, with a higher frequency in antimitochondrial antibody (AMA)-negative cases (53 vs. 9%, P<0.0001). Anti-Sp140 antibodies were found together with anti-Sp100 antibodies in all but one case (19 of 20, 90%) and with anti-PML antibodies in 12 (60%) cases. Anti-Sp140 positivity was not associated with a specific clinical feature of PBC. Our study identifies Sp140 as a new, highly specific autoantigen in PBC for the first time. The very frequent coexistence of anti-Sp140, anti-Sp100 and anti-PML antibodies suggests that the NB is a multiantigenic complex in PBC and enhances the diagnostic significance of these reactivities, which are particularly useful in AMA-negative cases.

  6. Status of the flora and fauna on the Nevada Test Site, 1992

    International Nuclear Information System (INIS)

    Hunter, R.B.

    1994-03-01

    This report documents changes in the populations of plants and animals on the Nevada Test Site (NTS) for calendar year 1992. It is part of a Department of Energy (DOE) program (Basic Environmental Compliance and Monitoring Program -- BECAMP) that also includes monitoring DOE compliance with the Endangered Species Act, the Historic Preservation Act, and the American Indian Freedom of Religion Act. Ecological studies were to comply with the National Environmental Policy Act and DOE Order 5400.1, ''General Environmental Protection Program.'' These studies focused on the following: status of ephemeral plants on the Nevada Test Site, 1992; status of reptile and amphibian populations on the Nevada Test Site, 1992; trends in small mammal populations on the Nevada Test Site, 1992; status of large mammals and birds at Nevada Test Site, 1992; and status of perennial plants on the Nevada Test Site, 1992

  7. Genetic Variations Involved in Vitamin E Status

    Directory of Open Access Journals (Sweden)

    Patrick Borel

    2016-12-01

    Full Text Available Vitamin E (VE is the generic term for four tocopherols and four tocotrienols that exhibit the biological activity of α-tocopherol. VE status, which is usually estimated by measuring fasting blood VE concentration, is affected by numerous factors, such as dietary VE intake, VE absorption efficiency, and VE catabolism. Several of these factors are in turn modulated by genetic variations in genes encoding proteins involved in these factors. To identify these genetic variations, two strategies have been used: genome-wide association studies and candidate gene association studies. Each of these strategies has its advantages and its drawbacks, nevertheless they have allowed us to identify a list of single nucleotide polymorphisms associated with fasting blood VE concentration and α-tocopherol bioavailability. However, much work remains to be done to identify, and to replicate in different populations, all the single nucleotide polymorphisms involved, to assess the possible involvement of other kind of genetic variations, e.g., copy number variants and epigenetic modifications, in order to establish a reliable list of genetic variations that will allow us to predict the VE status of an individual by knowing their genotype in these genetic variations. Yet, the potential usefulness of this area of research is exciting with regard to personalized nutrition and for future clinical trials dedicated to assessing the biological effects of the various isoforms of VE.

  8. Tenth act amending the German atomic energy act

    International Nuclear Information System (INIS)

    Heller, W.

    2009-01-01

    On January 14, 2009, the German federal government introduced into parliament the 10th Act Amending the Atomic Energy Act. In the first reading in the federal parliament, Federal Minister for the Environment Gabriel emphasized 2 main points: Intensified protection of nuclear facilities and of transports of radioactive substances against unauthorized interventions; transfer by law to the Federal Office for Radiological Protection (BfS) of decommissioning of the Asse mine. Reliability review: The amendment to Sec.12 b of the Atomic Energy Act is to meet the different safety and security conditions after the terrorist attacks on September 11, 2001 in the United States and other terrorist activities afterwards (London, Madrid) also with respect to hazards arising to nuclear facilities and nuclear transports. The bill must be seen in conjunction with the Ordinance on Reliability Reviews under the Atomic Energy Act dated July 1, 1999 which covers reviews of reliability of persons holding special responsibilities. Asse II mine: The competence of the Federal Office for Radiological Protection is achieved by an amendment to Sec.23, Para.1, Number 2, Atomic Energy Act, in which the words ''and for the Asse II mine'' are added after the word ''waste.'' Further proceedings depend on the additional provision in a new Sec.57 b, Atomic Energy Act. Accordingly, the operation and decommissioning of the Asse II mine are subject to the regulations applicable to facilities of the federation pursuant to Sec.9a, Para.3. In this way, Asse II is given the same legal status as the federal waste management facilities. Moreover, it is stipulated that the mine is to be shut down immediately. (orig.)

  9. Coincidence study of alpha particle fragmentation at E/sub alpha/ = 140 MeV

    International Nuclear Information System (INIS)

    Koontz, R.W.

    1980-01-01

    Results of an experimental study of the interaction of 140 MeV alpha particles with 90 Zr nuclei resulting in fragmentation of the alpha particle are reported. The experimental observations of the study are analyzed and are found to show that alpha particle breakup reactions leading to at least 4-body final states, composed of two charged alpha particle fragments, contribute significantly to the singles yield of charged fragments observed at a fixed forward angle. The conclusions are based on coincidence measurements where one charged fragment is detected at a small forward angle which remains fixed, while the second charged fragment is detected at a series of coplanar secondary angles. The largest coincidence charged particle yield for the multiparticle final state events results from 90 Zr(α,pp)X reactions, where both of the measured protons have energy distributions similar to the proton singles energy distributions. The second largest observed coincidence yield involving two charged fragments arises from 90 Zr(α,pd)X reactions, where the p and d fragments, as in the 90 Zr(α,pp)X reactions also have energy distribution similar to the singles energy distributions. Analysis of additional measurements, where alpha particle fragments at the fixed angle are detected in coincidence with evaporation and nonequilibrium particles at many coplanar angles, show that the alpha particle fragmentation reactions are also generally associated with large energy transfer to the target nucleus. A multiple scattering model of the fragmentation reaction is employed, in conjunction with the experimental observations, to estimate the cross sections for alpha particle fragmentation into multi-particle final states resulting in n, 2n, p, pp, d, dn, dp, t and 3 He fragments. The estimated total cross section for all fragmentation reactions is 755 mb or approximately 38% of the total reaction cross section for 140 MeV alpha particle interactions with 90 Zr

  10. 12 CFR 516.140 - How long is the comment period?

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 5 2010-01-01 2010-01-01 false How long is the comment period? 516.140 Section 516.140 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY APPLICATION PROCESSING PROCEDURES Comment Procedures § 516.140 How long is the comment period? (a) General. Except as...

  11. Status of E-Learning in Public Universities in Kenya

    Science.gov (United States)

    Makokha, George L.; Mutisya, Dorothy N.

    2016-01-01

    The purpose of this study was to assess the status of e-learning in public universities in Kenya. Data were collected using questionnaires administered to both students and lecturers randomly sampled from seven public universities. Questionnaire responses were triangulated with interviews from key informants and focus group discussions (FGDs).…

  12. Emotional or Behavioral Disorders: Background and Current Status of the E/BD Terminology and Definition.

    Science.gov (United States)

    Forness, Steven R.; Kavale, Kenneth A.

    2000-01-01

    This article reviews the development and current status of alternatives to the federal definition of emotional disturbance or behavior disorders. It notes that several states are now revising their own terminologies or definitions in response to the 1997 reauthorization of the Individuals with Disabilities Education Act that dropped the term…

  13. Dietary fish oil, and to a lesser extent the fat-1 transgene, increases astrocyte activation in response to intracerebroventricular amyloid-β 1-40 in mice.

    Science.gov (United States)

    Hopperton, Kathryn E; James, Nicholas C E; Mohammad, Dana; Irfan, Maha; Bazinet, Richard P

    2017-11-07

    Increases in astrocytes and one of their markers, glial fibrillary acidic protein (GFAP) have been reported in the brains of patients with Alzheimer's disease (AD). N-3 polyunsaturated fatty acids (PUFA) modulate neuroinflammation in animal models; however, their effect on astrocytes is unclear. Fat-1 mice and their wildtype littermates were fed either a fish oil diet or a safflower oil diet deprived of n-3 PUFA. At 12 weeks, mice underwent intracerebroventricular infusion of amyloid-β 1-40. Astrocyte phenotype in the hippocampus was assessed at baseline and 10 days post-surgery using immunohistochemistry with various microscopy and image analysis techniques. GFAP increased in all groups in response to amyloid-β, with a greater increase in fish oil-fed mice than either fat-1 or wildtype safflower oil-fed mice. Astrocytes in this group were also more hypertrophic, suggesting increased activation. Both fat-1- and fish oil-fed mice had greater increases in branch number and length in response to amyloid-β infusion than wildtype safflower animals. Fish oil feeding, and to a lesser extent the fat-1 transgene, enhances the astrocyte activation phenotype in response to amyloid-β 1-40. Astrocytes in mice fed fish oil were more activated in response to amyloid-β than in fat-1 mice despite similar levels of hippocampal n-3 PUFA, which suggests that other fatty acids or dietary factors contribute to this effect.

  14. Energy Independence and Security Act of 2007: A Summary of Major Provisions

    National Research Council Canada - National Science Library

    Sissine, Fred

    2007-01-01

    The Energy Independence and Security Act (P.L. 110-140, H.R. 6) is an omnibus energy policy law that consists mainly of provisions designed to increase energy efficiency and the availability of renewable energy...

  15. Quantitation of amyloid beta peptides Aβ(1-38), Aβ(1-40), and Aβ(1-42) in human cerebrospinal fluid by ultra-performance liquid chromatography-tandem mass spectrometry.

    Science.gov (United States)

    Lame, Mary E; Chambers, Erin E; Blatnik, Matthew

    2011-12-15

    Critical events in Alzheimer's disease (AD) involve an imbalance between the production and clearance of amyloid beta (Aβ) peptides from the brain. Current methods for Aβ quantitation rely heavily on immuno-based techniques. However, these assays require highly specific antibodies and reagents that are time-consuming and expensive to develop. Immuno-based assays are also characterized by poor dynamic ranges, cross-reactivity, matrix interferences, and dilution linearity problems. In particular, noncommercial immunoassays are especially subject to high intra- and interassay variability because they are not subject to more stringent manufacturing controls. Combinations of these factors make immunoassays more labor-intensive and often challenging to validate in support of clinical studies. Here we describe a mixed-mode solid-phase extraction method and an ultra-performance liquid chromatography tandem mass spectrometry (SPE UPLC-MS/MS) assay for the simultaneous quantitation of Aβ(1-38), Aβ(1-40), and Aβ(1-42) from human cerebrospinal fluid (CSF). Negative ion versus positive ion species were compared using their corresponding multiple reaction monitoring (MRM) transitions, and negative ions were approximately 1.6-fold greater in intensity but lacked selectivity in matrix. The positive ion MRM assay was more than sufficient to quantify endogenous Aβ peptides. Aβ standards were prepared in artificial CSF containing 5% rat plasma, and quality control samples were prepared in three pooled CSF sources. Extraction efficiency was greater than 80% for all three peptides, and the coefficient of variation during analysis was less than 15% for all species. Mean basal levels of Aβ species from three CSF pools were 1.64, 2.17, and 1.26 ng/ml for Aβ(1-38); 3.24, 3.63, and 2.55 ng/ml for Aβ(1-40); and 0.50, 0.63, and 0.46 ng/ml for Aβ(1-42). Copyright © 2011 Elsevier Inc. All rights reserved.

  16. NOS-mediated morphological and molecular modifications in rats infused with Aβ (1-40), as a model of Alzheimer's disease, in response to a new lipophilic molecular combination codrug-1.

    Science.gov (United States)

    Zara, Susi; Di Stefano, Antonio; Nasuti, Cinzia; Rapino, Monica; Patruno, Antonia; Pesce, Mirko; Sozio, Piera; Cerasa, Laura S; Cataldi, Amelia

    2011-04-01

    Alzheimer's disease is a neurodegenerative pathology due to the presence of β-amyloid plaques at brain level and hippocampus level and associated with the loss of memory speech and learning. At the basis of these effects lie molecular mechanisms which include nitric oxide metabolic pathway, whose involvement in the occurrence of morphological modifications related to such neurodegenerative process is suggested. Current evidences show that the non-steroidal anti-inflammatory drug ibuprofen posses a protective effect against the development of the disease, substantially delaying its onset; furthermore (R)-α-lipoic acid seems to have an antioxidant ameliorating effect on disease progression. Starting from these data, a new lipophilic codrug 1, obtained by joining an antioxidant molecule with an NSAID, has been previously synthesized. Our aim has been to investigate the possible therapeutical effects of codrug 1, compared to ibuprofen, on the molecular events at the basis of behavioural and morphological modifications occurring in Aβ (1-40) infused rat brains. Ibuprofen and codrug 1 seem to protect the subject against memory performance impairment and against behavioural detriment, induced by administration of Aβ (1-40) peptide. Such evidences are supported by morphological and biochemical findings showing Aβ (1-40) to determine cell disorganization, increased number of β-amyloid plaques and capillary vessels dilatation in parallel to increased total and specific NOS activity and to apoptosis occurrence, partly prevented by ibuprofen, more broadly by codrug 1. Such results underline the involvement of nitric oxide metabolic pathway in the events related to the onset of this pathology and suggest codrug 1 as a useful tool to protect the brain against cognitive and behavioural dysfunction, by reducing β-amyloid plaques formation and by inhibiting NOS signalling pathway and apoptosis occurrence. Copyright © 2010 Elsevier Inc. All rights reserved.

  17. Prediction of target genes for miR-140-5p in pulmonary arterial hypertension using bioinformatics methods.

    Science.gov (United States)

    Li, Fangwei; Shi, Wenhua; Wan, Yixin; Wang, Qingting; Feng, Wei; Yan, Xin; Wang, Jian; Chai, Limin; Zhang, Qianqian; Li, Manxiang

    2017-12-01

    The expression of microRNA (miR)-140-5p is known to be reduced in both pulmonary arterial hypertension (PAH) patients and monocrotaline-induced PAH models in rat. Identification of target genes for miR-140-5p with bioinformatics analysis may reveal new pathways and connections in PAH. This study aimed to explore downstream target genes and relevant signaling pathways regulated by miR-140-5p to provide theoretical evidences for further researches on role of miR-140-5p in PAH. Multiple downstream target genes and upstream transcription factors (TFs) of miR-140-5p were predicted in the analysis. Gene ontology (GO) enrichment analysis indicated that downstream target genes of miR-140-5p were enriched in many biological processes, such as biological regulation, signal transduction, response to chemical stimulus, stem cell proliferation, cell surface receptor signaling pathways. Kyoto Encyclopedia of Genes and Genome (KEGG) pathway analysis found that downstream target genes were mainly located in Notch, TGF-beta, PI3K/Akt, and Hippo signaling pathway. According to TF-miRNA-mRNA network, the important downstream target genes of miR-140-5p were PPI, TGF-betaR1, smad4, JAG1, ADAM10, FGF9, PDGFRA, VEGFA, LAMC1, TLR4, and CREB. After thoroughly reviewing published literature, we found that 23 target genes and seven signaling pathways were truly inhibited by miR-140-5p in various tissues or cells; most of these verified targets were in accordance with our present prediction. Other predicted targets still need further verification in vivo and in vitro .

  18. Suppressing Receptor-Interacting Protein 140: a New Sight for Salidroside to Treat Cerebral Ischemia.

    Science.gov (United States)

    Chen, Tong; Ma, Zhanqiang; Zhu, Lingpeng; Jiang, Wenjiao; Wei, Tingting; Zhou, Rui; Luo, Fen; Zhang, Kai; Fu, Qiang; Ma, Chunhua; Yan, Tianhua

    2016-11-01

    The purpose of the current study was to detect the effect of salidroside (Sal) on cerebral ischemia and explore its potential mechanism. Middle cerebral artery occlusion (MCAO) was performed to investigate the effects of Sal on cerebral ischemia. The rats were randomly divided into five groups: sham group, vehicle group, clopidogrel (7.5 mg/kg) group, Sal (20 mg/kg) group, and Sal (40 mg/kg) group. SH-SY5Y cells were exposed to ischemia-reperfusion (I/R) injury to verify the protective effect of Sal in vitro. We also built the stable receptor-interacting protein 140 (RIP140)-overexpressing SH-SY5Y cells. The results showed that Sal significantly reduces brain infarct size and cerebral edema. Sal could effectively decrease the levels of interleukin-6 (IL-6), interleukin-1β (IL-1β), and tumor necrosis factor-α (TNF-α) in serum of the MCAO rats and supernatant of I/R-induced SH-SY5Y cells. Immunohistochemical and Western blot results demonstrated that Sal inhibited RIP140-mediated inflammation and apoptosis in the MCAO rats and SH-SY5Y cells. In addition, we further confirmed that RIP140/NF-κB signaling plays a crucial role by evaluating the protein expression in RIP140-overexpressing SH-SY5Y cells. Our findings suggested that Sal could be used as an effective neuroprotective agent for cerebral ischemia due to its significant effect on preventing neuronal cell injury after cerebral ischemia both in vivo and in vitro by the inhibitions of RIP140-mediated inflammation and apoptosis.

  19. Development and testing of 140 GHz absorber coatings for the water baffle of W7-X cryopumps

    International Nuclear Information System (INIS)

    Floristan, Miriam; Mueller, Philipp; Gebhardt, Andreas; Killinger, Andreas; Gadow, Rainer; Cardella, Antonio; Li, Chuanfei; Stadler, Reinhold; Zangl, Guenter; Hirsch, Matthias; Laqua, Heinrich P.; Kasparek, Walter

    2011-01-01

    Due to the relatively high strayfield radiation (140 GHz) from the electron cyclotron radio frequency heating system to which the W7-X cryopumps are expected to be subjected, coating systems acting as an efficient absorber for 140 GHz radiation have been developed for the water-cooled baffle shield in order to reduce the thermal load on the liquid N shield and the liquid He cryopanel. Several types of oxide ceramic coatings were applied on planar copper substrates by Atmospheric Plasma Spraying. The influence of the process parameters on the coating properties and microwave absorbing capability was analysed. It was found that film thickness and microstructure of the sprayed coatings have a significant influence on microwave absorption behaviour. For Al 2 O 3 /TiO 2 coatings, absorption values over 90% were obtained for the 140 GHz probing beam. After optimisation of the coating structure for maximum microwave absorption, the coating procedure was adapted by special robot trajectories to the complex water baffle geometry. The selected spray parameters and kinematics were then used for the complete coating of four mock-ups, which have been tested in the W7-X strayfield test facility Mistral. The mock-ups showed absorption values of 75%.

  20. Development and testing of 140 GHz absorber coatings for the water baffle of W7-X cryopumps

    Energy Technology Data Exchange (ETDEWEB)

    Floristan, Miriam, E-mail: miriam.floristan@gsame.uni-stuttgart.de [Graduate School for advanced Manufacturing Engineering (GSaME), Universitaet Stuttgart (Germany); Institute for Manufacturing Technologies of Ceramic Components and Composites (IMTCCC), Universitaet Stuttgart, Allmandring 7 b, D-70569 Stuttgart (Germany); Mueller, Philipp; Gebhardt, Andreas; Killinger, Andreas; Gadow, Rainer [Institute for Manufacturing Technologies of Ceramic Components and Composites (IMTCCC), Universitaet Stuttgart, Allmandring 7 b, D-70569 Stuttgart (Germany); Cardella, Antonio [European Commission c/o Wendelstein 7X, Boltzmannstasse 2, D-85748 Garching (Germany); Li, Chuanfei; Stadler, Reinhold; Zangl, Guenter; Hirsch, Matthias; Laqua, Heinrich P. [Max-Planck-Institut fuer Plasmaphysik, EURATOM Assoc., Wendelsteinstrasse 1, D-17491 Greifswald (Germany); Kasparek, Walter [Institut fuer Plasmaforschung, Universitaet Stuttgart, Pfaffenwaldring 31, D-70569 Stuttgart (Germany)

    2011-10-15

    Due to the relatively high strayfield radiation (140 GHz) from the electron cyclotron radio frequency heating system to which the W7-X cryopumps are expected to be subjected, coating systems acting as an efficient absorber for 140 GHz radiation have been developed for the water-cooled baffle shield in order to reduce the thermal load on the liquid N shield and the liquid He cryopanel. Several types of oxide ceramic coatings were applied on planar copper substrates by Atmospheric Plasma Spraying. The influence of the process parameters on the coating properties and microwave absorbing capability was analysed. It was found that film thickness and microstructure of the sprayed coatings have a significant influence on microwave absorption behaviour. For Al{sub 2}O{sub 3}/TiO{sub 2} coatings, absorption values over 90% were obtained for the 140 GHz probing beam. After optimisation of the coating structure for maximum microwave absorption, the coating procedure was adapted by special robot trajectories to the complex water baffle geometry. The selected spray parameters and kinematics were then used for the complete coating of four mock-ups, which have been tested in the W7-X strayfield test facility Mistral. The mock-ups showed absorption values of 75%.

  1. 8 CFR 209.1 - Adjustment of status of refugees.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of refugees. 209.1... STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.1 Adjustment of status of refugees. The provisions of this section shall provide the sole and exclusive procedure for adjustment of status by a refugee...

  2. Silica Vesicle Nanovaccine Formulations Stimulate Long-Term Immune Responses to the Bovine Viral Diarrhoea Virus E2 Protein.

    Directory of Open Access Journals (Sweden)

    Karishma T Mody

    Full Text Available Bovine Viral Diarrhoea Virus (BVDV is one of the most serious pathogen, which causes tremendous economic loss to the cattle industry worldwide, meriting the development of improved subunit vaccines. Structural glycoprotein E2 is reported to be a major immunogenic determinant of BVDV virion. We have developed a novel hollow silica vesicles (SV based platform to administer BVDV-1 Escherichia coli-expressed optimised E2 (oE2 antigen as a nanovaccine formulation. The SV-140 vesicles (diameter 50 nm, wall thickness 6 nm, perforated by pores of entrance size 16 nm and total pore volume of 0.934 cm3 g(-1 have proven to be ideal candidates to load oE2 antigen and generate immune response. The current study for the first time demonstrates the ability of freeze-dried (FD as well as non-FD oE2/SV140 nanovaccine formulation to induce long-term balanced antibody and cell mediated memory responses for at least 6 months with a shortened dosing regimen of two doses in small animal model. The in vivo ability of oE2 (100 μg/SV-140 (500 μg and FD oE2 (100 μg/SV-140 (500 μg to induce long-term immunity was compared to immunisation with oE2 (100 μg together with the conventional adjuvant Quil-A from the Quillaja saponira (10 μg in mice. The oE2/SV-140 as well as the FD oE2/SV-140 nanovaccine generated oE2-specific antibody and cell mediated responses for up to six months post the final second immunisation. Significantly, the cell-mediated responses were consistently high in mice immunised with oE2/SV-140 (1,500 SFU/million cells at the six-month time point. Histopathology studies showed no morphological changes at the site of injection or in the different organs harvested from the mice immunised with 500 μg SV-140 nanovaccine compared to the unimmunised control. The platform has the potential for developing single dose vaccines without the requirement of cold chain storage for veterinary and human applications.

  3. A doxology to Christ (Rev. 1:5e-6

    Directory of Open Access Journals (Sweden)

    J. C. de Smidt

    2006-07-01

    Full Text Available Revelation 1:5e-6 is a doxology, an eulogy on the characteristics (attributes of Christ. Christ’s churches celebrate the enduring love of Christ, who by a once-and-for-all historical act redeemed them from enslavement to sin. Through this redemptive achievement Christ obtained royal and priestly prerogatives for believers in the present. The meaning of this doxology is investigated from a “heilgeschichtlich” and covenantal context. The acts of Christ are framed by the acts of God; God thus is the “Principium Essendi”. The point of departure in this article is that an ontological relationship exists between the theologia naturalis and the theologia supra- naturalis in the final phase of God’s kingdom.

  4. 23 CFR 140.907 - Overhead and indirect construction costs.

    Science.gov (United States)

    2010-04-01

    ... accounting principles; (2) The costs included in the distribution are limited to costs actually incurred by...), part 31, Contract Cost Principles and Procedures, relating to contracts with commercial organizations... 23 Highways 1 2010-04-01 2010-04-01 false Overhead and indirect construction costs. 140.907...

  5. Efeito do bentazon e bentazon + dichlorprop na cultura do arroz irrigado e sobre as plantas daninhas Effect of bentazon and bentazon + dichlorprop on irrigated rice and weeds

    Directory of Open Access Journals (Sweden)

    C.A.L. dos Santos

    1979-06-01

    Full Text Available Foi instalado um experimento de campo, em solo barrento, com a finalidade de se verificar o efeito do bentazon e da mistura de bentazon + dichlorprop sobre o desenvolvimento do arroz em cultura irrigada e sobre o controle das plantas daninhas. Os tratamentos utilizados foram os seguintes: bentazon á 0,75-1,00 e1,50 kg/ha; bentazon + dichlorprop a 0,80 + 1,00 e 1,00 + 1,40 kg/ha; propanil a 4,20 kg/ha (tratamento padrão; testemunha capinada e testemunha sem capina. Todas as pulverizações foram realizadas em pósemergência. As plantas daninhas encontradas no experimento foram: capituva - Echinochloa colonum (L Link, tiririca amarela - Cyperus esculentus L., beldroega - Portulaca oleracea L. e carurú comum - Amaranthus viridis L. Bentazon a 1,00 e 1,50 kg/ha e bentazon + dichlorprop a 1,00 + 1,40 kg/ha foram eficientes no controle de P. oleracea, A. viridis e C. esculentus; já a dose menor de bentazon apresentou bons resultados contra P. oleracea e A. viridis, enquanto que a dose menor de bentazon + dichlorprop controlou apenas P. oleracea. Propanil, de uma maneira geral, proporcionou eficiente ação sobre as plantas daninhas. Nas condições em que foi realizado o experimento nenhum dos herbicidas, nas suas respectivas doses, apresentou fitotoxicidade para as plantas de arroz da variedade IAC-435 ou prejudicou a produção da cultura.Bentazon at 0.75 - 1.00 and 1.50 kg/ha a.i ., bentazon + dichlorprop at 0.80 + 1.00 and 1.00 + 1.40 kg and propanil at 4.20 kg were applied in post-emergence on irrigated rice, against the following weeds: Echinochloa colonum (L. Link, Cy-perus esc-ulentus L., Portulaca oleracea L. and Amaranthus viridis L. Bentazon at 1.00 - 1.50 kg and bentazon + dichlorprop at 1.00 + 1.40 kg gave good control of P. oleracea, A. viridis and C. esculentus; bentazon at 0.75 kg controlled P. oleracea and A. viridis; bentazon + dichlorprop at 0.80 + 1.00 kg only showed effeciency for P. oleracea; propanil, in general, gave good

  6. 47 CFR 25.140 - Qualifications of fixed-satellite space station licensees.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Qualifications of fixed-satellite space station licensees. 25.140 Section 25.140 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses Space Stations § 25.140 Qualifications...

  7. Characterization of CTX-M-140, a Variant of CTX-M-14 Extended-Spectrum β-Lactamase with Decreased Cephalosporin Hydrolytic Activity, from Cephalosporin-Resistant Proteus mirabilis.

    Science.gov (United States)

    Tian, Guo-Bao; Jiang, Yi-Qi; Huang, Ying-Min; Qin, Yun; Feng, Lian-Qiang; Zhang, Xue-Fei; Li, Hong-Yu; Zhong, Lan-Lan; Zeng, Kun-Jiao; Patil, Sandip; Xing, Yong; Huang, Xi

    2016-10-01

    CTX-M-140, a novel CTX-M-type extended-spectrum β-lactamase (ESBL), was identified in cephalosporin-resistant clinical isolates of Proteus mirabilis CTX-M-140 contained an alanine-to-threonine substitution at position 109 compared to its putative progenitor, CTX-M-14. When it was expressed in an Escherichia coli isogenic background, CTX-M-140 conferred 4- to 32-fold lower MICs of cephalosporins than those with CTX-M-14, indicating that the phenotype was attributable to this single substitution. For four mutants of CTX-M-14 that were constructed by site-directed mutagenesis (A109E, A109D, A109K, and A109R mutants), MICs of cephalosporins were similar to those for the E. coli host strain, which suggested that the alanine at position 109 was essential for cephalosporin hydrolysis. The kinetic properties of native CTX-M-14 and CTX-M-140 were consistent with the MICs for the E. coli clones. Compared with that of CTX-M-14, a lower hydrolytic activity against cephalosporins was observed for CTX-M-140. blaCTX-M-140 is located on the chromosome as determined by I-CeuI pulsed-field gel electrophoresis (I-CeuI-PFGE) and Southern hybridization. The genetic environment surrounding blaCTX-M-140 is identical to the sequence found in different plasmids with blaCTX-M-9-group genes among the Enterobacteriaceae Genome sequencing and analysis showed that P. mirabilis strains with blaCTX-M-140 have a genome size of ∼4 Mbp, with a GC content of 38.7% and 23 putative antibiotic resistance genes. Our results indicate that alanine at position 109 is critical for the hydrolytic activity of CTX-M-14 against oxyimino-cephalosporins. Copyright © 2016, American Society for Microbiology. All Rights Reserved.

  8. UA1 experience with 3081/E systems

    International Nuclear Information System (INIS)

    Sphicas, P.A.

    1987-01-01

    A Harvard/MIT collaboration has built, with support from CERN, a 3081/E farm of two processors in Cambridge, MA. The farm was completed in the beginning of 1986. It has since been used for UA1 data analysis and two full production runs have been completed so far. The system will be upgraded in the near future: the number of 3081/E's will be increased to five, and a new IBM-VME interface developed at CERN will be installed. Similar farms have either already been built (CERN, 5 emulators) or have received approval (ROME, 2 emulators). They will also be used for production and analysis of UA1 data. An overview of the status, performance and future of these systems will be given. (orig.)

  9. 77 FR 65706 - Agency Information Collection Activities: Immigrant Petition for Alien Worker, Form I-140...

    Science.gov (United States)

    2012-10-30

    ...-0015] Agency Information Collection Activities: Immigrant Petition for Alien Worker, Form I-140... Form/Collection: Immigrant Petition for Alien Worker. (3) Agency form number, if any, and the... information furnished on Form I-140 will be used by USCIS to classify aliens under sections 203(b)(1), 203(b...

  10. 75 FR 39974 - Sunshine Act Meetings

    Science.gov (United States)

    2010-07-13

    ... NATIONAL COUNCIL ON DISABILITY Sunshine Act Meetings DATE AND TIMES: July 28, 2010, 2 p.m.-6 p.m. PLACE: Renaissance Washington, DC Downtown Hotel, 999 9th Street, NW., Washington, DC. STATUS: Open to the public. MATTERS TO BE CONSIDERED: (1) National Summit on Disability Policy 2010 Evaluation; (2...

  11. Socioeconomic status and adolescent e-cigarette use: The mediating role of e-cigarette advertisement exposure.

    Science.gov (United States)

    Simon, Patricia; Camenga, Deepa R; Morean, Meghan E; Kong, Grace; Bold, Krysten W; Cavallo, Dana A; Krishnan-Sarin, Suchitra

    2018-07-01

    Among adolescents, low socioeconomic status (SES) is associated with greater exposure to tobacco cigarette advertising and cigarette use. However, associations among SES, e-cigarette advertising and e-cigarette use are not well understood. This study examined exposure to e-cigarette advertisements as a mediator of the relationship between SES and adolescent e-cigarette use. Adolescents (N = 3473; 51% Female) from 8 high schools in Connecticut completed an anonymous survey in Spring 2015. Mediation analysis was used to examine whether the total number of sources of recent e-cigarette advertising exposure (e.g., TV, radio, billboards, magazines, local stores [gas stations, convenience stores], vape shops, mall kiosks, tobacco shops, social media) mediated the association between SES (measured by the Family Affluence Scale) and past-month frequency of e-cigarette use. We clustered for school and controlled for other tobacco product use, age, sex, race/ethnicity and perceived social norms for e-cigarette use in the model. Our sample recently had seen advertisements via 2.1 (SD = 2.8) advertising channels. Mediation was supported (indirect effect: β = 0.01, SE = 0.00, 95% CI [0.001, 0.010], p = 0.02), such that higher SES was associated with greater recent advertising exposure, which, in turn, was associated with greater frequency of e-cigarette use. Our study suggests that regulations to reduce youth exposure to e-cigarette advertisement may be especially relevant to higher SES youth. Future research should examine these associations longitudinally and evaluate which types of advertisements target different SES groups. Copyright © 2018 Elsevier Inc. All rights reserved.

  12. Nuclear magnetic resonance (1.40 T) and mid infrared (FTIR-ATR) associated with chemometrics as analytical methods for the analysis of methyl ester yield obtained by esterification reaction

    Energy Technology Data Exchange (ETDEWEB)

    Kollar, Sara R.M.; Suarez, Paulo A.Z., E-mail: psuarez@unb.br [Universidade de Brasilia (UnB), Brasília, DF (Brazil). Instituto de Química; Novotny, Etelvino H. [Embrapa Solos, Rio de Janeiro, RJ (Brazil); Nascimento, Claudia J. do [Universidade Federal do Estado do Rio de Janeiro (UNIRIO), Rio de Janeiro, RJ, (Brazil). Instituto de Biociências

    2017-07-01

    In this work, we compared 1.40 T nuclear magnetic resonance (NMR) to 7.05 T (60 and 300 MHz for proton, respectively), and mid-infrared with attenuated total reflectance (FTIR-ATR), associated with chemometrics methods, for the quantification of the reaction yield during esterification of fatty acids with methanol. The results showed that the integrated intensities of the ester C=O stretching region, relative to the total C=O stretching region, is useful to quantify the fatty acid methyl ester (FAME) concentration. Comparing the results obtained by the different final models: NMR (1.40 T and 7.05 T), FTIR-ATR using multivariate partial last squares regression (PLS) with orthogonal signal correction (OSC), and univariate ordinary least squares (OLS), the NMR of 1.40 T (60 MHz for proton) showed more advantages when compared to a high field spectrometer, due to the non-use of cryogenic and solvents and less laborious work for obtaining results. (author)

  13. 29 CFR 1620.1 - Basic applicability of the Equal Pay Act.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Basic applicability of the Equal Pay Act. 1620.1 Section 1620.1 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION THE EQUAL PAY ACT § 1620.1 Basic applicability of the Equal Pay Act. (a) Since the Equal Pay Act, 29 U.S.C...

  14. THE USE OF EXPRESSIVE SPEECH ACTS IN HANNAH MONTANA SESSION 1

    Directory of Open Access Journals (Sweden)

    Nur Vita Handayani

    2015-07-01

    Full Text Available This study aims to describe kinds and forms of expressive speech act in Hannah Montana Session 1. It belongs to descriptive qualitative method. The research object was expressive speech act. The data source was utterances which contain expressive speech acts in the film Hannah Montana Session 1. The researcher used observation method and noting technique in collecting the data. In analyzing the data, descriptive qualitative method was used. The research findings show that there are ten kinds of expressive speech act found in Hannah Montana Session 1, namely expressing apology, expressing thanks, expressing sympathy, expressing attitudes, expressing greeting, expressing wishes, expressing joy, expressing pain, expressing likes, and expressing dislikes. The forms of expressive speech act are direct literal expressive speech act, direct non-literal expressive speech act, indirect literal expressive speech act, and indirect non-literal expressive speech act.

  15. Alcohol use and self-perceived mental health status among pregnant and breastfeeding women in Canada: a secondary data analysis.

    Science.gov (United States)

    Lange, S; Quere, M; Shield, K; Rehm, J; Popova, S

    2016-05-01

    To estimate the prevalence of alcohol consumption during pregnancy and while breastfeeding in Canada from 2003 to 2010, and to test the relation between self-perceived mental health status and alcohol consumption during pregnancy and while breastfeeding. Secondary analysis of four cycles of the Canadian Community Health Survey, a population-based cross-sectional survey. Canada. A total of 18 612 pregnant and 15 836 breastfeeding women. The prevalence of alcohol consumption during pregnancy and while breastfeeding and 95% confidence intervals (CI) were calculated by province and territory, and cycle. The relation between self-perceived mental health status and alcohol consumption during pregnancy and while breastfeeding was explored using quasi-Poisson regression models. Alcohol consumption during pregnancy and while breastfeeding, and self-perceived mental health status. In Canada, between 2003 and 2010, approximately one in every ten pregnant women (9.9%; 95%CI 9.2-10.5%) and two in every ten breastfeeding women (20.3%; 95%CI 19.4-21.2%) women consumed alcohol. Women with a lower self-perceived mental health status (i.e. 'good') were 1.40 (95%CI 1.18-1.67, P women with an 'excellent' self-perceived mental health. There were no notable differences between the categories of mental health status in regard to alcohol consumption while breastfeeding. Despite public health efforts in Canada, a significant proportion of pregnant and breastfeeding women consume alcohol. It is imperative that a standard screening protocol be initiated among pregnant and breastfeeding women, especially in high-risk populations (e.g. women utilising substance abuse treatment programs). In Canada in 2003-2010, approximately 10% of pregnant and 20% of breastfeeding women consumed alcohol. © 2015 Royal College of Obstetricians and Gynaecologists.

  16. 40 CFR 421.140 - Applicability: Description of the primary antimony subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability: Description of the primary antimony subcategory. 421.140 Section 421.140 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Primary Antimony Subcategory § 421.140...

  17. X-ray and VLBI radio observations of the quasars NRAO 140 and NRAO 530

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.

    1981-01-01

    We have detected the quasars NRAO 140 and NRAO 530 with the Einstein X-Ray Observatory, thereby confirming the previously reported detection by HEAO 1 (Marscher et al.). The low-energy X-ray flux of NRAO 140 is consistent with the high-energy results from the earlier satellite. However, either the X-ray emission from NRAO 530 decreased by an order of magnitude from 1978.0 to 1979.7, or a second bright source was present within the HEAO 1 field

  18. Investigating the Speech Act of Correction in Iraqi EFL Context

    Science.gov (United States)

    Darweesh, Abbas Deygan; Mehdi, Wafaa Sahib

    2016-01-01

    The present paper investigates the performance of the Iraqi students for the speech act of correction and how it is realized with status unequal. It attempts to achieve the following aims: (1) Setting out the felicity conditions for the speech act of correction in terms of Searle conditions; (2) Identifying the semantic formulas that realize the…

  19. Comparative genomic analysis shows that avian pathogenic Escherichia coli isolate IMT5155 (O2:K1:H5; ST complex 95, ST140 shares close relationship with ST95 APEC O1:K1 and human ExPEC O18:K1 strains.

    Directory of Open Access Journals (Sweden)

    Xiangkai Zhu Ge

    Full Text Available Avian pathogenic E. coli and human extraintestinal pathogenic E. coli serotypes O1, O2 and O18 strains isolated from different hosts are generally located in phylogroup B2 and ST complex 95, and they share similar genetic characteristics and pathogenicity, with no or minimal host specificity. They are popular objects for the study of ExPEC genetic characteristics and pathogenesis in recent years. Here, we investigated the evolution and genetic blueprint of APEC pathotype by performing phylogenetic and comparative genome analysis of avian pathogenic E. coli strain IMT5155 (O2:K1:H5; ST complex 95, ST140 with other E. coli pathotypes. Phylogeny analyses indicated that IMT5155 has closest evolutionary relationship with APEC O1, IHE3034, and UTI89. Comparative genomic analysis showed that IMT5155 and APEC O1 shared significant genetic overlap/similarities with human ExPEC dominant O18:K1 strains (IHE3034 and UTI89. Furthermore, the unique PAI I5155 (GI-12 was identified and found to be conserved in APEC O2 serotype isolates. GI-7 and GI-16 encoding two typical T6SSs in IMT5155 might be useful markers for the identification of ExPEC dominant serotypes (O1, O2, and O18 strains. IMT5155 contained a ColV plasmid p1ColV5155, which defined the APEC pathotype. The distribution analysis of 10 sequenced ExPEC pan-genome virulence factors among 47 sequenced E. coli strains provided meaningful information for B2 APEC/ExPEC-specific virulence factors, including several adhesins, invasins, toxins, iron acquisition systems, and so on. The pathogenicity tests of IMT5155 and other APEC O1:K1 and O2:K1 serotypes strains (isolated in China through four animal models showed that they were highly virulent for avian colisepticemia and able to cause septicemia and meningitis in neonatal rats, suggesting zoonotic potential of these APEC O1:K1 and O2:K1 isolates.

  20. 78 FR 69141 - Sunshine Act Meeting

    Science.gov (United States)

    2013-11-18

    ... POSTAL REGULATORY COMMISSION Sunshine Act Meeting TIME AND DATE: Wednesday, December 11, 2013, at.... STATUS: Part of this meeting will be open to the public. The rest of the meeting will be closed to the... December 11, 2013 meeting includes the items identified below. PORTIONS OPEN TO THE PUBLIC: 1. Report from...

  1. 41 CFR 105-53.140 - Office of Operations and Industry Relations.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office of Operations and Industry Relations. 105-53.140 Section 105-53.140 Public Contracts and Property Management Federal Property... FUNCTIONS Central Offices § 105-53.140 Office of Operations and Industry Relations. The Office of Operations...

  2. Slovak Republic Act of 11 February 1998 on the energetics and on alterations to Act No. 455/1991 Collection of Acts of CSFR on small business (trade Act) in version of posterior regulations

    International Nuclear Information System (INIS)

    1998-01-01

    This act constitute: (a) conditions of undertaking in electro-energetic, gas industry, and heat supply (in next only 'energetic' branches) ; (b) rights and responsibility of physical and act person undertaking in energetic branches; (c) rights and responsibility of customers of electricity, gas, and heat; counteract measures in the need situations, (d) and at prevention before need situations in energetic branches; (e) state regulation in energetic; (f) authority on keep of this act. The act is divided into for parts: (1) General constitutions, (2) Energetic branches; (3) The state authority; (4) Common, transient and invalidation constitutions.This act deals with the specific conditions for undertaking in nuclear power plants, too (licensing, security). This act shall into effect on 1 July 1998

  3. Electronic Mail, Privacy, and the Electronic Communications Privacy Act of 1986: Technology in Search of Law.

    Science.gov (United States)

    Samoriski, Jan H.; And Others

    1996-01-01

    Attempts to clarify the status of e-mail privacy under the Electronic Communications Privacy Act of 1986 (ECPA). Examines current law and the paucity of definitive case law. A review of cases and literature suggests there is a gap in the existing ECPA that allows for potentially abusive electronic monitoring and interception of e-mail,…

  4. Possibilities of 140Nd production by the VINCY cyclotron

    International Nuclear Information System (INIS)

    Comor, J.J.; Dakovic, M.

    2000-01-01

    Application of positron emission tomography (PET) in modern medical diagnosis relies on the application of short lived radionuclides 11 C, 13 N, 15 O and 18 F, presuming their production in the close vicinity of the PET camera. Application of long-lived positron emitters would enable the regional distribution of PET radiopharmaceuticals, which would significantly lower the price of PET diagnosis, as well as enable its application in fields currently inhibited by the short half-life of available positron emitters. One of the candidates for application in PET is the generator system 140 Nd/ 140 Pr, due to the long half-life of 140 Nd (3,37 days). Theoretical calculations confirm that this radionuclide can be produced with high yields by protons accelerated to energies bellow 30 MeV. Due to its optimal operating parameters, the VINCY Cyclotron could produce enough 140 Nd for its regional distribution to a number of PET centers (author)

  5. 8 CFR 1209.1 - Adjustment of status of refugees.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of refugees. 1209.1... IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 1209.1 Adjustment of status of refugees. The provisions of this section shall provide the sole and exclusive procedure for...

  6. Crescimento e estado nutricional de helicônia irrigada com água residuária tratada em casa de vegetação Growth and nutritional status of helicônia irrigated with treated wastewater in greenhouse

    Directory of Open Access Journals (Sweden)

    Olívia S. N. Santos

    2012-08-01

    Full Text Available Neste trabalho se estudaram o desenvolvimento e o estado nutricional de helicônias irrigadas com água residuária tratada de origem doméstica associada a fertilizantes químicos (NPK. O experimento foi conduzido em casa de vegetação na qual se utilizaram plantas de helicônia Golden Adrian. O experimento foi instalado no esquema fatorial 5 x 3 + 1 constituídos de cinco níveis de lâmina de água aplicada (equivalente a 60, 80, 100, 120 e 140% da evaporação do tanque classe A ECA, três tipos de água (água residuária (AR, água pluvial (AP e mistura de 50% de AR + 50% de AP e testemunha (solo sem adubação e recebendo 100% da ECA de água pluvial. O delineamento experimental utilizado foi blocos ao acaso, com cinco repetições. A utilização de AR e as lâminas maiores proporcionaram acréscimo nos parâmetros de crescimento avaliados. Os teores de macronutrientes presentes nas folhas das plantas irrigadas com AR se comportaram de forma semelhante às plantas que receberam AP. O uso de AR e AP resultou em acréscimo de teores de micronutrientes nas folhas, principalmente Fe e Mn, acima dos teores recomendados para a cultura.In this study the growth and nutritional status of helicônias irrigated with treated wastewater of domestic origin associated with chemical fertilizers (NPK was studied. The experiment was conducted in a greenhouse utilizing plants of helicônia Golden Adrian. The experiment was installed in 5 x 3 + 1 factorial scheme consisting of five depths of irrigation water (equivalent to 60, 80, 100, 120 and 140% of class A pan evaporation - ECA, three types of water (wastewater (AR, rainwater (AP and a mixture of 50% AR + 50% AP and control (soil without fertilizer and receiving rainwater corresponding to 100% ECA. The experimental design was in randomized blocks with five repetitions. The use of AR and larger depths of irrigation provided increases in evaluated parameters of growth. The levels of macronutrients in the

  7. PENGARUH PEMBERIAN TABLET BESI DAN VITAMIN E PADA KADAR HEMOGLOBIN DAN STATUS BESI WANITA USIA SUBUR YANG DIDUGA MENDERITA THALASEMIA KARIER

    Directory of Open Access Journals (Sweden)

    M. Saidin

    2012-11-01

    Full Text Available THE EFFECT OF IRON PILL SUPPLEMENTATION ADDED WITH VITAMIN E (ALPHA-TOCOPHEROL TO HEMOGLOBIN AND IRON STATUS OF CHILDBEARING AGE WOMEN SUSPECTED SUFFERING FROM CARRIER THALASSEMIA.Background: Anemia control programme among pregnant women had been conducting for about three decades, but prevalence of anemia still considered high. It was reported by Nutrition and Food Research Centre (2000 that 37.4% of childbearing women indicated fragility of red blood cell membrane wich assumed related to anemia. One of the vitamins which have positive effect to the wall of red blood cells is vitamin E through its rolle as antioxidant. It was recommended to conduct a study to determine the effect of supplementation of iron pill, "Ferro sulfate" (60 mg elemental iron with 25 mg folic acid added with vitamin E (20 mg a-tocopherol to hemoglobin level and iron status of childbearing age of women.Methods: The study design was "Intervention with quacy experiment trial".  The study sites covered 10 villages in Cianjur district of West Java. A total of 210 childbearing age women (19-45 years old with indication of fragility of red blood cell membrane which was determined by procedure of NESTROF (Naked Eye Single Test Tube Red Cell Osmotic Fragility, divided into two groups (105 women/group. Group I received one iron pill daily and vitamin E twice a week for 10 weeks. While group II received Iron pill only, without vitamin E. Data collection was conducted before and after intervention.Results: After 10 weeks intervention, the average of Hb increament of group I (0.4 g/dl was slightly higher than that of group II (0.3 g/dl. There was improvement of serum ferritin of both groups with increament 4.3 mg/dl for group I and 7.2 mg/dl for group II. Vitamin E status of both groups still considered low: 3.1 mg/L for group I and 3.1 mg/L for group II. Normal value of serum vitamin E is 5.0 mg/L.Conclusions: Vitamin E (20 mg of a-tocopherol which was given twice a week bisides

  8. Differences in total and allergen specific IgE during pregnancy compared with 1 month and 1 year post partum.

    Science.gov (United States)

    Perry, Lee M; Ownby, Dennis R; Wegienka, Ganesa R; Peterson, Edward L; Woodcroft, Kimberly J; Joseph, Christine L; Johnson, Christine C

    2009-10-01

    Pregnancy alters the function of many body systems, including the immune system. However, little is known regarding the effect of pregnancy on maternal IgE levels or atopy. To determine whether pregnancy consistently influences serum levels of total or allergen specific IgE. Blood samples were obtained from 764 women during the third trimester of pregnancy and 1 month post partum. A third sample was obtained from 106 of these women 1 year post partum. Samples were analyzed for total and specific IgE to 8 regionally common allergens using a commercially available system. Sensitization was defined as an allergen specific IgE level of 0.35 kU of allergen per liter or higher to any allergen. Total IgE increased significantly post partum, both at 1 month (40.36 vs 35.37 IU/mL intrapartum; P = .001) and at 1 year (44.97 vs 37.00 IU/mL intrapartum; P = .005). Allergen specific IgE decreased significantly at 1 month for cat, dog, ragweed, timothy grass, and egg (P = .001 to P = .02) but not for dust mite, cockroach, or Alternaria (P = .15 to P = .90). Similar patterns of change in total and specific IgE were seen at 1 year. However, on average, only 3.5% of participants changed sensitization status to the individual allergens studied during the 1 year of observation. Compared with intrapartum levels, total IgE levels increased significantly at 1 month and 1 year post partum. Conversely, at the same time points, IgE levels specific for common allergens significantly declined to most but not all allergens. Few women changed their sensitization status over 1 year.

  9. Bloodstream Amyloid-beta (1-40) Peptide, Cognition, and Outcomes in Heart Failure.

    Science.gov (United States)

    Bayes-Genis, Antoni; Barallat, Jaume; de Antonio, Marta; Domingo, Mar; Zamora, Elisabet; Vila, Joan; Subirana, Isaac; Gastelurrutia, Paloma; Pastor, M Cruz; Januzzi, James L; Lupón, Josep

    2017-11-01

    In the brain, amyloid-beta generation participates in the pathophysiology of cognitive disorders; in the bloodstream, the role of amyloid-beta is uncertain but may be linked to sterile inflammation and senescence. We explored the relationship between blood levels of amyloid-beta 1-40 peptide (Aβ40), cognition, and mortality (all-cause, cardiovascular, and heart failure [HF]-related) in ambulatory patients with HF. Bloodstream Aβ40 was measured in 939 consecutive patients with HF. Cognition was evaluated with the Pfeiffer questionnaire (adjusted for educational level) at baseline and during follow-up. Multivariate Cox regression analyses and measurements of performance (discrimination, calibration, and reclassification) were used, with competing risk for specific causes of death. Over 5.1 ± 2.9 years, 471 patients died (all-cause): 250 from cardiovascular causes and 131 HF-related. The median Aβ40 concentration was 519.1 pg/mL [Q1-Q3: 361.8-749.9 pg/mL]. The Aβ40 concentration correlated with age, body mass index, renal dysfunction, and New York Heart Association functional class (all P < .001). There were no differences in Aβ40 in patients with and without cognitive impairment at baseline (P = .97) or during follow-up (P = .20). In multivariable analysis, including relevant clinical predictors and N-terminal pro-B-type natriuretic peptide, Aβ40 remained significantly associated with all-cause death (HR, 1.22; 95%CI, 1.10-1.35; P < .001) and cardiovascular death (HR, 1.18; 95%CI, 1.03-1.36; P = .02), but not with HF-related death (HR, 1.13; 95%CI, 0.93-1.37; P = .22). Circulating Aβ40 improved calibration and patient reclassification. Blood levels of Aβ40 are not associated with cognitive decline in HF. Circulating Aβ40 was predictive of mortality and may indicate systemic aging. Copyright © 2017 Sociedad Española de Cardiología. Published by Elsevier España, S.L.U. All rights reserved.

  10. 41 CFR 50-201.1 - The Walsh-Healey Public Contracts Act.

    Science.gov (United States)

    2010-07-01

    ... Contracts Act. 50-201.1 Section 50-201.1 Public Contracts and Property Management Other Provisions Relating... Walsh-Healey Public Contracts Act. The Walsh-Healey Public Contracts Act, as amended (41 U.S.C. 35-45... making of contracts by the United States.” It is not an act of general applicability to industry. The...

  11. Ovários policísticos em meninas e adolescentes normais: uma avaliação ultra-sonográfica

    OpenAIRE

    Teixeira Rosimere J.; Silva Valéria C.G.; Freitas Josele R.; Henriques Jodélia L.M.; Guimarães Marília M.

    2001-01-01

    Realizamos ultra-sonografia pélvica em tempo real e de alta resolução em 140 meninas com idade entre dois e 18 anos, para descrever a prevalência de ovários policísticos durante o desenvolvimento puberal normal. O volume dos ovários foi calculado e sua estrutura classificada como homogênea, microcística, multicística, policística e folicular. O volume aumentou e a freqüência das classes ovarianas variou de acordo com o status puberal. Os ovários eram de aspecto policístico em 8% (duas meninas...

  12. Factorization of RSA-140 using the number field sieve

    NARCIS (Netherlands)

    S.H. Cavallar; B. Dodson; A.K. Lenstra (Arjen); P.C. Leyland; W.M. Lioen (Walter); P.L. Montgomery; B. Murphy; H.J.J. te Riele (Herman); P. Zimmermann

    1999-01-01

    textabstractOn February 2, 1999, we completed the factorization of the 140--digit number RSA--140 with the help of the Number Field Sieve factoring method (NFS). This is a new general factoring record. The previous record was established on April 10, 1996 by the factorization of the 130--digit

  13. Child gender and weight status moderate the relation of maternal feeding practices to body esteem in 1st grade children.

    Science.gov (United States)

    Shriver, Lenka H; Hubbs-Tait, Laura; Harrist, Amanda W; Topham, Glade; Page, Melanie

    2015-06-01

    Prevention of body dissatisfaction development is critical for minimizing adverse effects of poor body esteem on eating behaviors, self-esteem, and overall health. Research has examined body esteem and its correlates largely in pre-adolescents and adolescents; however, important questions remain about factors influencing body esteem of younger children. The main purpose of this study was to test moderation by children's gender and weight status of the relation of maternal controlling feeding practices to 1st graders' body esteem. The Body Esteem Scale (BES) and anthropometric measurements were completed during one-on-one child interviews at school. Mothers completed the Child Feeding Questionnaire (restriction, monitoring, concern, self-assessed maternal weight). A total of 410 mother/child dyads (202 girls) participated. Percent of children classified as overweight (BMI-for-age ≥85th) was: girls - 29%; boys - 27%. Gender moderated the relation between restriction and body esteem (β = -.140, p = .05), with maternal restriction predicting body esteem in girls but not boys. The hypothesized three-way interaction among gender, child weight status, and monitoring was confirmed. Monitoring was significantly inversely related to body esteem only for overweight/obese girls (b = -1.630). The moderating influence of gender or gender and weight status on the link between maternal feeding practices and body esteem suggests the importance of body esteem interventions for girls as early as first grade. Copyright © 2015 Elsevier Ltd. All rights reserved.

  14. Beyond Dominance and Competence: A Moral Virtue Theory of Status Attainment.

    Science.gov (United States)

    Bai, Feng

    2017-08-01

    Recognition has grown that moral behavior (e.g., generosity) plays a role in status attainment, yet it remains unclear how, why, and when demonstrating moral characteristics enhances status. Drawing on philosophy, anthropology, psychology, and organizational behavior, I critically review a third route to attaining status: virtue, and propose a moral virtue theory of status attainment to provide a generalized account of the role of morality in status attainment. The moral virtue theory posits that acts of virtue elicit feelings of warmth and admiration (for virtue), and willing deference, toward the virtuous actor. I further consider how the scope and priority of moralities and virtues endorsed by a moral community are bound by culture and social class to affect which moral characteristics enhance status. I end by outlining an agenda for future research into the role of virtue in status attainment.

  15. 32 CFR 935.140 - Motor vehicle maintenance and equipment.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Motor vehicle maintenance and equipment. 935.140... AND INSULAR REGULATIONS WAKE ISLAND CODE Motor Vehicle Code § 935.140 Motor vehicle maintenance and equipment. (a) Each person who has custody of a motor vehicle on Wake Island shall present that vehicle for...

  16. Rapid growth and childhood obesity are strongly associated with lysoPC(14:0).

    Science.gov (United States)

    Rzehak, Peter; Hellmuth, Christian; Uhl, Olaf; Kirchberg, Franca F; Peissner, Wolfgang; Harder, Ulrike; Grote, Veit; Weber, Martina; Xhonneux, Annick; Langhendries, Jean-Paul; Ferre, Natalia; Closa-Monasterolo, Ricardo; Verduci, Elvira; Riva, Enrica; Socha, Piotr; Gruszfeld, Dariusz; Koletzko, Berthold

    2014-01-01

    Despite the growing interest in the early-origins-of-later-disease hypothesis, little is known about the metabolic underpinnings linking infant weight gain and childhood obesity. To discover biomarkers reflective of weight change in the first 6 months and overweight/obesity at age 6 years via a targeted metabolomics approach. This analysis comprised 726 infants from a European multicenter randomized trial (Childhood Obesity Programme, CHOP) for whom plasma blood samples at age 6 months and anthropometric data up to the age of 6 years were available. 'Rapid growth' was defined as a positive difference in weight within the first 6 months of life standardized to WHO growth standards. Weight change was regressed on each of 168 metabolites (acylcarnitines, lysophosphatidylcholines, sphingomyelins, and amino acids). Metabolites significant after Bonferroni's correction were tested as predictors of later overweight/obesity. Among the overall 19 significant metabolites, 4 were associated with rapid growth and 15 were associated with a less-than-ideal weight change. After adjusting for feeding group, only the lysophosphatidylcholine LPCaC14:0 remained significantly associated with rapid weight gain (β = 0.18). Only LPCaC14:0 at age 6 months was predictive of overweight/obesity at age 6 years (OR 1.33; 95% CI 1.04-1.69). LPCa14:0 is strongly related to rapid growth in infancy and childhood overweight/obesity. This suggests that LPCaC14:0 levels may represent a metabolically programmed effect of infant weight gain on the later obesity risk. However, these results require confirmation by independent cohorts. © 2014 S. Karger AG, Basel.

  17. Selected HIV-1 Env trimeric formulations act as potent immunogens in a rabbit vaccination model.

    Directory of Open Access Journals (Sweden)

    Leo Heyndrickx

    Full Text Available BACKGROUND: Ten to 30% of HIV-1 infected subjects develop broadly neutralizing antibodies (bNAbs during chronic infection. We hypothesized that immunizing rabbits with viral envelope glycoproteins (Envs from these patients may induce bNAbs, when formulated as a trimeric protein and in the presence of an adjuvant. METHODS: Based on in vitro neutralizing activity in serum, patients with bNAbs were selected for cloning of their HIV-1 Env. Seven stable soluble trimeric gp140 proteins were generated from sequences derived from four adults and two children infected with either clade A or B HIV-1. From one of the clade A Envs both the monomeric and trimeric Env were produced for comparison. Rabbits were immunized with soluble gp120 or trimeric gp140 proteins in combination with the adjuvant dimethyl dioctadecyl ammonium/trehalose dibehenate (CAF01. Env binding in rabbit immune serum was determined using ELISAs based on gp120-IIIB protein. Neutralizing activity of IgG purified from rabbit immune sera was measured with the pseudovirus-TZMbl assay and a PBMC-based neutralization assay for selected experiments. RESULTS: It was initially established that gp140 trimers induce better antibody responses over gp120 monomers and that the adjuvant CAF01 was necessary for such strong responses. Gp140 trimers, based on HIV-1 variants from patients with bNAbs, were able to elicit both gp120IIIB specific IgG and NAbs to Tier 1 viruses of different subtypes. Potency of NAbs closely correlated with titers, and an gp120-binding IgG titer above a threshold of 100,000 was predictive of neutralization capability. Finally, peptide inhibition experiments showed that a large fraction of the neutralizing IgG was directed against the gp120 V3 region. CONCLUSIONS: Our results indicate that the strategy of reverse immunology based on selected Env sequences is promising when immunogens are delivered as stabilized trimers in CAF01 adjuvant and that the rabbit is a valuable model

  18. Selected HIV-1 Env trimeric formulations act as potent immunogens in a rabbit vaccination model.

    Science.gov (United States)

    Heyndrickx, Leo; Stewart-Jones, Guillaume; Jansson, Marianne; Schuitemaker, Hanneke; Bowles, Emma; Buonaguro, Luigi; Grevstad, Berit; Vinner, Lasse; Vereecken, Katleen; Parker, Joe; Ramaswamy, Meghna; Biswas, Priscilla; Vanham, Guido; Scarlatti, Gabriella; Fomsgaard, Anders

    2013-01-01

    Ten to 30% of HIV-1 infected subjects develop broadly neutralizing antibodies (bNAbs) during chronic infection. We hypothesized that immunizing rabbits with viral envelope glycoproteins (Envs) from these patients may induce bNAbs, when formulated as a trimeric protein and in the presence of an adjuvant. Based on in vitro neutralizing activity in serum, patients with bNAbs were selected for cloning of their HIV-1 Env. Seven stable soluble trimeric gp140 proteins were generated from sequences derived from four adults and two children infected with either clade A or B HIV-1. From one of the clade A Envs both the monomeric and trimeric Env were produced for comparison. Rabbits were immunized with soluble gp120 or trimeric gp140 proteins in combination with the adjuvant dimethyl dioctadecyl ammonium/trehalose dibehenate (CAF01). Env binding in rabbit immune serum was determined using ELISAs based on gp120-IIIB protein. Neutralizing activity of IgG purified from rabbit immune sera was measured with the pseudovirus-TZMbl assay and a PBMC-based neutralization assay for selected experiments. It was initially established that gp140 trimers induce better antibody responses over gp120 monomers and that the adjuvant CAF01 was necessary for such strong responses. Gp140 trimers, based on HIV-1 variants from patients with bNAbs, were able to elicit both gp120IIIB specific IgG and NAbs to Tier 1 viruses of different subtypes. Potency of NAbs closely correlated with titers, and an gp120-binding IgG titer above a threshold of 100,000 was predictive of neutralization capability. Finally, peptide inhibition experiments showed that a large fraction of the neutralizing IgG was directed against the gp120 V3 region. Our results indicate that the strategy of reverse immunology based on selected Env sequences is promising when immunogens are delivered as stabilized trimers in CAF01 adjuvant and that the rabbit is a valuable model for HIV vaccine studies.

  19. 10 CFR 140.95 - Appendix E-Form of indemnity agreement with nonprofit educational institutions.

    Science.gov (United States)

    2010-01-01

    ... out of an act of war; and (3) claims for loss of, or damage to, or loss of use of (a) property which... intervening causes, whether involving the conduct of a third person or an act of God. As used herein, conduct...

  20. E-Learning in Supplemental Educational Systems in Taiwan: Present Status and Future Challenges

    Science.gov (United States)

    Zhang, Ke; Hung, Jui-Long

    2009-01-01

    As Taiwan's full-scale e-learning initiatives moved to the seventh year in 2009, the current status and challenges of e-learning development there are yet to be fully understood. Further extending Zhang and Hung's (2006) investigation on e-learning in all universities and colleges in Taiwan, this study investigated the after-school programs (ASPs)…

  1. 40 CFR 1065.140 - Dilution for gaseous and PM constituents.

    Science.gov (United States)

    2010-07-01

    ...) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Equipment Specifications § 1065.140 Dilution for... and the exhaust gases. (2) Pressure control. Maintain static pressure at the location where raw exhaust is introduced into the tunnel within ± 1.2 kPa of atmospheric pressure. You may use a booster...

  2. Feasibility study on sensor data fusion for the CP-140 aircraft: fusion architecture analyses

    Science.gov (United States)

    Shahbazian, Elisa

    1995-09-01

    Loral Canada completed (May 1995) a Department of National Defense (DND) Chief of Research and Development (CRAD) contract, to study the feasibility of implementing a multi- sensor data fusion (MSDF) system onboard the CP-140 Aurora aircraft. This system is expected to fuse data from: (a) attributed measurement oriented sensors (ESM, IFF, etc.); (b) imaging sensors (FLIR, SAR, etc.); (c) tracking sensors (radar, acoustics, etc.); (d) data from remote platforms (data links); and (e) non-sensor data (intelligence reports, environmental data, visual sightings, encyclopedic data, etc.). Based on purely theoretical considerations a central-level fusion architecture will lead to a higher performance fusion system. However, there are a number of systems and fusion architecture issues involving fusion of such dissimilar data: (1) the currently existing sensors are not designed to provide the type of data required by a fusion system; (2) the different types (attribute, imaging, tracking, etc.) of data may require different degree of processing, before they can be used within a fusion system efficiently; (3) the data quality from different sensors, and more importantly from remote platforms via the data links must be taken into account before fusing; and (4) the non-sensor data may impose specific requirements on the fusion architecture (e.g. variable weight/priority for the data from different sensors). This paper presents the analyses performed for the selection of the fusion architecture for the enhanced sensor suite planned for the CP-140 aircraft in the context of the mission requirements and environmental conditions.

  3. Impregnação de filmes do compósito de policarbonato (PC e sílica-gel (Si com corante fotocrômico em fluido supercrítico - DOI: 10.4025/actascitechnol.v32i1.1999

    Directory of Open Access Journals (Sweden)

    Fernanda de Almeida Fin de Lima

    2009-12-01

    Full Text Available O objetivo deste trabalho foi estudar a impregnação do corante fotocromático Reversacol Graphit® em filmes do compósito de policarbonato (PC e sílica-gel (Si, com a finalidade de obter aplicações em lentes fotocrômicas. Filmes de PC puros também foram impregnados nas mesmas condições, para verificar o efeito da adição de sílica-gel. Os filmes do compósito foram produzidos em proporções de Si:PC de 1:40 e 1:80 (m m-1, pelo método casting. Para a impregnação do corante Reversacol Graphit® nos filmes obtidos foi utilizado o processo supercrítico, pela sua eficiência e benefícios. A impregnação foi feita nos tempos de 15, 30, 45, 60, 90, 120, 150 e 180 min. A temperatura e a pressão adotadas foram de 60ºC e 120 bar. A quantidade de pigmento impregnado nos filmes de Si:PC – 1:40 e 1:80 (m m-1 foi de 29 e 23% de massa de corante por massa de compósito, respectivamente, e para o filme de PC puro foi de apenas 2,2% massa de corante por massa de compósito. Pelas análises térmicas, verificou-se que os filmes do compósito apresentaram maior estabilidade térmica. Pela técnica de microscopia eletrônica, observou-se que os filmes de PC puro e dos compósitos Si:PC – 1:40 e 1:80 (m m-1 apresentaram uma superfície lisa e homogênea.

  4. Conflicts and misapplications of ANSI N509, N510, U.S. NRC Regulatory Guide 1.52 and 1.140

    International Nuclear Information System (INIS)

    Kovach, J.L.

    1987-01-01

    The nuclear industry in the early 1970's attempted to standardize air cleaning system design and testing by the development of ANSI N509, Nuclear Power Air Cleaning Units and Components and ANSI N510, Testing of Nuclear Air Cleaning Systems. Parallel to those and leaning somewhat on the same information, the USNRC has prepared first, Regulatory Guide 1.52, Design, Testing, and Maintenance Criteria for Atmosphere Clean Up of System Air Filtration and Adsorption Units of Light Water Cooled Nuclear Reactor plants, and regulatory guide 1.140, Design, Testing, and Maintenance Criteria for Normal Ventilation Exhaust System Air Filtration and Adsorption Units of Light Water Cooled Nuclear Power Plants. These documents were a good starting point and should have been the basis for the evolution of sound engineering practices. Instead of that path, the subsequent revisions were narrow in scope, uncoordinated, rarely based on experience and became nearly unworkable. Starting with the scope statement (or equivalent for the regulatory guides) the problems began to occur. Ten recommendations are made for eliminating the troublesome aspects of the regulations

  5. Complex Tectono-Magmatic Interaction along the George V Transform Fault, South-East Indian Ridge, 140°E, and Implications for Mantle Dynamics

    Science.gov (United States)

    Briais, A.; Ruellan, E.; Ceuleneer, G.; Maia, M.

    2017-12-01

    The 300 km-offset George V Transform Fault (TF) is the westernmost of the major, right-stepping transform faults that offset the South-East Indian Ridge between 140°E and 155°E. All these TFs have multiple shear zones with intra-transform ridge segments (ITRS), mostly unmapped yet. We present the results of the analysis of geophysical and petrological data collected during the STORM cruise (South Tasmania Ocean Ridge and Mantle). The data cover the western shear zone and part of two ITRSs. They reveal a complex interaction between tectonic processes at the plate boundary and near-axis volcanic activity along and across the transform fault. The western TF shear zone consists of two segments offset by a 50 km-long, 15 km-wide, up to 2000 m-high serpentinite massif. We infer that the massif is a push-up resulting from transpression along the transform, due to the lengthening of the western ITRS, with a mechanism similar to the processes currently uplifting the mylonitic massif along the St. Paul TF in the Equatorial Atlantic (1). The western ITRS is relatively shallow and magmatically robust, which is unexpected in a TF system. The bathymetric and backscatter maps also reveal a series of recent off-axis oblique volcanic ridges. Rocks dredged on one of these ridges consist of picrites (i.e. basalts rich in olivine phenocrysts). These observations suggest that the TF there is not magma starved like many mid-ocean ridge transforms, but is the locus of significant primitive melt supply. Such an unexpected production of high-Mg melt might be related to the presence of a mantle thermal anomaly beneath the easternmost SEIR, and/or to a western flow of mantle across the TF. *STORM cruise scientific party: A. Briais, F. Barrere, C. Boulart, D. Brunelli, G. Ceuleneer, N. Ferreira, B. Hanan, C. Hémond, S. Macleod, M. Maia, A. Maillard, S. Merkuryev, S.H. Park, S. Révillon, E. Ruellan, A. Schohn, S. Watson, and Y.S. Yang. (1) Maia et al. 2016 Nature Geo. doi:10.1038/ngeo2759

  6. High power, 140 GHz gyrotron

    International Nuclear Information System (INIS)

    Kreischer, K.E.; Temkin, R.J.; Mulligan, W.J.; MacCabe, S.; Chaplya, R.

    1982-01-01

    The design and construction of a pulsed 100 kW, 140 GHz gyrotron is described. Initial gyrotron operation is expected in early 1982. Advances in gyrotron theory have also been carried out in support of this experimental research. The application of gyrotrons to plasma diagnostics is also under investigation. (author)

  7. Angiogenesis mediated by soluble forms of E-selectin and vascular cell adhesion molecule-1

    Science.gov (United States)

    Koch, Alisa E.; Halloran, Margaret M.; Haskell, Catherine J.; Shah, Manisha R.; Polverini, Peter J.

    1995-08-01

    ENDOTHELIAL adhesion molecules facilitate the entry of leukocytes into inflamed tissues. This in turn promotes neovascularization, a process central to the progression of rheumatoid arthritis, tumour growth and wound repair1. Here we test the hypothesis that soluble endothelial adhesion molecules promote angiogenesis2á¤-4. Human recombinant soluble E-selectin and soluble vascular cell adhesion molecule-1 induced chemotaxis of human endothelial cells in vitro and were angiogenic in rat cornea. Soluble E-selectin acted on endothelial cells in part through a sialyl Lewis-X-dependent mechanism, while soluble vascular cell adhesion molecule-1 acted on endothelial cells in part through a very late antigen (VLA)-4 dependent mechanism. The chemotactic activity of rheumatoid synovial fluid for endothelial cells, and also its angiogenic activity, were blocked by antibodies to either soluble E-selectin or soluble vascular cell adhesion molecule-1. These results suggest a novel function for soluble endothelial adhesion molecules as mediators of angiogenesis.

  8. Nogo-66 receptor antagonist peptide (NEP1-40) administration promotes functional recovery and axonal growth after lateral funiculus injury in the adult rat

    NARCIS (Netherlands)

    Cao, Y.; Shumsky, J. S.; Sabol, M. A.; Kushner, R. A.; Strittmatter, S.; Hamers, F. P. T.; Lee, D. H. S.; Rabacchi, S. A.; Murray, M.

    2008-01-01

    Objective. The myelin protein Nogo inhibits axon regeneration by binding to its receptor (NgR) on axons. Intrathecal delivery of an NgR antagonist (NEP1-40) promotes growth of injured corticospinal axons and recovery of motor function following a dorsal hemisection. The authors used a similar design

  9. Endometrial tumour BRAF mutations and MLH1 promoter methylation as predictors of germline mismatch repair gene mutation status: a literature review.

    Science.gov (United States)

    Metcalf, Alexander M; Spurdle, Amanda B

    2014-03-01

    Colorectal cancer (CRC) that displays high microsatellite instability (MSI-H) can be caused by either germline mutations in mismatch repair (MMR) genes, or non-inherited transcriptional silencing of the MLH1 promoter. A correlation between MLH1 promoter methylation, specifically the 'C' region, and BRAF V600E status has been reported in CRC studies. Germline MMR mutations also greatly increase risk of endometrial cancer (EC), but no systematic review has been undertaken to determine if these tumour markers may be useful predictors of MMR mutation status in EC patients. Endometrial cancer cohorts meeting review inclusion criteria encompassed 2675 tumours from 20 studies for BRAF V600E, and 447 tumours from 11 studies for MLH1 methylation testing. BRAF V600E mutations were reported in 4/2675 (0.1%) endometrial tumours of unknown MMR mutation status, and there were 7/823 (0.9%) total sequence variants in exon 11 and 27/1012 (2.7%) in exon 15. Promoter MLH1 methylation was not observed in tumours from 32 MLH1 mutation carriers, or for 13 MSH2 or MSH6 mutation carriers. MMR mutation-negative individuals with tumour MLH1 and PMS2 IHC loss displayed MLH1 methylation in 48/51 (94%) of tumours. We have also detailed specific examples that show the importance of MLH1 promoter region, assay design, and quantification of methylation. This review shows that BRAF mutations occurs so infrequently in endometrial tumours they can be discounted as a useful marker for predicting MMR-negative mutation status, and further studies of endometrial cohorts with known MMR mutation status are necessary to quantify the utility of tumour MLH1 promoter methylation as a marker of negative germline MMR mutation status in EC patients.

  10. 40 CFR 80.140 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... evaluated by weight. Leaded gasoline means gasoline which is produced with the use of any lead additive or... FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.140 Definitions. The definitions in this section apply... given them in 40 CFR part 79, subpart A. Additization means the addition of detergent to gasoline or...

  11. Corrective Action Decision Document for Corrective Action Unit 140: Waste Dumps, Burn Pits, and Storage Area, Nevada Test Site, Nevada, Revision 1 with ROTC 1

    International Nuclear Information System (INIS)

    Boehlecke, Robert

    2004-01-01

    This Corrective Action Decision Document (CADD) has been prepared for Corrective Action Unit (CAU) 140: Waste Dumps, Burn Pits, and Storage Area, Nevada Test Site (NTS), Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 140 is located within Areas 5, 22, and 23 of the NTS and is comprised of the following corrective action sites (CASs): 05-08-01, Detonation Pits; 05-08-02, Debris Pits; 05-17-01, Hazardous Waste Accumulation Site (Buried); 05-19-01, Waste Disposal Site; 05-23-01, Gravel Gertie; 05-35-01, Burn Pit; 05-99-04, Burn Pit; 22-99-04, Radioactive Waste Dump; and 23-17-01, Hazardous Waste Storage Area. The purpose of this CADD is to identify and provide a rationale for the recommendation of a corrective action alternative for each CAS within CAU 140. Corrective action investigation activities were performed from November 13 through December 11, 2002. Additional sampling to delineate the extent of contaminants of concern (COCs) was conducted on February 4 and March 18 and 19, 2003. Corrective action investigation activities were performed as set forth in the Corrective Action Investigation Plan for CAU 140. Analytes detected during the corrective action investigation were evaluated against appropriate preliminary action levels to identify COCs for each CAS. Assessment of the data generated from investigation activities revealed the following: (1) CAS 05-08-01 contains the COCs lead and the radioisotope thorium-234 in the surface soil at sample location A05. (2) CAS 05-23-01 did not have any COCs identified during the field investigation; however, based on historical knowledge of activities at this site, the interior of the Gravel Gertie is considered contaminated with uranium. (3) CAS 23-17-01 contains the COC total petroleum hydrocarbons (diesel-range organics) at location J20 at a depth of 9 to 10 feet below ground surface. (4) No COCs were identified at CASs 05-08-02, 05-17-01, 05-19-01, 05

  12. Atomic Energy Commission Act, 2000 (Act 588)

    International Nuclear Information System (INIS)

    2000-01-01

    Act 588 of the Republic of Ghana entitled, Atomic Energy Commission Act, 2000, amends and consolidates the Atomic Energy Commission Act, 204 of 1963 relating to the establishment of the Atomic Energy Commission. Act 588 makes provision for the Ghana Atomic Energy Commission to establish more institutes for the purpose of research in furtherance of its functions and also promote the commercialization of its research and development results. (E.A.A.)

  13. Evolução sócio-profissional de 140 pacientes epilépticos submetidos a tratamento medicamentoso The socio-professional evolution of 140 epileptic patients submitted to antiepileptic drug therapy

    Directory of Open Access Journals (Sweden)

    Luís Marques-Assis

    1968-09-01

    Full Text Available É estudada a evolução sócio-profissional de 140 doentes epilépticos, submetidos apenas a tratamento medicamentoso. Foram empregadas drogas de fácil aquisição em nosso meio (barbitúricos, hidantoinatos, primidona e trimetadiona, utilizadas isolada ou combinadamente. No estudo foram consideradas basicamente as atividades escolares, domésticas e profissionais. A evolução sócio-profissional foi estudada em relação às manifestações clínicas, ao tempo de doença, à freqüência das crises e ao padrão eletrencefalográfico. Os resultados, expressos em índices percentuais, permitiram ao autor concluir que na maioria dos pacientes epilépticos, convenientemente tratados do ponto de vista clínico, os problemas sociais e profissionais podem ser corrigidos ou evitados, independentemente de outras medidas especializadas que possam ser postas em prática.The socio-professional evolution of 140 epileptic patients submitted to antiepileptic drug therapy is studied. Only barbiturates, hydantoin, primidone and trimethadione were administered to the patients, isolated or in association. The school, house keeper and professional activities were considered in the investigation. The socio-professional follow-up was investigated regarding to clinic manifestations, time of disease, frequency of seizures and electroencephalographic pattern. The results, analysed in percentage, led the author to the conclusion that in most epileptic patients, adequately controlled with drugs, the social and the professional problems can be avoided.

  14. The human papillomavirus type 16 E6 oncoprotein activates mTORC1 signaling and increases protein synthesis.

    Science.gov (United States)

    Spangle, Jennifer M; Münger, Karl

    2010-09-01

    The mammalian target of rapamycin (mTOR) kinase acts as a cellular rheostat that integrates signals from a variety of cellular signal transduction pathways that sense growth factor and nutrient availability as well as intracellular energy status. It was previously reported that the human papillomavirus type 16 (HPV16) E6 oncoprotein may activate the S6 protein kinase (S6K) through binding and E6AP-mediated degradation of the mTOR inhibitor tuberous sclerosis complex 2 (TSC2) (Z. Lu, X. Hu, Y. Li, L. Zheng, Y. Zhou, H. Jiang, T. Ning, Z. Basang, C. Zhang, and Y. Ke, J. Biol. Chem. 279:35664-35670, 2004; L. Zheng, H. Ding, Z. Lu, Y. Li, Y. Pan, T. Ning, and Y. Ke, Genes Cells 13:285-294, 2008). Our results confirmed that HPV16 E6 expression causes an increase in mTORC1 activity through enhanced phosphorylation of mTOR and activation of downstream signaling pathways S6K and eukaryotic initiation factor binding protein 1 (4E-BP1). However, we did not detect a decrease in TSC2 levels in HPV16 E6-expressing cells. We discovered, however, that HPV16 E6 expression causes AKT activation through the upstream kinases PDK1 and mTORC2 under conditions of nutrient deprivation. We show that HPV16 E6 expression causes an increase in protein synthesis by enhancing translation initiation complex assembly at the 5' mRNA cap and an increase in cap-dependent translation. The increase in cap-dependent translation likely results from HPV16 E6-induced AKT/mTORC1 activation, as the assembly of the translation initiation complex and cap-dependent translation are rapamycin sensitive. Lastly, coexpression of the HPV16 E6 and E7 oncoproteins does not affect HPV16 E6-induced activation of mTORC1 and cap-dependent translation. HPV16 E6-mediated activation of mTORC1 signaling and cap-dependent translation may be a mechanism to promote viral replication under conditions of limited nutrient supply in differentiated, HPV oncoprotein-expressing proliferating cells.

  15. GMP-140 binds to a glycoprotein receptor on human neutrophils: Evidence for a lectin-like interaction

    International Nuclear Information System (INIS)

    Moore, K.L.; Varki, A.; McEver, R.P.

    1991-01-01

    GMP-140 is a rapidly inducible receptor for neutrophils and monocytes expressed on activated platelets and endothelial cells. It is a member of the selectin family of lectin-like cell surface molecules that mediate leukocyte adhesion. We used a radioligand binding assay to characterize the interaction of purified GMP-140 with human neutrophils. Unstimulated neutrophils rapidly bound [125I]GMP-140 at 4 degrees C, reaching equilibrium in 10-15 min. Binding was Ca2+ dependent, reversible, and saturable at 3-6 nM free GMP-140 with half-maximal binding at approximately 1.5 nM. Receptor density and apparent affinity were not altered when neutrophils were stimulated with 4 beta-phorbol 12-myristate 13-acetate. Treatment of neutrophils with proteases abolished specific binding of [125I]GMP-140. Binding was also diminished when neutrophils were treated with neuraminidase from Vibrio cholerae, which cleaves alpha 2-3-, alpha 2-6-, and alpha 2-8-linked sialic acids, or from Newcastle disease virus, which cleaves only alpha 2-3- and alpha 2-8-linked sialic acids. Binding was not inhibited by an mAb to the abundant myeloid oligosaccharide, Lex (CD15), or by the neoglycoproteins Lex-BSA and sialyl-Lex-BSA. We conclude that neutrophils constitutively express a glycoprotein receptor for GMP-140, which contains sialic acid residues that are essential for function. These findings support the concept that GMP-140 interacts with leukocytes by a lectin-like mechanism

  16. Act to amend cost regulations of the Atomic Energy Act

    International Nuclear Information System (INIS)

    1980-01-01

    Article 21 is replaced by articles 21 to 21b. According to this, fees or reimbursements for expenses for official acts (e.g. decisions, supervisory acts, safeguarding of nuclear fuels) as well as for the use of facilities according to article 9a, section 3, of the Atomic Energy Act (e.g. Laender facilities to collect nuclear waste). (HP) [de

  17. 23 CFR 140.603 - Programs.

    Science.gov (United States)

    2010-04-01

    ... Bond Issue Projects § 140.603 Programs. Programs covering projects to be financed from the proceeds of bonds shall be prepared and submitted to FHWA. Project designations shall be the same as for regular Federal-aid projects except that the prefix letter “B” for bond issue shall be used as the first letter of...

  18. The Tomato U-Box Type E3 Ligase PUB13 Acts With Group III Ubiquitin E2 Enzymes to Modulate FLS2-Mediated Immune Signaling

    Directory of Open Access Journals (Sweden)

    Bangjun Zhou

    2018-05-01

    Full Text Available In Arabidopsis and rice, the ubiquitin ligase PUB13-mediated protein degradation plays a significant role in plant pattern-triggered immunity (PTI and flowering time control. The Arabidopsis PUB13 has been shown to attenuate the pattern recognition receptor FLS2-mediated immune signaling by ubiquitinating FLS2 and consequently promoting its degradation by the 26S proteasome. Nevertheless, the cognate ubiquitin-conjugating enzymes (E2 with which PUB13 acts to modulate FLS2-mediated PTI are unknown. To address this question, we investigate here the tomato (Solanum lycopersicum homolog of PUB13, SlPUB13 by utilizing the recently characterized complete set of tomato E2s. Of the 13 groups of tomato E2s, only members in group III are found to interact and act with SlPUB13. Knocking-down of the group III E2 genes enhances callose deposition and induction of the RbohB gene in the immunity-associated, early oxidative burst after flg22 treatment. The group III E2s are also found to work with SlPUB13 to ubiquitinate FLS2 in vitro and are required for PUB13-mediated degradation of FLS2 in vivo upon flg22 treatment, suggesting an essential role for group III E2s in the modulation of FLS2-mediated immune signaling by PUB13. Additionally, another immunity-associated E3, NtCMPG1 is shown to also work specifically with members of group III E2 in the in vitro ubiquitination assay, which implies the group III E2 enzymes may cooperate with many E3 ligases to regulate different aspects of PTI. Taken together, these data corroborate the notion that group III E2 enzymes play an important role in PTI and build a foundation for further functional and mechanistic characterization of tomato PUB13.

  19. 21 CFR 173.140 - Esterase-lipase derived from Mucor miehei.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Esterase-lipase derived from Mucor miehei. 173.140... HUMAN CONSUMPTION Enzyme Preparations and Microorganisms § 173.140 Esterase-lipase derived from Mucor miehei. Esterase-lipase enzyme, consisting of enzyme derived from Mucor miehei var. Cooney et Emerson by...

  20. Thermal annealing of radiation damage in CMOS ICs in the temperature range -140 C to +375 C

    Science.gov (United States)

    Danchenko, V.; Fang, P. H.; Brashears, S. S.

    1982-01-01

    Annealing of radiation damage was investigated in the commercial, Z- and J-processes of the RCA CD4007A ICs in the temperature range from -140 C to +375 C. Tempering curves were analyzed for activation energies of thermal annealing, following irradiation at -140 C. It was found that at -140 C, the radiation-induced shifts in the threshold potentials were similar for all three processes. The radiation hardness of the Z- and J-process is primarily due to rapid annealing of radiation damage at room temperature. In the region -140 to 20 C, no dopant-dependent charge trapping is seen, similar to that observed at higher temperatures. In the unbiased Z-process n-channels, after 1 MeV electron irradiation, considerable negative charge remains in the gate oxide.

  1. Hidden Lineage Complexity of Glycan-Dependent HIV-1 Broadly Neutralizing Antibodies Uncovered by Digital Panning and Native-Like gp140 Trimer

    Directory of Open Access Journals (Sweden)

    Linling He

    2017-08-01

    Full Text Available Germline precursors and intermediates of broadly neutralizing antibodies (bNAbs are essential to the understanding of humoral response to HIV-1 infection and B-cell lineage vaccine design. Using a native-like gp140 trimer probe, we examined antibody libraries constructed from donor-17, the source of glycan-dependent PGT121-class bNAbs recognizing the N332 supersite on the HIV-1 envelope glycoprotein. To facilitate this analysis, a digital panning method was devised that combines biopanning of phage-displayed antibody libraries, 900 bp long-read next-generation sequencing, and heavy/light (H/L-paired antibodyomics. In addition to single-chain variable fragments resembling the wild-type bNAbs, digital panning identified variants of PGT124 (a member of the PGT121 class with a unique insertion in the heavy chain complementarity-determining region 1, as well as intermediates of PGT124 exhibiting notable affinity for the native-like trimer and broad HIV-1 neutralization. In a competition assay, these bNAb intermediates could effectively compete with mouse sera induced by a scaffolded BG505 gp140.681 trimer for the N332 supersite. Our study thus reveals previously unrecognized lineage complexity of the PGT121-class bNAbs and provides an array of library-derived bNAb intermediates for evaluation of immunogens containing the N332 supersite. Digital panning may prove to be a valuable tool in future studies of bNAb diversity and lineage development.

  2. Hidden Lineage Complexity of Glycan-Dependent HIV-1 Broadly Neutralizing Antibodies Uncovered by Digital Panning and Native-Like gp140 Trimer.

    Science.gov (United States)

    He, Linling; Lin, Xiaohe; de Val, Natalia; Saye-Francisco, Karen L; Mann, Colin J; Augst, Ryan; Morris, Charles D; Azadnia, Parisa; Zhou, Bin; Sok, Devin; Ozorowski, Gabriel; Ward, Andrew B; Burton, Dennis R; Zhu, Jiang

    2017-01-01

    Germline precursors and intermediates of broadly neutralizing antibodies (bNAbs) are essential to the understanding of humoral response to HIV-1 infection and B-cell lineage vaccine design. Using a native-like gp140 trimer probe, we examined antibody libraries constructed from donor-17, the source of glycan-dependent PGT121-class bNAbs recognizing the N332 supersite on the HIV-1 envelope glycoprotein. To facilitate this analysis, a digital panning method was devised that combines biopanning of phage-displayed antibody libraries, 900 bp long-read next-generation sequencing, and heavy/light (H/L)-paired antibodyomics. In addition to single-chain variable fragments resembling the wild-type bNAbs, digital panning identified variants of PGT124 (a member of the PGT121 class) with a unique insertion in the heavy chain complementarity-determining region 1, as well as intermediates of PGT124 exhibiting notable affinity for the native-like trimer and broad HIV-1 neutralization. In a competition assay, these bNAb intermediates could effectively compete with mouse sera induced by a scaffolded BG505 gp140.681 trimer for the N332 supersite. Our study thus reveals previously unrecognized lineage complexity of the PGT121-class bNAbs and provides an array of library-derived bNAb intermediates for evaluation of immunogens containing the N332 supersite. Digital panning may prove to be a valuable tool in future studies of bNAb diversity and lineage development.

  3. 24 CFR 964.140 - Resident training.

    Science.gov (United States)

    2010-04-01

    ... TENANT PARTICIPATION AND TENANT OPPORTUNITIES IN PUBLIC HOUSING Tenant Participation § 964.140 Resident... Resident Management Corporations and duly elected Resident Councils; (3) Public housing policies, programs... colleges, vocational schools; and (4) HUD and other Federal agencies and other local public, private and...

  4. 77 FR 41997 - Privacy Act of 1974; Notice of a New System of Records, Office of General Counsel E-Discovery...

    Science.gov (United States)

    2012-07-17

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5613-N-06] Privacy Act of 1974; Notice of a New System of Records, Office of General Counsel E-Discovery Management System AGENCY: Office of the Chief Information Officer. ACTION: Notification of New Privacy Act System of Records, E-Discovery...

  5. Main: 1E1E [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available Mays Molecule: Beta-Glucosidase; Chain: A, B; Engineered: Yes Glycoside Hydrolase 3.2.1.21 (Beta-Glucosidas..., B.Henrissat, A.Esen Crystal Structure Of A Monocotyledon (Maize Zmglu1) Beta-Gl...55-566.|PDB; 1E55; X-ray; A/B=55-566.|PDB; 1E56; X-ray; A/B=55-566.|PDB; 1H49; X-ray; A/B=55-566.|PDB; 1HXJ; X-ray; A/B=60-566.|Mai...ze-2DPAGE; P49235; COLEOPTILE.|MaizeDB; 13870; -.|InterPro

  6. e+e- colliding beams in Novosibirsk. Status and plans

    International Nuclear Information System (INIS)

    Protopopov, I.Ya.

    1987-01-01

    The status of the VEPP-4 and VEPP-2M is described. At present, the reconstruction of the facilities is underway, which is to be completed by 1989. Solution is taken to construct the ring mirror-symmetrically as to the axis. Two-bunch operation mode is being prepared. Modifications in the RF-system are planned. A new detector with a longitudinal field is envisaged in the VEPP-4. The diagram of design luminosity of the VEPP-4 is presented. It is expected that VEPP-4 luminosity in the range of γ-resonance energies can be close to 10 32 cm -2 xs -1

  7. S6K1 and 4E-BP1 are independent regulated and control cellular growth in bladder cancer.

    Directory of Open Access Journals (Sweden)

    Roman Nawroth

    Full Text Available Aberrant activation and mutation status of proteins in the phosphatidylinositol-3-kinase (PI3K/Akt/mammalian target of rapamycin (mTOR and the mitogen activated protein kinase (MAPK signaling pathways have been linked to tumorigenesis in various tumors including urothelial carcinoma (UC. However, anti-tumor therapy with small molecule inhibitors against mTOR turned out to be less successful than expected. We characterized the molecular mechanism of this pathway in urothelial carcinoma by interfering with different molecular components using small chemical inhibitors and siRNA technology and analyzed effects on the molecular activation status, cell growth, proliferation and apoptosis. In a majority of tested cell lines constitutive activation of the PI3K was observed. Manipulation of mTOR or Akt expression or activity only regulated phosphorylation of S6K1 but not 4E-BP1. Instead, we provide evidence for an alternative mTOR independent but PI3K dependent regulation of 4E-BP1. Only the simultaneous inhibition of both S6K1 and 4E-BP1 suppressed cell growth efficiently. Crosstalk between PI3K and the MAPK signaling pathway is mediated via PI3K and indirect by S6K1 activity. Inhibition of MEK1/2 results in activation of Akt but not mTOR/S6K1 or 4E-BP1. Our data suggest that 4E-BP1 is a potential new target molecule and stratification marker for anti cancer therapy in UC and support the consideration of a multi-targeting approach against PI3K, mTORC1/2 and MAPK.

  8. Fibulin-1 functions as a prognostic factor in lung adenocarcinoma.

    Science.gov (United States)

    Cui, Yuan; Liu, Jian; Yin, Hai-Bing; Liu, Yi-Fei; Liu, Jun-Hua

    2015-09-01

    Fibulin-1 is a member of the fibulin gene family, characterized by tandem arrays of epidermal growth factor-like domains and a C-terminal fibulin-type module. Fibulin-1 plays important roles in a range of cellular functions including morphology, growth, adhesion and mobility. It acts as a tumor suppressor gene in cutaneous melanoma, prostate cancer and gastric cancer. However, whether fibulin-1 also acts as a tumor suppressor gene in lung adenocarcinoma remains unknown. We also determined the association of fibulin-1 expression with various clinical and pathological parameters, which would show its potential role in clinical prognosis. We investigated and followed up 140 lung adenocarcinoma patients who underwent lung resection without pre- and post-operative systemic chemotherapy at the Affiliated Hospital of Nantong University from 2009 to 2013. Western blot assay and immunohistochemistry were used to evaluate the expression of fibulin-1 in lung adenocarcinoma tissues. We then analyzed the correlations between fibulin-1 expression and clinicopathological variables as well as the patients' overall survival rate. Both western blot assay and immunohistochemistry demonstrated that the level of fibulin-1 was downregulated in human lung adenocarcinoma tissues compared with that of normal lung tissues. Fibulin-1 expression significantly correlated with histological differentiation (P = 0.046), clinical stage (P< 0.01), lymph node status (P = 0.038) and expression of Ki-67 (P = 0.013). More importantly, multivariate analysis revealed that fibulin-1 was an independent prognostic marker for lung adenocarcinoma, and high expression of fibulin-1 was significantly associated with better prognosis of lung adenocarcinoma patients. The results supported our hypothesis that fibulin-1 can act as a prognostic factor in lung adenocarcinoma progression. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Effects of a long-acting trace mineral rumen bolus supplement on growth performance, metabolic profiles, and trace mineral status of growing camels.

    Science.gov (United States)

    Alhidary, Ibrahim A; Abdelrahman, Mutassim M; Harron, Raafat M

    2016-04-01

    A study was conducted to evaluate the effects of a long-acting trace mineral rumen bolus (TMB) supplement on the productive performance, metabolic profiles, and trace mineral status of growing camels under natural grazing conditions. Fifteen 6-month-old growing male camels (average bodyweight 139.51 ± 26.49 kg) were used in a 150-day trial. Animals were individually housed in a shaded pen and randomly assigned to receive zero (control group, CON), one (TMB1), or two (TMB2) long-acting TMBs. Feed intake was measured weekly, and camels were weighed monthly. Blood samples were collected from all camels on days 1, 30, 60, 90, 120, and 150 to obtain metabolic profiles. Zinc, selenium, copper, cobalt, and manganese concentrations were determined in the diet, serum, and liver. In comparison with controls, giving camels one TMB increased the average daily gain (14.38%; P camels in the TMB2 group. These data indicate that TMB supplementation has positive effects on the growth performance and trace mineral profiles of camels. Different levels, sources, and synergistic combinations of trace minerals can be used in further studies to elucidate their abilities to increase productive variables as well as their availability and cost to the camel industry.

  10. Hpa1 harpin needs nitroxyl terminus to promote vegetative growth ...

    Indian Academy of Sciences (India)

    2014-01-27

    Jan 27, 2014 ... When Hpa1 was applied to plants, it acted to enhance the vegetative growth but did not affect the .... Plants were grown in pots containing potting soils in an environ- mentally .... adapted to dark for 20 minutes and then adjusted to PPFD 1500 ... X. oryzae pv. oryzae Hpa1 contains 140 amino acids and has.

  11. ADAPTAÃÃO E VALIDAÃÃO DA ESCALA DE CONSUMO DE STATUS (SCS PARA USO NO CONTEXTE BRASILEIRO

    Directory of Open Access Journals (Sweden)

    Francisco Aranha

    2004-06-01

    Full Text Available O Brasil tem se destacado no mercado dos bens de Iuxo, que tem no status um dos seus principais componentes. Este artigo relata a adaptação e validação, para usa no contexto brasileiro, de uma escala auto declarativa e concisa de medição de consumo de status, conhecida como SCS (Status Consumption Scale. Originalmente desenvolvida par Eastman (1999 nos Estados Unidos, a escala possibilita a utilização do conceito de status par pesquisadores e profissionais de marketing de forma mais precisa e sistemática. Para o processo de adaptação e validação, foram aplicados 385 questionários a estudantes de cursos de graduação na cidade de São Paulo. Os resultados mostraram-se amplamente satisfat6riost confirmando a validade interna da escala e sua confiabilidade também para o caso de consumidores brasileiros.

  12. Combined effect of Hashimoto's thyroiditis and BRAF(V600E) mutation status on aggressiveness in papillary thyroid cancer.

    Science.gov (United States)

    Kim, Su-jin; Myong, Jun Pyo; Jee, Hyeon-Gun; Chai, Young Jun; Choi, June Young; Min, Hye Sook; Lee, Kyu Eun; Youn, Yeo-Kyu

    2016-01-01

    The purpose of this study was to evaluate the association between Hashimoto's thyroiditis and BRAF(V600E) mutation status in patients with papillary thyroid cancer (PTC) and to determine their combined association with tumor aggressiveness in PTC. A total of 1780 patients with PTC who underwent surgery were enrolled in this study. Simple and multiple analyses were performed to determine the association between Hashimoto's thyroiditis and the BRAF(V600E) mutation in PTC. Hashimoto's thyroiditis was present in 11.5% of patients (204/1780) with PTC. Multiple logistic regressions showed that BRAF(V600E) (odds ratio [OR] = 0.493; 95% confidence interval [CI] = 0.360-0.678) and the female sex (OR = 7.146; 95% CI = 3.408-18.347) were independent factors associated with Hashimoto's thyroiditis in PTC. BRAF(V600E) mutation and the Hashimoto's thyroiditis-negative PTC group were associated with aggressive disease (OR = 3.069; 95% CI = 1.654-5.916). Hashimoto's thyroiditis was associated less frequently with BRAF(V600E) , and frequently with the female sex in patients with PTC. Hashimoto's thyroiditis and BRAF(V600E) status may help to predict clinical outcome of PTC. © 2015 Wiley Periodicals, Inc.

  13. 76 FR 78483 - S.A.F.E. Mortgage Licensing Act (Regulations G & H)

    Science.gov (United States)

    2011-12-19

    ... BUREAU OF CONSUMER FINANCIAL PROTECTION 12 CFR Part 1007 and 1008 [Docket No. CFPB-2011-0023] RIN 3170-AA06 S.A.F.E. Mortgage Licensing Act (Regulations G & H) AGENCY: Bureau of Consumer Financial... number of consumer financial protection laws from seven Federal agencies to the Bureau of Consumer...

  14. 76 FR 17712 - Sunshine Act; Notice Of Agency Meeting

    Science.gov (United States)

    2011-03-30

    ... NATIONAL CREDIT UNION ADMINISTRATION Sunshine Act; Notice Of Agency Meeting TIME AND DATE: 9:30 a.m., Monday, April 4, 2011. PLACE: Westin San Diego Hotel, Board Room, 3rd Floor, 400 West Broadway, San Diego, CA 92101. STATUS: Closed. MATTERS TO BE CONSIDERED: 1. Consideration of Supervisory...

  15. Directional selection at the pfmdr1, pfcrt, pfubp1, and pfap2mu loci of Plasmodium falciparum in Kenyan children treated with ACT.

    Science.gov (United States)

    Henriques, Gisela; Hallett, Rachel L; Beshir, Khalid B; Gadalla, Nahla B; Johnson, Rachel E; Burrow, Rebekah; van Schalkwyk, Donelly A; Sawa, Patrick; Omar, Sabah A; Clark, Taane G; Bousema, Teun; Sutherland, Colin J

    2014-12-15

    The efficacy of artemisinin-based combination therapy (ACT) for Plasmodium falciparum malaria may be threatened by parasites with reduced responsiveness to artemisinins. Among 298 ACT-treated children from Mbita, Kenya, submicroscopic persistence of P. falciparum on day 3 posttreatment was associated with subsequent microscopically detected parasitemia at days 28 or 42. DNA sequences of resistance-associated parasite loci pfcrt, pfmdr1, pfubp1, and pfap2mu were determined in the Mbita cohort before treatment, on days 2 and 3 after initiation of treatment, and on the day of treatment failure. Parasites surviving ACT on day 2 or day 3 posttreatment were significantly more likely than the baseline population to carry the wild-type haplotypes of pfcrt (CVMNK at codons 72-76; P < .001) and pfmdr1 (NFD at codons 86, 184, 1246; P < .001). In contrast, variant alleles of the novel candidate resistance genes pfap2mu (S160N/T; P = .006) and pfubp-1 (E1528D; P < .001) were significantly more prevalent posttreatment. No genetic similarities were found to artemisinin-tolerant parasites recently described in Cambodia. Among treated children in western Kenya, certain P. falciparum genotypes defined at pfcrt, pfmdr1, pfap2mu, and pfubp1 more often survive ACT at the submicroscopic level, and contribute to onward transmission and subsequent patent recrudescence. © The Author 2014. Published by Oxford University Press on behalf of the Infectious Diseases Society of America.

  16. Vitamin E - its status and role in leukemia and lymphoma

    International Nuclear Information System (INIS)

    Dasgupta, J.; Das, S.; Sanyal, U.

    1993-01-01

    A comparative study has been performed on the relationship between vitamin E and immuno-function in normal and malignant condition in human and murine systems. Further, the effects of supplemental vitamin E on tumor take, host survival and tumor growth has been studied in a transplantable lymphoma in mice. Vitamin E was assayed in serum samples from normal subjects and from patient with leukemia and lymphoma by high performance liquid chromatography (HPLC) The murine group included Dalton's ascite lymphoma (DL), Schwartz lymphoblastic leukemia (SVL) and Moloney lymphoblastic leukemia (MVL). Serum vitamin E was found to be lower than that of the normal controls in all cases of leukemia and lymphoma both in human and lymphoma. Supplementary vitamin E administered at the initial phase of development of murine lymphomas reduced the rate of tumor growth, improved host survival and elevated serum vitamin E level. Vitamin E supplementation also activated specific induced blastogenesis of peripheral blood lymphocytes (PBL) and elevated serum IgG level. IgM remained unaltered and and macrophage activity did not seem to be affected. The present findings indicated a low status of vitamin E in tumor bearing host and beneficial effect of supplemental vitamin E on the host which was mediated by the host immune system. (author)

  17. 17 CFR 201.140 - Commission orders and decisions: Signature and availability.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Commission orders and decisions: Signature and availability. 201.140 Section 201.140 Commodity and Securities Exchanges SECURITIES... and decisions: Signature and availability. (a) Signature required. All orders and decisions of the...

  18. Arsenite promotes centrosome abnormalities under a p53 compromised status induced by 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone (NNK)

    International Nuclear Information System (INIS)

    Liao, W.-T.; Yu, H.-S.; Lin Pinpin; Chang, Louis W.

    2010-01-01

    Epidemiological evidence indicated that residents, especially cigarette smokers, in arseniasis areas had significantly higher lung cancer risk than those living in non-arseniasis areas. Thus an interaction between arsenite and cigarette smoking in lung carcinogenesis was suspected. In the present study, we investigated the interactions of a tobacco-specific carcinogen 4- (methylnitrosamino)-1-(3-pyridyl)-1-butanone (nicotine-derived nitrosamine ketone, NNK) and arsenite on lung cell transformation. BEAS-2B, an immortalized human lung epithelial cell line, was selected to test the centrosomal abnormalities and colony formation by NNK and arsenite. We found that NNK, alone, could enhance BEAS-2B cell growth at 1-5 μM. Under NNK exposure, arsenite was able to increase centrosomal abnormality as compared with NNK or arsenite treatment alone. NNK treatment could also reduce arsenite-induced G2/M cell cycle arrest and apoptosis, these cellular effects were found to be correlated with p53 dysfunction. Increased anchorage-independent growth (colony formation) of BEAS-2B cells cotreated with NNK and arsenite was also observed in soft agar. Our present investigation demonstrated that NNK could provide a p53 compromised status. Arsenite would act specifically on this p53 compromised status to induce centrosomal abnormality and colony formation. These findings provided strong evidence on the carcinogenic promotional role of arsenite under tobacco-specific carcinogen co-exposure.

  19. 75 FR 33367 - Board of Governors; Sunshine Act Meeting

    Science.gov (United States)

    2010-06-11

    ... POSTAL SERVICE Board of Governors; Sunshine Act Meeting Times and Dates: 4 p.m., Monday, June 21... Broadway. Status: (Closed). Matters To Be Considered: Monday, June 21, at 4 p.m. (Closed) 1. Strategic...' Executive Session--Discussion of prior agenda items and Board Governance. Tuesday, June 22, at 10 a.m...

  20. Liquid density of biofuel mixtures: (Dibutyl ether + 1-butanol) system at pressures up to 140 MPa and temperatures from (293.15 to 393.15) K

    Energy Technology Data Exchange (ETDEWEB)

    Alaoui, Fatima E.M. [Laboratoire des Fluides Complexes, Faculte des Sciences et Techniques, UMR CNRS 5150, Universite de Pau, BP 1155, 64013 Pau Cedex (France); Departamento de Ingenieria Electromecanica, Escuela Politecnica Superior, Universidad de Burgos, E-09006 Burgos (Spain); Montero, Eduardo A., E-mail: emontero@ubu.es [Departamento de Ingenieria Electromecanica, Escuela Politecnica Superior, Universidad de Burgos, E-09006 Burgos (Spain); Bazile, Jean-Patrick [Laboratoire des Fluides Complexes, Faculte des Sciences et Techniques, UMR CNRS 5150, Universite de Pau, BP 1155, 64013 Pau Cedex (France); Aguilar, Fernando [Departamento de Ingenieria Electromecanica, Escuela Politecnica Superior, Universidad de Burgos, E-09006 Burgos (Spain); Boned, Christian [Laboratoire des Fluides Complexes, Faculte des Sciences et Techniques, UMR CNRS 5150, Universite de Pau, BP 1155, 64013 Pau Cedex (France)

    2011-11-15

    Highlights: > New density data for binary mixtures of (dibutyl ether + 1-butanol) are reported. > The pressure and temperature intervals are 0.1 to 140 MPa and 293.15 to 393.15 K. > 445 Data points measured at five compositions were fitted to a Tait-like equation. > Excess volumes have been calculated from the experimental data. > The isobaric expansivity and the isothermal compressibility have been derived. - Abstract: This work reports new experimental density data (445 points) for binary mixtures of (dibutyl ether + 1-butanol) over the composition range (five compositions; 0.15 {<=} dibutyl ether mole fraction x {<=} 0.85), from (293.15 to 393.15) K (every 20 K), and for 15 pressures from (0.1 to 140) MPa (every 10 MPa). An Anton Paar vibrating tube densimeter, calibrated with an uncertainty of {+-}0.5 kg . m{sup -3} was used to perform these measurements. The experimental density data were fitted with a Tait-like equation with low standard deviations. Excess volumes have been calculated from the experimental data and fitted by the Redlich-Kister equation. In addition, the isobaric thermal expansivity and the isothermal compressibility have been derived from the Tait-like equation.

  1. Perfil clínico e resposta circulatória ao estresse gravitacional ativo de indivíduos pré-hipertensos e sua comparabilidade com hipertensos e normotensos

    OpenAIRE

    Avena, Katia de Miranda

    2013-01-01

    A caracterização do estado pré-hipertensivo é fundamental para prevenção primária da hipertensão. Esse estudo descreve o perfil clínico e a resposta circulatória ao estresse gravitacional ativo (EGA) de pré-hipertensos, comparando-os ao de hipertensos e normotensos. Métodos: Estudo transversal com 137 hipertensos (pressão arterial, PA, ≥140/90mmHg), 72 pré-hipertensos (PA 140-120/90-80mmHg) e 72 normotensos (PA

  2. Fatty Acid Status and Its Relationship to Cognitive Decline and Homocysteine Levels in the Elderly

    Directory of Open Access Journals (Sweden)

    Marília Baierle

    2014-09-01

    Full Text Available Polyunsaturated fatty acids (PUFAs, especially the n-3 series, are known for their protective effects. Considering that cardiovascular diseases are risk factors for dementia, which is common at aging, the aim of this study was to evaluate whether fatty acid status in the elderly was associated with cognitive function and cardiovascular risk. Forty-five elderly persons (age ≥60 years were included and divided into two groups based on their Mini-Mental Status Examination score adjusted for educational level: the case group (n = 12 and the control group (n = 33. Serum fatty acid composition, homocysteine (Hcy, hs-CRP, lipid profile and different cognitive domains were evaluated. The case group, characterized by reduced cognitive performance, showed higher levels of 14:0, 16:0, 16:1n-7 fatty acids and lower levels of 22:0, 24:1n-9, 22:6n-3 (DHA and total PUFAs compared to the control group (p < 0.05. The n-6/n-3 ratio was elevated in both study groups, whereas alterations in Hcy, hs-CRP and lipid profile were observed in the case group. Cognitive function was positively associated with the 24:1n-9, DHA and total n-3 PUFAs, while 14:0, 16:0 and 16:1n-7 fatty acids, the n-6/n-3 ratio and Hcy were inversely associated. In addition, n-3 PUFAs, particularly DHA, were inversely associated with cardiovascular risk, assessed by Hcy levels in the elderly.

  3. Paraoxonase 1 (PON1) status and substrate hydrolysis

    International Nuclear Information System (INIS)

    Richter, Rebecca J.; Jarvik, Gail P.; Furlong, Clement E.

    2009-01-01

    Paraoxonase 1 (PON1) hydrolyzes a number of organophosphorus (OP) compounds including insecticides and nerve agents. The in vivo efficacy of PON1 to protect against a specific OP exposure depends on the catalytic efficiency of hydrolysis. The Q192R polymorphism affects the catalytic efficiency of hydrolysis of some substrates and not others. While PON1 R192 hydrolyzes paraoxon approximately 9-times as efficiently as PON1 Q192 , the efficiency is insufficient to provide in vivo protection against paraoxon/parathion exposure. The two PON1 192 alloforms have nearly equivalent but higher catalytic efficiencies for hydrolyzing diazoxon (DZO) and provide equivalent in vivo protection against DZO exposures. On the other hand, PON1 R192 is significantly more efficient in hydrolyzing chlorpyrifos oxon (CPO) than PON1 Q192 and provides better protection against CPO exposure. Thus, for some exposures it is only the level of plasma PON1 that is important, whereas for others it is both plasma level and the PON1 192 alloform(s) present in plasma that are important. In no case is the plasma level of PON1 unimportant, provided that the catalytic efficiency is sufficient to protect against the exposure. Two-substrate enzyme assay/analysis protocols that reveal both PON1 plasma levels and PON1 192 phenotype (QQ; QR; RR) are designed to optimize the separation of PON1 192 phenotypes; however, they have not been optimized for evaluating in vivo rates of OP detoxication. This study describes the adaptation of a non-OP, two-substrate determination of PON1 status to the conversion of the PON1 status data to physiologically relevant rates of DZO and CPO detoxication. Conversion factors were generated for rates of hydrolysis of different substrates

  4. Mainzer-Saldino Syndrome Is a Ciliopathy Caused by IFT140 Mutations

    Science.gov (United States)

    Perrault, Isabelle; Saunier, Sophie; Hanein, Sylvain; Filhol, Emilie; Bizet, Albane A.; Collins, Felicity; Salih, Mustafa A.M.; Gerber, Sylvie; Delphin, Nathalie; Bigot, Karine; Orssaud, Christophe; Silva, Eduardo; Baudouin, Véronique; Oud, Machteld M.; Shannon, Nora; Le Merrer, Martine; Roche, Olivier; Pietrement, Christine; Goumid, Jamal; Baumann, Clarisse; Bole-Feysot, Christine; Nitschke, Patrick; Zahrate, Mohammed; Beales, Philip; Arts, Heleen H.; Munnich, Arnold; Kaplan, Josseline; Antignac, Corinne; Cormier-Daire, Valérie; Rozet, Jean-Michel

    2012-01-01

    Mainzer-Saldino syndrome (MSS) is a rare disorder characterized by phalangeal cone-shaped epiphyses, chronic renal failure, and early-onset, severe retinal dystrophy. Through a combination of ciliome resequencing and Sanger sequencing, we identified IFT140 mutations in six MSS families and in a family with the clinically overlapping Jeune syndrome. IFT140 is one of the six currently known components of the intraflagellar transport complex A (IFT-A) that regulates retrograde protein transport in ciliated cells. Ciliary abundance and localization of anterograde IFTs were altered in fibroblasts of affected individuals, a result that supports the pivotal role of IFT140 in proper development and function of ciliated cells. PMID:22503633

  5. 31 CFR 363.140 - When is a certificate of indebtedness issued?

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false When is a certificate of indebtedness issued? 363.140 Section 363.140 Money and Finance: Treasury Regulations Relating to Money and Finance... issued? A certificate of indebtedness is issued the business day after the purchase transaction is made. ...

  6. Is bronchial wall imaging affected by temporal resolution? Comparative evaluation at 140 and 75 ms in 90 patients

    Energy Technology Data Exchange (ETDEWEB)

    Hutt, Antoine; Tacelli, Nunzia; Faivre, Jean-Baptiste; Remy, Jacques; Remy-Jardin, Martine [CHRU et Universite de Lille, Department of Thoracic Imaging, Hospital Calmette (EA 2694), Lille (France); Flohr, Thomas [Computed Tomography, Siemens Healthcare, Forchheim (Germany); Duhamel, Alain [CHRU et Universite de Lille, Department of Biostatistics (EA 2694), Lille (France)

    2016-02-15

    To evaluate the influence of temporal resolution (TR) on cardiogenic artefacts at the level of bronchial walls. Ninety patients underwent a dual-source, single-energy chest CT examination enabling reconstruction of images with a TR of 75 ms (i.e., optimized TR) (Group 1) and 140 ms (i.e., standard TR) (Group 2). Cardiogenic artefacts were analyzed at the level of eight target bronchi, i.e., right (R) and left (L) B1, B5, B7, and B10 (total number of bronchi examined: n = 720). Cardiogenic artefacts were significantly less frequent and less severe in Group 1 than in Group 2 (p < 0.0001) with the highest scores of discordant ratings for bronchi in close contact with cardiac cavities: RB5 (61/90; 68 %); LB5 (66/90; 73 %); LB7 (63/90; 70 %). In Group 1, 78 % (560/720) of bronchi showed no cardiac motion artefacts, whereas 22 % of bronchi (160/720) showed artefacts rated as mild (152/160; 95 %), moderate (7/160; 4 %), and severe (1/160; 1 %). In Group 2, 70 % of bronchi (503/720) showed artefacts rated as mild (410/503; 82 %), moderate (82/503; 16 %), and severe (11/503; 2 %). At 75 ms, most bronchi can be depicted without cardiogenic artefacts. (orig.)

  7. Identidade, status e instituições internacionais: o caso do Brasil, da Índia e do tratado de não proliferação Identity, status and international institutions: the case of Brazil, India and the non-proliferation treaty

    Directory of Open Access Journals (Sweden)

    Oliver Stuenkel

    2010-12-01

    Full Text Available A fim de se entender como podemos explicar o comportamento das potências emergentes diante das instituições internacionais, este artigo analisa o caso de Brasil, Índia e do Tratado de Não Proliferação com maior profundidade e mostrar que nem os realistas nem os institucionalistas liberais podem explicar plenamente o comportamento de ambos os países. Argumenta-se, no artigo, que status e identidade, ambos amplamente negligenciados pelo realismo e pelo liberalismo, desempenham um papel-chave. Tanto o Brasil quanto a Índia compartilham uma convicção fundamental de que são "grandes potências" (ou estão no caminho de se tornarem uma, e sua decisão de integrar uma instituição particular depende da habilidade dessa instituição em conferir um status às potências emergentes que seja compatível com a identidade das potências emergentes. Como mostra o exemplo do TNP, status e identidade superam outros determinantes mais comumente aceitos para o comportamento dos Estados, como as preocupações com segurança.In order to understand how we can explain rising powers' behavior towards international institutions, this article analyzes the case of Brazil, India and the Non-Proliferation Treaty (NPT in more depth and shows that neither realists nor liberal institutionalists can fully explain both countries' behavior. In the article it is argued that status and identity, both largely overlooked by realism and liberalism, play a key role. Both Brazil and India share a fundamental conviction that they are 'great powers' (or on their way to becoming one, and their decision to integrate into a particular institution depends on this institutions' ability to confer status on the emerging powers that is compatible with the rising powers' identity. As the example of the NPT shows, status and identity override other, more commonly accepted determinants for states' behavior such as security concerns.

  8. 33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...

  9. ACT Reporting Category Interpretation Guide: Version 1.0. ACT Working Paper 2016 (05)

    Science.gov (United States)

    Powers, Sonya; Li, Dongmei; Suh, Hongwook; Harris, Deborah J.

    2016-01-01

    ACT reporting categories and ACT Readiness Ranges are new features added to the ACT score reports starting in fall 2016. For each reporting category, the number correct score, the maximum points possible, the percent correct, and the ACT Readiness Range, along with an indicator of whether the reporting category score falls within the Readiness…

  10. 78 FR 9721 - Privacy Act of 1974; New System of Records, Office of General Counsel E-Discovery Management...

    Science.gov (United States)

    2013-02-11

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5613-N-06-C] Privacy Act of 1974; New System of Records, Office of General Counsel E-Discovery Management System: Republication of System.... SUMMARY: Pursuant to the provision of the Privacy Act of 1974, HUD is providing notice of its formal...

  11. 7 CFR 1.51 - Claims based on negligence, wrongful act or omission.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Claims based on negligence, wrongful act or omission. 1.51 Section 1.51 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Claims § 1.51 Claims based on negligence, wrongful act or omission. (a) Authority of the Department...

  12. Status of potential PfATP6 molecular markers for artemisinin resistance in Suriname

    Directory of Open Access Journals (Sweden)

    Adhin Malti R

    2012-09-01

    Full Text Available Abstract Background Polymorphisms within the PfATP6 gene have been indicated as potential molecular markers for artemisinin efficacy. Since 2004, the use of artemisinin combination therapy (ACT was introduced as first-line treatment of the uncomplicated malaria cases in Suriname. The aim of this research was to determine changes in Suriname in the status of the polymorphic markers in the PfATP6 gene before and after the adoption of the ACT-regimen, particularly of the S769N mutation, which was reported to be associated with in vitro Artemether resistance in the neighboring country French Guiana. Methods The PfATP6 gene from Plasmodium falciparum parasites in Suriname was investigated in 28 samples using PCR amplification and restriction enzyme analysis, to assess and determine the prevalence of potentially interesting single nucleotide polymorphisms. The polymorphisms [L263E; A623E; S769N], which may be associated with the artemisinin resistant phenotype were characterized in parasites from three endemic regions before and after the adoption of the ACT-regimen. In addition, the status of these molecular markers was compared in paired P. falciparum isolates from patients with recurring malaria after controlled ACT. Results All the investigated samples exhibit the wild-type genotype at all three positions; L263, A623, S769. Conclusion All investigated isolates before and after the adoption of the ACT-regimen and independent of endemic region harbored the wild-type genotype for the three investigated polymorphisms. The study revealed that decreased artemisinin susceptibility could occur independent from PfATP6 mutations, challenging the assumption that artemisinin resistance is associated with these mutations in the PfATP6 gene.

  13. 20 CFR 655.140 - Review of applications.

    Science.gov (United States)

    2010-04-01

    ....140 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY... Temporary Employment Certification and job order for compliance with all applicable program requirements... provided address via traditional methods to assure next day delivery. The employer's response to such a...

  14. Making Legal: The Dream Act, Birthright Citizenship, and Broad-Scale Legalization

    OpenAIRE

    Motomura, Hiroshi

    2013-01-01

    Some of the most controversial topics in immigration and citizenship law involve granting lawful immigration status—or citizenship itself—to persons who might otherwise be in the United States unlawfully. In this Article, I examine arguments for and against three ways to confer lawful status: (1) the DREAM Act, which would grant status to many unauthorized migrants who were brought to the United States as children; (2) the Fourteenth Amendment to the Constitution, under which almost all child...

  15. 41 CFR 102-2.140 - What elements of plain language appear in the FMR?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT REGULATION SYSTEM Plain Language Regulatory Style § 102-2.140 What elements of plain language... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What elements of plain language appear in the FMR? 102-2.140 Section 102-2.140 Public Contracts and Property Management Federal...

  16. Association between amylin and amyloid-β peptides in plasma in the context of apolipoprotein E4 allele.

    Directory of Open Access Journals (Sweden)

    Wei Qiao Qiu

    Full Text Available Amylin, a pancreatic peptide that readily crosses the blood brain barrier (BBB, and amyloid-beta peptide (Aβ, the main component of amyloid plaques and a major component of Alzheimer's disease (AD pathology in the brain, share several features. These include having similar β-sheet secondary structures, binding to the same receptor, and being degraded by the same protease. Thus, amylin may be associated with Aβ, but the nature of their relationship remains unclear. In this study, we used human samples to study the relationship between plasma amylin and Aβ in the context of the apolipoprotein E alleles (ApoE. We found that concentrations of Aβ1-42 (P<0.0001 and Aβ1-40 (P<0.0001 increased with each quartile increase of amylin. Using multivariate regression analysis, the study sample showed that plasma amylin was associated with Aβ1-42 (β = +0.149, SE = 0.025, P<0.0001 and Aβ1-40 (β = +0.034, SE = 0.016, P = 0.04 as an outcome after adjusting for age, gender, ethnicity, ApoE4, BMI, diabetes, stroke, kidney function and lipid profile. This positive association between amylin and Aβ1-42 in plasma was found regardless of the ApoE genotype. In contrast, the relationship between amylin and Aβ1-40 in plasma seen in ApoE4 non-carriers disappeared in the presence of ApoE4. Using AD mouse models, our recent study demonstrates that intraperitoneal (i.p. injection of synthetic amylin enhances the removal of Aβ from the brain into blood, thus resulting in increased blood levels of both amylin and Aβ. The positive association between amylin and Aβ, especially Aβ1-42, in human blood samples is probably relevant to the findings in the AD mouse models. The presence of ApoE4 may attenuate amylin's capacity to remove Aβ, especially Aβ1-40, from the AD brain.

  17. Novel bis-(−)-nor-meptazinol derivatives act as dual binding site AChE inhibitors with metal-complexing property

    Energy Technology Data Exchange (ETDEWEB)

    Zheng, Wei [Department of Medicinal Chemistry, School of Pharmacy, Fudan University, 826 Zhangheng Road, Shanghai 200032 (China); NPFPC Key Laboratory of Contraceptives and Devices, Shanghai Institute of Planned Parenthood Research, 2140 Xietu Road, Shanghai 200032 (China); Li, Juan [Department of Pharmacology, Institute of Medical Sciences, Shanghai Jiaotong University School of Medicine, 280 South Chongqing Road, Shanghai 200025 (China); Qiu, Zhuibai [Department of Medicinal Chemistry, School of Pharmacy, Fudan University, 826 Zhangheng Road, Shanghai 200032 (China); Xia, Zheng [Department of Pharmacology, Institute of Medical Sciences, Shanghai Jiaotong University School of Medicine, 280 South Chongqing Road, Shanghai 200025 (China); Li, Wei [Department of Medicinal Chemistry, School of Pharmacy, Fudan University, 826 Zhangheng Road, Shanghai 200032 (China); Yu, Lining; Chen, Hailin; Chen, Jianxing [NPFPC Key Laboratory of Contraceptives and Devices, Shanghai Institute of Planned Parenthood Research, 2140 Xietu Road, Shanghai 200032 (China); Chen, Yan; Hu, Zhuqin; Zhou, Wei; Shao, Biyun; Cui, Yongyao [Department of Pharmacology, Institute of Medical Sciences, Shanghai Jiaotong University School of Medicine, 280 South Chongqing Road, Shanghai 200025 (China); Xie, Qiong, E-mail: xiejoanxq@gmail.com [Department of Medicinal Chemistry, School of Pharmacy, Fudan University, 826 Zhangheng Road, Shanghai 200032 (China); Chen, Hongzhuan, E-mail: yaoli@shsmu.edu.cn [Department of Pharmacology, Institute of Medical Sciences, Shanghai Jiaotong University School of Medicine, 280 South Chongqing Road, Shanghai 200025 (China)

    2012-10-01

    The strategy of dual binding site acetylcholinesterase (AChE) inhibition along with metal chelation may represent a promising direction for multi-targeted interventions in the pathophysiological processes of Alzheimer's disease (AD). In the present study, two derivatives (ZLA and ZLB) of a potent dual binding site AChE inhibitor bis-(−)-nor-meptazinol (bis-MEP) were designed and synthesized by introducing metal chelating pharmacophores into the middle chain of bis-MEP. They could inhibit human AChE activity with IC{sub 50} values of 9.63 μM (for ZLA) and 8.64 μM (for ZLB), and prevent AChE-induced amyloid-β (Aβ) aggregation with IC{sub 50} values of 49.1 μM (for ZLA) and 55.3 μM (for ZLB). In parallel, molecular docking analysis showed that they are capable of interacting with both the catalytic and peripheral anionic sites of AChE. Furthermore, they exhibited abilities to complex metal ions such as Cu(II) and Zn(II), and inhibit Aβ aggregation triggered by these metals. Collectively, these results suggest that ZLA and ZLB may act as dual binding site AChEIs with metal-chelating potency, and may be potential leads of value for further study on disease-modifying treatment of AD. -- Highlights: ► Two novel bis-(−)-nor-meptazinol derivatives are designed and synthesized. ► ZLA and ZLB may act as dual binding site AChEIs with metal-chelating potency. ► They are potential leads for disease-modifying treatment of Alzheimer's disease.

  18. Novel bis-(−)-nor-meptazinol derivatives act as dual binding site AChE inhibitors with metal-complexing property

    International Nuclear Information System (INIS)

    Zheng, Wei; Li, Juan; Qiu, Zhuibai; Xia, Zheng; Li, Wei; Yu, Lining; Chen, Hailin; Chen, Jianxing; Chen, Yan; Hu, Zhuqin; Zhou, Wei; Shao, Biyun; Cui, Yongyao; Xie, Qiong; Chen, Hongzhuan

    2012-01-01

    The strategy of dual binding site acetylcholinesterase (AChE) inhibition along with metal chelation may represent a promising direction for multi-targeted interventions in the pathophysiological processes of Alzheimer's disease (AD). In the present study, two derivatives (ZLA and ZLB) of a potent dual binding site AChE inhibitor bis-(−)-nor-meptazinol (bis-MEP) were designed and synthesized by introducing metal chelating pharmacophores into the middle chain of bis-MEP. They could inhibit human AChE activity with IC 50 values of 9.63 μM (for ZLA) and 8.64 μM (for ZLB), and prevent AChE-induced amyloid-β (Aβ) aggregation with IC 50 values of 49.1 μM (for ZLA) and 55.3 μM (for ZLB). In parallel, molecular docking analysis showed that they are capable of interacting with both the catalytic and peripheral anionic sites of AChE. Furthermore, they exhibited abilities to complex metal ions such as Cu(II) and Zn(II), and inhibit Aβ aggregation triggered by these metals. Collectively, these results suggest that ZLA and ZLB may act as dual binding site AChEIs with metal-chelating potency, and may be potential leads of value for further study on disease-modifying treatment of AD. -- Highlights: ► Two novel bis-(−)-nor-meptazinol derivatives are designed and synthesized. ► ZLA and ZLB may act as dual binding site AChEIs with metal-chelating potency. ► They are potential leads for disease-modifying treatment of Alzheimer's disease.

  19. The influence of vitamin E supplementation on the oxidative status of rat liver

    Directory of Open Access Journals (Sweden)

    Đurašević S.F.

    2010-01-01

    Full Text Available We tested to see if the additional intake of vitamin E in the form of α-tocopheryl-succinate would improve liver antioxidative protection. Thus, we studied the tissue oxidative status in rats supplemented by two doses of the antioxidant over a four week period of time. Our results confirmed that the additional intake of vitamin E decreased the liver lipid peroxidation level and SOD activity level and preserved its vitamin C content. However, the hydrogen peroxide content and catalase activity remained unchanged, probably due to the mechanism of vitamin E liver metabolism. .

  20. What Can Influence Iranian Suicide Attempters to Go Through the Process of Non-Fatal Suicide Act Once Again? A Preliminary Report.

    Science.gov (United States)

    Toudehskchuie, Gholam Reza Ghassemi; Fereidoon, Mahsa

    2016-07-01

    The thrust of this study was to examine some of the psycho-social risk factors for the recurrence of non-fatal suicide attempt in a sample of 1121 inmates admitted between April 2012 to June 2013 at the toxicology emergency ward, Noor Medical Centre, Isfahan, Iran. Out of the total participants, 240 of them reported history of suicide attempt and assumed the status of case group. The remaining 881 patients were admitted first their attempt and constituted the control group. Cases were compared to the controls with respect to select demographic features (i.e. age, sex, education, occupation, marital status, type of residence, and locale), current suicide attempt method, family history of suicide and drug abuse, history of psychiatric disorder, physical ailment and physical disability, substance abuse and alcohol use, psychiatric diagnosis, and recent life hassles (i.e. interpersonal, occupational, financial, medical, and home affairs). We used a structured interview schedule to interview the participants. Psychiatric diagnosis was based on the DSM-IV criteria. Data were computer analyzed using SPSS.21 and administering statistical analysis including Chi Square, t-student, and logistic regression. Demographic risk factors for recurrence of suicide attempts at the univariate level included occupational status [Crud odds Ratio (COR) = 0.53] and type of residence (COR = 1.40). Medical and psychiatric risk factors at the univariate level included substance abuse (COR = 1.97), physical ailment (COR = 1.76), alcohol use (COR = 1.84), psychiatric disorder (COR = 3.69), and history of suicide in the family of origin (COR = 1.86). Recent life hassles risk factors at the univariate level included financial constraints (COR = 1.46) and medical emergencies (COR = 3.48). A multivariate logistic regression model identified five variables (i.e. substance abuse, alcohol use, psychiatric illness, suicide in family, and medical emergencies) that were statistically

  1. Assessment of CD4+ T cell responses to glutamic acid decarboxylase 65 using DQ8 tetramers reveals a pathogenic role of GAD65 121-140 and GAD65 250-266 in T1D development.

    Directory of Open Access Journals (Sweden)

    I-Ting Chow

    Full Text Available Susceptibility to type 1 diabetes (T1D is strongly associated with MHC class II molecules, particularly HLA-DQ8 (DQ8: DQA1*03:01/DQB1*03:02. Monitoring T1D-specific T cell responses to DQ8-restricted epitopes may be key to understanding the immunopathology of the disease. In this study, we examined DQ8-restricted T cell responses to glutamic acid decarboxylase 65 (GAD65 using DQ8 tetramers. We demonstrated that GAD65 121-140 and GAD65 250-266 elicited responses from DQ8+ subjects. Circulating CD4+ T cells specific for these epitopes were detected significantly more often in T1D patients than in healthy individuals after in vitro expansion. T cell clones specific for GAD65 121-140 and GAD65 250-266 carried a Th1-dominant phenotype, with some of the GAD65 121-140-specific T cell clones producing IL-17. GAD65 250-266-specific CD4+ T cells could also be detected by direct ex vivo staining. Analysis of unmanipulated peripheral blood mononuclear cells (PBMCs revealed that GAD65 250-266-specific T cells could be found in both healthy and diabetic individuals but the frequencies of specific T cells were higher in subjects with type 1 diabetes. Taken together, our results suggest a proinflammatory role for T cells specific for DQ8-restricted GAD65 121-140 and GAD65 250-266 epitopes and implicate their possible contribution to the progression of T1D.

  2. Weldability and Strength Recovery of NUCu-140 Advanced Naval Steel

    Science.gov (United States)

    Bono, Jason T.

    NUCu-140 is a ferritic copper-precipitation strengthened steel that is a candidate material for use in many naval and structural applications. Previous work has shown that the heat-affected zone (HAZ) and fusion zone (FZ) of NUCu-140 exhibit softening that is due to dissolution of the copper-rich precipitates. This study aims to recover the FZ and HAZ strength by re-precipitation of the copper-rich precipitates through either multiple weld passes or an isothermal post-weld heat treatment (PWHT). The potential use of multiple thermal cycles was investigated with HAZ simulations using a Gleeble thermomechanical simulator. The HAZ simulations represented two weld thermal cycles with different combinations of peak temperatures during the initial and secondary weld passes. To investigate the potential for a PWHT for strength recovery, gas tungsten arc weld (GTAW) samples were isothermally heated for various times and temperatures. Microhardness measurements revealed no strength recovery in the multipass HAZ samples. The time dependent precipitate characteristics were modeled under the HAZ thermal cycle conditions, and the results showed that the lack of strength recovery could be attributed to insufficient time for re-precipitation during the secondary weld pass. Conversely, full strength recovery in the HAZ was observed in the isothermally heat treated samples. Atom-probe tomography (APT) analysis correlated this strength recovery to re-precipitation of the copper-rich precipitates during the isothermal PWHT. The experimental naval steel known as NUCu-140 and an established naval steel HSLA-100 were subjected to stress-relief cracking (SRC) and hot-ductility testing to assess their relative cracking susceptibilities during the welding process and post weld heat treatment. NUCu-140 exhibited a longer time-to-failure (TTF) and a lower temperature of minimum TTF during SRC testing when compared to HSLA-100, indicating better resistance to SRC for the NUCu-140 steel. The

  3. The prostaglandin EP1 receptor potentiates kainate receptor activation via a protein kinase C pathway and exacerbates status epilepticus

    Science.gov (United States)

    Rojas, Asheebo; Gueorguieva, Paoula; Lelutiu, Nadia; Quan, Yi; Shaw, Renee; Dingledine, Raymond

    2014-01-01

    Prostaglandin E2 (PGE2) regulates membrane excitability, synaptic transmission, plasticity, and neuronal survival. The consequences of PGE2 release following seizures has been the subject of much study. Here we demonstrate that the prostaglandin E2 receptor 1 (EP1, or Ptger1) modulates native kainate receptors, a family of ionotropic glutamate receptors widely expressed throughout the central nervous system. Global ablation of the EP1 gene in mice (EP1-KO) had no effect on seizure threshold after kainate injection but reduced the likelihood to enter status epilepticus. EP1-KO mice that did experience typical status epilepticus had reduced hippocampal neurodegeneration and a blunted inflammatory response. Further studies with native prostanoid and kainate receptors in cultured cortical neurons, as well as with recombinant prostanoid and kainate receptors expressed in Xenopus oocytes, demonstrated that EP1 receptor activation potentiates heteromeric but not homomeric kainate receptors via a second messenger cascade involving phospholipase C, calcium and protein kinase C. Three critical GluK5 C-terminal serines underlie the potentiation of the GluK2/GluK5 receptor by EP1 activation. Taken together, these results indicate that EP1 receptor activation during seizures, through a protein kinase C pathway, increases the probability of kainic acid induced status epilepticus, and independently promotes hippocampal neurodegeneration and a broad inflammatory response. PMID:24952362

  4. Retrovirally transduced NCAM140 facilitates neuronal fate choice of hippocampal progenitor cells.

    Science.gov (United States)

    Kim, Ju Hee; Lee, Jung-Ha; Park, Jin-Yong; Park, Chang-Hwan; Yun, Chae-Ok; Lee, Sang-Hun; Lee, Yong-Sung; Son, Hyeon

    2005-07-01

    Neural cell adhesion molecule (NCAM) influences proliferation and differentiation of neuronal cells. However, only a little is known about the downstream effects of NCAM signalling, such as alterations in gene transcription, which are associated with cell fate choice. To examine whether NCAM plays a role in cell fate choice during hippocampal neurogenesis, we performed a gain-of-function study, using a retroviral vector which contained full-length NCAM140 cDNA and the marker gene EGFP, and found that NCAM140 promoted neurogenesis by activating proneural transcription activators with concurrent inhibition of gliogenesis. The enhanced transcript levels of proneural transcription factors in NCAM140-transduced cells were down-regulated by treatment of the cells with mitogen-activated protein kinase kinase (MEK) inhibitor PD098059. Overall, these findings suggest that NCAM140 may facilitate hippocampal neurogenesis via regulation of proneurogenic transcription factors in an extracellular signal-regulated kinase (ERK)-dependent manner.

  5. 40 CFR 415.140 - Applicability; description of the sodium bicarbonate production subcategory.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Applicability; description of the sodium bicarbonate production subcategory. 415.140 Section 415.140 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS INORGANIC CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Sodium Bicarbonate...

  6. E2F5 status significantly improves malignancy diagnosis of epithelial ovarian cancer

    KAUST Repository

    Kothandaraman, Narasimhan

    2010-02-24

    Background: Ovarian epithelial cancer (OEC) usually presents in the later stages of the disease. Factors, especially those associated with cell-cycle genes, affecting the genesis and tumour progression for ovarian cancer are largely unknown. We hypothesized that over-expressed transcription factors (TFs), as well as those that are driving the expression of the OEC over-expressed genes, could be the key for OEC genesis and potentially useful tissue and serum markers for malignancy associated with OEC.Methods: Using a combination of computational (selection of candidate TF markers and malignancy prediction) and experimental approaches (tissue microarray and western blotting on patient samples) we identified and evaluated E2F5 transcription factor involved in cell proliferation, as a promising candidate regulatory target in early stage disease. Our hypothesis was supported by our tissue array experiments that showed E2F5 expression only in OEC samples but not in normal and benign tissues, and by significantly positively biased expression in serum samples done using western blotting studies.Results: Analysis of clinical cases shows that of the E2F5 status is characteristic for a different population group than one covered by CA125, a conventional OEC biomarker. E2F5 used in different combinations with CA125 for distinguishing malignant cyst from benign cyst shows that the presence of CA125 or E2F5 increases sensitivity of OEC detection to 97.9% (an increase from 87.5% if only CA125 is used) and, more importantly, the presence of both CA125 and E2F5 increases specificity of OEC to 72.5% (an increase from 55% if only CA125 is used). This significantly improved accuracy suggests possibility of an improved diagnostics of OEC. Furthermore, detection of malignancy status in 86 cases (38 benign, 48 early and late OEC) shows that the use of E2F5 status in combination with other clinical characteristics allows for an improved detection of malignant cases with sensitivity

  7. Liquid density of biofuel mixtures: (Dibutyl ether + 1-butanol) system at pressures up to 140 MPa and temperatures from (293.15 to 393.15) K

    International Nuclear Information System (INIS)

    Alaoui, Fatima E.M.; Montero, Eduardo A.; Bazile, Jean-Patrick; Aguilar, Fernando; Boned, Christian

    2011-01-01

    Highlights: → New density data for binary mixtures of (dibutyl ether + 1-butanol) are reported. → The pressure and temperature intervals are 0.1 to 140 MPa and 293.15 to 393.15 K. → 445 Data points measured at five compositions were fitted to a Tait-like equation. → Excess volumes have been calculated from the experimental data. → The isobaric expansivity and the isothermal compressibility have been derived. - Abstract: This work reports new experimental density data (445 points) for binary mixtures of (dibutyl ether + 1-butanol) over the composition range (five compositions; 0.15 ≤ dibutyl ether mole fraction x ≤ 0.85), from (293.15 to 393.15) K (every 20 K), and for 15 pressures from (0.1 to 140) MPa (every 10 MPa). An Anton Paar vibrating tube densimeter, calibrated with an uncertainty of ±0.5 kg . m -3 was used to perform these measurements. The experimental density data were fitted with a Tait-like equation with low standard deviations. Excess volumes have been calculated from the experimental data and fitted by the Redlich-Kister equation. In addition, the isobaric thermal expansivity and the isothermal compressibility have been derived from the Tait-like equation.

  8. Cardiorespiratory fitness and academic performance association is mediated by weight status in adolescents: DADOS study.

    Science.gov (United States)

    Beltran-Valls, María Reyes; Adelantado-Renau, Mireia; Castro-Piñero, Jose; Sánchez-López, Mairena; Moliner-Urdiales, Diego

    2018-04-28

    The aim of our study was to examine the mediation effect of weight status on the association between cardiorespiratory fitness (CRF) and academic performance (AP). Two hundred sixty-nine adolescents (140 boys) aged 13.9 ± 0.3 years old from the DADOS study were included in this cross-sectional analysis. CRF was assessed by the 20-m shuttle run test and estimated maximum oxygen uptake was used in the analysis. AP was assessed through the final academic grades and the Science Research Associates Test of Educational Abilities for assessing reasoning, verbal, and numeric abilities. Weight status was assessed by body mass index (kg/m 2 ). Boot-strapped mediation procedures were performed and indirect effects (IE) with confidence intervals (CI) not including zero were considered statistically significant. Mediation analysis revealed that weight status acted as a mediator of the relationship of CRF with reasoning ability (IE = 0.039; CI = 0.001; 0.091) and the final grades in Math (IE = 0.011; CI = 0.002; 0.025), Language (IE = 0.013; CI = 0.004; 0.027), and GPA (IE = 0.011; CI = 0.003; 0.023). Our data show that the influence of CRF on academic performance is mediated by weight status in adolescents. We suggest that our data could be considered by educators, families, and policy makers, so that active lifestyles might be promoted when designing programs aimed to improve AP among adolescents. What is Known: • Academic performance is associated with both, cardiorespiratory fitness and weight status. • The role of weight status in the association between cardiorespiratory fitness and academic performance is poorly understood. What is New: • We support the scarce research investigating the mediating role of weight status as mechanism in the association between fitness and academic performance in youth. • Previous knowledge is expanded by suggesting that cardiorespiratory fitness is related to weight status which in turn may

  9. Status of the flora and fauna on the Nevada Test Site, 1992. Results of continuing basic environmental monitoring, January through December 1992

    Energy Technology Data Exchange (ETDEWEB)

    Hunter, R.B. [comp.

    1994-03-01

    This report documents changes in the populations of plants and animals on the Nevada Test Site (NTS) for calendar year 1992. It is part of a Department of Energy (DOE) program (Basic Environmental Compliance and Monitoring Program -- BECAMP) that also includes monitoring DOE compliance with the Endangered Species Act, the Historic Preservation Act, and the American Indian Freedom of Religion Act. Ecological studies were to comply with the National Environmental Policy Act and DOE Order 5400.1, ``General Environmental Protection Program.`` These studies focused on the following: status of ephemeral plants on the Nevada Test Site, 1992; status of reptile and amphibian populations on the Nevada Test Site, 1992; trends in small mammal populations on the Nevada Test Site, 1992; status of large mammals and birds at Nevada Test Site, 1992; and status of perennial plants on the Nevada Test Site, 1992.

  10. 7 CFR 1955.140 - Sale in parcels.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property General § 1955.140 Sale in parcels... projects. When farm inventory property is larger than a family-size farm, the county official will...

  11. A trial of e-simulation of sudden patient deterioration (FIRST2ACT WEB) on student learning.

    Science.gov (United States)

    Bogossian, Fiona E; Cooper, Simon J; Cant, Robyn; Porter, Joanne; Forbes, Helen

    2015-10-01

    High-fidelity simulation pedagogy is of increasing importance in health professional education; however, face-to-face simulation programs are resource intensive and impractical to implement across large numbers of students. To investigate undergraduate nursing students' theoretical and applied learning in response to the e-simulation program-FIRST2ACT WEBTM, and explore predictors of virtual clinical performance. Multi-center trial of FIRST2ACT WEBTM accessible to students in five Australian universities and colleges, across 8 campuses. A population of 489 final-year nursing students in programs of study leading to license to practice. Participants proceeded through three phases: (i) pre-simulation-briefing and assessment of clinical knowledge and experience; (ii) e-simulation-three interactive e-simulation clinical scenarios which included video recordings of patients with deteriorating conditions, interactive clinical tasks, pop up responses to tasks, and timed performance; and (iii) post-simulation feedback and evaluation. Descriptive statistics were followed by bivariate analysis to detect any associations, which were further tested using standard regression analysis. Of 409 students who commenced the program (83% response rate), 367 undergraduate nursing students completed the web-based program in its entirety, yielding a completion rate of 89.7%; 38.1% of students achieved passing clinical performance across three scenarios, and the proportion achieving passing clinical knowledge increased from 78.15% pre-simulation to 91.6% post-simulation. Knowledge was the main independent predictor of clinical performance in responding to a virtual deteriorating patient R(2)=0.090, F(7, 352)=4.962, plearning. The web-based e-simulation program FIRST2ACTTM effectively enhanced knowledge, virtual clinical performance, and self-assessed knowledge, skills, confidence, and competence in final-year nursing students. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Anomalous behavior of the magnetic hyperfine field at 140Ce impurities at La sites in LaMnSi2

    Science.gov (United States)

    Domienikan, C.; Bosch-Santos, B.; Cabrera-Pasca, G. A.; Saxena, R. N.; Carbonari, A. W.

    2018-05-01

    Magnetic hyperfine field has been measured in the orthorhombic intermetallic compound LaMnSi2 with perturbed angular correlation (PAC) spectroscopy using radioactive 140La(140Ce) nuclear probes. Magnetization measurements were also carried out in this compound with MPSM-SQUID magnetometer. Samples of LaMnSi2 compound were prepared by arc melting the component metals with high purity under argon atmosphere followed by annealing at 1000°C for 60 h under helium atmosphere and quenching in water. X-ray analysis confirmed the samples to be in a single phase with correct crystal structure expected for LaMnSi2 compound. The radioactive 140La (T1/2 = 40 h) nuclei were produced by direct irradiation of the sample with neutrons in the IEA-R1 nuclear research reactor at IPEN with a flux of ˜ 1013 n cm-2s-1 for about 3 - 4 min. The PAC measurements were carried out with a six BaF2 detector spectrometer at several temperatures between 10 K and 400 K. Temperature dependence of the hyperfine field, Bhf was found to be anomalous. A modified two-state model explained this anomalous behavior where the effective magnetic hyperfine field at 140Ce is believed to have two contributions, one from the unstable localized spins at Ce impurities and another from the magnetic Mn atoms of the host. The competition of these two contributions explains the anomalous behavior observed for the temperature dependence of the magnetic hyperfine field at 140Ce. The ferromagnetic transition temperature (TC) of LaMnSi2 was determined to be 400(1) K confirming the magnetic measurements.

  13. Association analysis of anti-Epstein-Barr nuclear antigen-1 antibodies, anti-cyclic citrullinated peptide antibodies, the shared epitope and smoking status in Brazilian patients with rheumatoid arthritis

    Directory of Open Access Journals (Sweden)

    Michel Alexandre Yazbek

    2011-01-01

    Full Text Available INTRODUCTION: Epstein-Barr virus exposure appears to be an environmental trigger for rheumatoid arthritis that interacts with other risk factors. Relationships among anti-cyclic citrullinated peptide antibodies, the shared epitope, and smoking status have been observed in patients with rheumatoid arthritis from different populations. OBJECTIVE: To perform an association analysis of anti-Epstein-Barr nuclear antigen-1 antibodies, anti-cyclic citrullinated peptide antibodies, the shared epitope, and smoking status in Brazilian patients with rheumatoid arthritis. METHODS: In a case-control study, 140 rheumatoid arthritis patients and 143 healthy volunteers who were matched for age, sex, and ethnicity were recruited. Anti-Epstein-Barr nuclear antigen-1 antibodies and anti-cyclic citrullinated peptide antibodies were examined using an enzyme-linked immunosorbent assay, and shared epitope alleles were identified by genotyping. Smoking information was collected from all subjects. A comparative analysis of anti-Epstein-Barr nuclear antigen-1 antibodies, anti-cyclic citrullinated peptide antibodies, the shared epitope, and smoking status was performed in the patient group. Logistic regression analysis models were used to analyze the risk of rheumatoid arthritis. RESULTS: Anti-Epstein-Barr nuclear antigen-1 antibodies were not associated with anti-cyclic citrullinated peptide antibodies, shared epitope alleles, or smoking status. Anti-cyclic citrullinated peptide antibody positivity was significantly higher in smoking patients with shared epitope alleles (OR = 3.82. In a multivariate logistic regression analysis using stepwise selection, only anti-cyclic citrullinated peptide antibodies were found to be independently associated with rheumatoid arthritis (OR = 247.9. CONCLUSION: Anti-Epstein-Barr nuclear antigen-1 antibodies did not increase the risk of rheumatoid arthritis and were not associated with the rheumatoid arthritis risk factors studied. Smoking

  14. Penconazole alters redox status, cholinergic function and lung's histoarchitecture of adult rats: Reversal effect of vitamin E.

    Science.gov (United States)

    Chaâbane, Mariem; Elwej, Awatef; Ghorbel, Imen; Chelly, Sabrine; Mnif, Hela; Boudawara, Tahia; Ellouze Chaabouni, Semia; Zeghal, Najiba; Soudani, Nejla

    2018-06-01

    The present study pertains to the possible adverse effects of penconazole exposure on the lung of adult rats, and to the potential ability of vitamin E (Vit E) in mitigating the toxicity induced by this fungicide. Male Wistar rats were divided into four groups of six animals each: Group I (Controls): rats drank distilled water; Group II (PEN): rats received, by gavage, 50 mg/kg body weight (1/40 LD 50 ) of penconazole every 2 days during 10 days; Group III (Vit E): rats received daily 100 mg α-tocopherol acetate/kg body weight during 10 days by gavage; and Group IV (Vit E + PEN): rats received both vitamin E (100 mg α-tocopherol acetate/kg body weight) and penconazole (50 mg/kg body weight), being vitamin E given as a daily dosage and penconazole every 2 days, by gavage during 10 days. Results showed that penconazole induced oxidative stress in the lung demonstrated by an increase in malondialdehyde (+77%), hydrogen peroxide (+58%) and advanced oxidation protein product (+22%) levels, as compared to the controls. Furthermore, a decrease in the activities of catalase (-41%), superoxide dismutase (-45%), glutathione peroxidase (-23%) and acetylcholinesterase (-67%), and an increase in the levels of non-protein thiols (+17%), glutathione (+7%) and vitamin C (+44%) were registered. Abnormalities in lung histological sections such as alveolar edema, infiltration of inflammatory cells (leukocytes) and emphysema, were also observed following penconazole exposure. Vitamin E ameliorated the biochemical parameters, as well as the histological impairments induced by this fungicide. In conclusion, our study demonstrated that vitamin E, a natural antioxidant, was effective in alleviating penconazole-induced lung damage in Wistar rats. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  15. K2-140b - an eccentric 6.57 d transiting hot Jupiter in Virgo

    Science.gov (United States)

    Giles, H. A. C.; Bayliss, D.; Espinoza, N.; Brahm, R.; Blanco-Cuaresma, S.; Shporer, A.; Armstrong, D.; Lovis, C.; Udry, S.; Bouchy, F.; Marmier, M.; Jordán, A.; Bento, J.; Cameron, A. Collier; Sefako, R.; Cochran, W. D.; Rojas, F.; Rabus, M.; Jenkins, J. S.; Jones, M.; Pantoja, B.; Soto, M.; Jensen-Clem, R.; Duev, D. A.; Salama, M.; Riddle, R.; Baranec, C.; Law, N. M.

    2018-04-01

    We present the discovery of K2-140b, a P = 6.57 d Jupiter-mass (MP = 1.019 ± 0.070MJup) planet transiting a V = 12.5 (G5-spectral type) star in an eccentric orbit (e = 0.120^{+0.056}_{-0.046}) detected using a combination of K2 photometry and ground-based observations. With a radius of 1.095 ± 0.018 RJup, the planet has a bulk density of 0.726 ± 0.062 ρJup. The host star has a [Fe/H] of 0.12 ± 0.045, and from the K2 light curve, we find a rotation period for the star of 16.3 ± 0.1 d. This discovery is the 9th hot Jupiter from K2 and highlights K2's ability to detect transiting giant planets at periods slightly longer than traditional, ground-based surveys. This planet is slightly inflated, but much less than others with similar incident fluxes. These are of interest for investigating the inflation mechanism of hot Jupiters.

  16. 26 CFR 1.856-0 - Revenue Act of 1978 amendments not included.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Revenue Act of 1978 amendments not included. 1.856-0 Section 1.856-0 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.856-0 Revenue Act of 1978...

  17. Changes in nuclear receptor corepressor RIP140 do not influence mitochondrial content in the cortex.

    Science.gov (United States)

    Herbst, Eric A F; Bonen, Arend; Holloway, Graham P

    2015-10-01

    Changes in nuclear receptor interacting protein 140 (RIP140) influences mitochondrial content in skeletal muscle; however, the translation of these findings to the brain has not been investigated. The present study examined the impact of overexpressing and ablating RIP140 on mitochondrial content in muscle and the cortex through examining mRNA, mtDNA, and mitochondrial protein content. Our results show that changes in RIP140 expression significantly alters markers of mitochondrial content in skeletal muscle but not the brain.

  18. Comparison of 120- and 140-μm SMILE Cap Thickness Results in Eyes With Thick Corneas.

    Science.gov (United States)

    Liu, Manli; Zhou, Yugui; Wu, Xianghua; Ye, Tiantian; Liu, Quan

    2016-10-01

    To evaluate clinical outcomes after small incision lenticule extraction (SMILE) with different cap thicknesses in thick corneas. Forty patients with central corneal thickness of more than 560 μm were recruited in this prospective, randomized, masked, paired-eye study. Patients were randomized to receive SMILE with a 120-μm cap thickness in 1 eye and 140-μm cap thickness in the other. Uncorrected and corrected distance visual acuity (CDVA), contrast sensitivity (CS), higher-order aberrations (HOAs), and morphologic modifications of corneal architecture were measured during the 3-month follow-up period. Postoperative refractive outcomes, visual outcomes, CS, and the changes in HOAs were similar between both groups. The persistence of brightly reflective particles in the corneal interface layer was 1388.6 ± 219.5/mm in eyes with 120-μm cap thickness and 54.7 ± 8.6/mm in eyes with 140-μm cap thickness (P line at the interface layer almost disappeared in all eyes with 140-μm cap thickness, and it still persisted in 43% of the fellow eyes at 3 months postoperatively. The anterior surfaces of lenticules in the 140-μm cap thickness group exhibited more smoothness than in the 120-μm cap thickness group. There was a lower level corneal wound-healing response after SMILE with a 140-μm cap thickness than with a 120-μm cap thickness, although the thickness of cap creation did not affect visual outcomes by 3 months postoperatively.

  19. Immunoglobulin G1 Allotype Influences Antibody Subclass Distribution in Response to HIV gp140 Vaccination

    Directory of Open Access Journals (Sweden)

    Sven Kratochvil

    2017-12-01

    Full Text Available Antibody subclasses exhibit extensive polymorphisms (allotypes that could potentially impact the quality of HIV-vaccine induced B cell responses. Allotypes of immunoglobulin (Ig G1, the most abundant serum antibody, have been shown to display altered functional properties in regard to serum half-life, Fc-receptor binding and FcRn-mediated mucosal transcytosis. To investigate the potential link between allotypic IgG1-variants and vaccine-generated humoral responses in a cohort of 14 HIV vaccine recipients, we developed a novel protocol for rapid IgG1-allotyping. We combined PCR and ELISA assays in a dual approach to determine the IgG1 allotype identity (G1m3 and/or G1m1 of trial participants, using human plasma and RNA isolated from PBMC. The IgG1-allotype distribution of our participants mirrored previously reported results for caucasoid populations. We observed elevated levels of HIV gp140-specific IgG1 and decreased IgG2 levels associated with the G1m1-allele, in contrast to G1m3 carriers. These data suggest that vaccinees homozygous for G1m1 are predisposed to develop elevated Ag-specific IgG1:IgG2 ratios compared to G1m3-carriers. This elevated IgG1:IgG2 ratio was further associated with higher FcγR-dimer engagement, a surrogate for potential antibody-dependent cellular cytotoxicity (ADCC and antibody-dependent cellular phagocytosis (ADCP function. Although preliminary, these results suggest that IgG1 allotype may have a significant impact on IgG subclass distribution in response to vaccination and associated Fc-mediated effector functions. These results have important implications for ongoing HIV vaccine efficacy studies predicated on engagement of FcγR-mediated cellular functions including ADCC and ADCP, and warrant further investigation. Our novel allotyping protocol provides new tools to determine the potential impact of IgG1 allotypes on vaccine efficacy.

  20. The structure of low-lying states in ${}^{140}$Sm studied by Coulomb excitation

    CERN Document Server

    Klintefjord, M.; Görgen, A.; Bauer, C.; Bello Garrote, F.L.; Bönig, S.; Bounthong, B.; Damyanova, A.; Delaroche, J.P.; Fedosseev, V.; Fink, D.A.; Giacoppo, F.; Girod, M.; Hoff, P.; Imai, N.; Korten, W.; Larsen, A.C.; Libert, J.; Lutter, R.; Marsh, B.A.; Molkanov, P.L.; Naïdja, H.; Napiorkowski, P.; Nowacki, F.; Pakarinen, J.; Rapisarda, E.; Reiter, P.; Renstrøm, T.; Rothe, S.; Seliverstov, M.D.; Siebeck, B.; Siem, S.; Srebrny, J.; Stora, T.; Thöle, P.; Tornyi, T.G.; Tveten, G.M.; Van Duppen, P.; Vermeulen, M.J.; Voulot, D.; Warr, N.; Wenander, F.; De Witte, H.; Zielińska, M.

    2016-05-02

    The electromagnetic structure of $^{140}$Sm was studied in a low-energy Coulomb excitation experiment with a radioactive ion beam from the REX-ISOLDE facility at CERN. The $2^+$ and $4^+$ states of the ground-state band and a second $2^+$ state were populated by multi-step excitation. The analysis of the differential Coulomb excitation cross sections yielded reduced transition probabilities between all observed states and the spectroscopic quadrupole moment for the $2_1^+$ state. The experimental results are compared to large-scale shell model calculations and beyond-mean-field calculations based on the Gogny D1S interaction with a five-dimensional collective Hamiltonian formalism. Simpler geometric and algebraic models are also employed to interpret the experimental data. The results indicate that $^{140}$Sm shows considerable $\\gamma$ softness, but in contrast to earlier speculation no signs of shape coexistence at low excitation energy. This work sheds more light on the onset of deformation and collectivit...

  1. Aptidão física, idade e estado nutricional em militares Aptitud física, edad y estado nutricional en militares Physical fitness, age and nutritional status of military personnel

    Directory of Open Access Journals (Sweden)

    Clarissa Stefani Teixeira

    2010-04-01

    of this decrease due to the aging process and the nutritional status in adult male individuals is not well-known, especially in the Brazilian population. OBJECTIVE: To analyze the levels of physical fitness according to age and the nutritional status in adult male individuals. METHODS: Aerobic and muscular endurance tests as well as flexibility tests and nutritional status assessment were carried out in 1,011 male individuals. Analyses of correlation, covariance and prevalence ratio were performed through Poisson regression. RESULTS: The individuals presented a moderate performance at the physical fitness tests. A decrease in the levels of physical performance according to the aging process was verified, considering all age ranges analyzed. The analysis of covariance corrected by age showed differences (p<0.001 for all tests comparing normal individuals and those with overweight/obesity. The prevalence ratios showed a strong trend toward the decrease in the physical fitness from 18 to 54 years. Individuals aged 41 to 54 years presented prevalences of low VO2max index that were 3.22-fold higher when compared to those aged 18 to 20 and 1.40-fold higher when compared to individuals aged 21 to 25 years. There was a decrease in the VO2max scores in the 18 to 20 age range, when compared to the 41 to 54 age range, of 11.45% in the normal group and 20.91% in the group with overweight and obesity. CONCLUSION: Age and the nutritional status have a strong influence on the decreased physical performance scores, mainly after 30 years of age.

  2. 24 CFR 146.1 - Purpose of the Age Discrimination Act of 1975.

    Science.gov (United States)

    2010-04-01

    ... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General § 146.1 Purpose of the Age Discrimination Act of... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Purpose of the Age Discrimination... programs or activities receiving Federal financial assistance. The Act, however, permits federally assisted...

  3. Exigência de valina e isoleucina para codornas de corte no período de um a 14 dias e de 15 a 35 dias de idade

    OpenAIRE

    Batista,E.; Furlan,A.C.; Marcato,S.M.; Pozza,P.C.; Ton,A.P.S.; Grieser,D.O.; Zancanela,V.; Stanquevis,C.E.; Perine,T.P.; Benites,M.I.; Euzébio,T.C.; Paula,V.R.C.

    2016-01-01

    RESUMO Foram conduzidos dois experimentos, com o objetivo de estimar a exigência de valina e isoleucina digestível para codornas de corte em crescimento. No experimento 1, foram utilizadas 2.160 codornas de corte de um dia de idade, não sexadas, distribuídas em um delineamento inteiramente ao acaso, com arranjo fatorial 4x4, sendo quatro níveis de valina digestível (0,90, 1,10, 1,30 e 1,50%) e quatro níveis de isoleucina digestível (0,80, 1,00, 1,20 e 1,40%), totalizando 16 tratamentos, com t...

  4. Human Rights Act, 12 February 1987.

    Science.gov (United States)

    1987-01-01

    This document reprints major provisions of the Yukon's (Canada) 1987 Human Rights Act. The Act furthers the public policy that every individual is free and equal in dignity and rights, seeks to discourage and eliminate discrimination, and promotes the underlying principles of Canadian and international human rights instruments. Part 1 contains a Bill of Rights that protects the right to freedom of: 1) religion and conscience, 2) expression, 3) assembly and association, and 4) to enjoyment and disposition of property. Part 2 prohibits discrimination based on ancestry (including color and race), national origin, ethnic or linguistic background or origin, age, sex (including pregnancy), and marital or family status. Discrimination is also prohibited when offering services, goods, or facilities to the public; in connection with employment; in connection with membership in trade unions or trade, occupational, or professional associations; and in negotiation or performance of public contracts. The Bill of Rights lists reasonable causes for discrimination as well as exemptions, including preferential treatment for organization or family members or employment in a private home. Special programs and affirmative action programs are specifically not considered discrimination under this Act. The Act sets forth rules for providing equal pay for work of equal value and creates a Yukon Human Rights Commission to promote human rights and assist adjudication of complaints.

  5. 20 CFR 402.140 - How a request for a record is processed.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false How a request for a record is processed. 402.140 Section 402.140 Employees' Benefits SOCIAL SECURITY ADMINISTRATION AVAILABILITY OF INFORMATION AND... engaged in disseminating information (such as a member of the news media), and there is an “urgency to...

  6. On the status of Ukrainian SSR before the beginning of perestroika

    Directory of Open Access Journals (Sweden)

    А. А. Омарова

    2014-12-01

    Full Text Available The article studies legal status of Ukrainian SSR before the beginning of Perestroika. Constitutional acts, laws and other regulatory acts are analyzed which fixed the status of Ukrainian SSR within USSR. On the basis of study of regulatory sources and monographs we came to conclusion that a contradiction existed between legally fixed and actual status of Ukrainian SSR within USSR before the beginning of Perestroika.

  7. Dicty_cDB: Contig-U11166-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9138 |pid:none) Streptomyces venezuelae methymycin... 140 1e-31 AM408590_2958( AM408590 |pid:none) Mycobacte...3( AF079138 |pid:none) Streptomyces venezuelae methymycin... 137 1e-30 AB070949_3( AB070949 |pid:none) Strep

  8. Performance Evaluation of the SPT-140

    Science.gov (United States)

    Manzella, David; Sarmiento, Charles; Sankovic, John; Haag, Tom

    1997-01-01

    As part of an on-going cooperative program with industry, an engineering model SPT-140 Hall thruster, which may be suitable for orbit insertion and station-keeping of geosynchronous communication satellites, was evaluated with respect to thrust and radiated electromagnetic interference at the NASA Lewis Research Center. Performance measurements were made using a laboratory model propellant feed system and commercial power supplies. The engine was operated in a space simulation chamber capable of providing background pressures of 4 x 10(exp -6) Torr or less during thruster operation. Thrust was measured at input powers ranging from 1.5 to 5 kilowatts with two different output filter configurations. The broadband electromagnetic emission spectra generated by the engine was also measured for a range of frequencies from 0.01 to 18,000 Mhz. These results are compared to the noise threshold of the measurement system and MIL-STD-461C where appropriate.

  9. The Act of 17 March 2000 on metrology and on changes and amendments of some acts

    International Nuclear Information System (INIS)

    2000-01-01

    This act metrology for organization of unity and correctness of mensuration adapts (a) the law measurement units, (b) the requests on committed gauges and their metrological control, (c) the conditions of official mensuration, (d) the requests on consumptive packages articles; (e) the conditions of authorization and registration, (f) operation of organs of the state administration for metrology, (g) the metrological authority (h) putting of fines. This act shall into effect on 1 July 2000

  10. A longitudinal study of risk perceptions and e-cigarette initiation among college students: Interactions with smoking status.

    Science.gov (United States)

    Cooper, Maria; Loukas, Alexandra; Case, Kathleen R; Marti, C Nathan; Perry, Cheryl L

    2018-05-01

    Recent data suggest that lower perceived risks of e-cigarettes are associated with e-cigarette use in young adults; however, the temporality of this relationship is not well-understood. We explore how perceptions of harmfulness and addictiveness of e-cigarettes influence e-cigarette initiation, and specifically whether this association varies by cigarette smoking status, in a longitudinal study of tobacco use on college campuses. Data are from a 5-wave 24-college study in Texas. Only students who reported never using e-cigarettes at wave 1 were included (n = 2565). Multilevel discrete-time hazard models, accounting for school clustering, were used. The dependent variable, ever e-cigarette use, was assessed at each wave. Both time-varying (e-cigarette perceptions of harmfulness and addictiveness, age, use of cigarettes, use of other tobacco products, and use of other substances) and time-invariant demographic covariates were included. Two-way interactions between each e-cigarette perception variable and current conventional cigarette use were tested to determine if the hypothesized relationship differed among smokers and non-smokers. 21% of all never e-cigarette users at baseline had initiated e-cigarette ever use by wave 5. Significant two-way interactions qualified the relationship between risk perceptions and e-cigarette initiation. Specifically, perceptions of a lower degree of harmfulness (OR = 1.13, p = .047) and addictiveness (OR = 1.34, p risk of e-cigarettes contributes to subsequent e-cigarette initiation among non-smokers, but not among current smokers. have implications for prevention campaigns focusing on the potential harm of e-cigarettes for non-smoking college students. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. How Social Status Shapes Person Perception and Evaluation: A Social Neuroscience Perspective.

    Science.gov (United States)

    Mattan, Bradley D; Kubota, Jennifer T; Cloutier, Jasmin

    2017-05-01

    Inferring the relative rank (i.e., status) of others is essential to navigating social hierarchies. A survey of the expanding social psychological and neuroscience literatures on status reveals a diversity of focuses (e.g., perceiver vs. agent), operationalizations (e.g., status as dominance vs. wealth), and methodologies (e.g., behavioral, neuroscientific). Accommodating this burgeoning literature on status in person perception, the present review offers a novel social neuroscientific framework that integrates existing work with theoretical clarity. This framework distinguishes between five key concepts: (1) strategic pathways to status acquisition for agents, (2) status antecedents (i.e., perceptual and knowledge-based cues that confer status rank), (3) status dimensions (i.e., domains in which an individual may be ranked, such as wealth), (4) status level (i.e., one's rank along a given dimension), and (5) the relative importance of a given status dimension, dependent on perceiver and context characteristics. Against the backdrop of this framework, we review multiple dimensions of status in the nonhuman and human primate literatures. We then review the behavioral and neuroscientific literatures on the consequences of perceived status for attention and evaluation. Finally, after proposing a social neuroscience framework, we highlight innovative directions for future social status research in social psychology and neuroscience.

  12. 23 CFR 140.908 - Materials and supplies.

    Science.gov (United States)

    2010-04-01

    ... Reimbursement for Railroad Work § 140.908 Materials and supplies. (a) Procurement. Materials and supplies, if... job, less a consideration for loss in service life at 10 percent for rails, angle bars, tie plates and... measures for restoration of affected areas as required by the physical construction or by reason of safety...

  13. 75 FR 53262 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2010-08-31

    ... a new Privacy Act system of records, JUSTICE/FBI- 021, the Data Integration and Visualization System... provisions of the Privacy Act in order to avoid interference with the national security and criminal law...)(G), (H) and (I); (e)(5) and (8); (f) and (g) of the Privacy Act: (1) Data Integration and...

  14. Marital Status and Outcomes in Patients With Cardiovascular Disease.

    Science.gov (United States)

    Schultz, William M; Hayek, Salim S; Samman Tahhan, Ayman; Ko, Yi-An; Sandesara, Pratik; Awad, Mosaab; Mohammed, Kareem H; Patel, Keyur; Yuan, Michael; Zheng, Shuai; Topel, Matthew L; Hartsfield, Joy; Bhimani, Ravila; Varghese, Tina; Kim, Jonathan H; Shaw, Leslee; Wilson, Peter; Vaccarino, Viola; Quyyumi, Arshed A

    2017-12-20

    Being unmarried is associated with decreased survival in the general population. Whether married, divorced, separated, widowed, or never-married status affects outcomes in patients with cardiovascular disease has not been well characterized. A prospective cohort (inception period 2003-2015) of 6051 patients (mean age 63 years, 64% male, 23% black) undergoing cardiac catheterization for suspected or confirmed coronary artery disease was followed for a median of 3.7 years (interquartile range: 1.7-6.7 years). Marital status was stratified as married (n=4088) versus unmarried (n=1963), which included those who were never married (n=451), divorced or separated (n=842), or widowed (n=670). The relationship between marital status and primary outcome of cardiovascular death and myocardial infarction was examined using Cox regression models adjusted for clinical characteristics. There were 1085 (18%) deaths from all causes, 688 (11%) cardiovascular-related deaths, and 272 (4.5%) incident myocardial infarction events. Compared with married participants, being unmarried was associated with higher risk of all-cause mortality (hazard ratio [HR]: 1.24; 95% confidence interval [CI], 1.06-1.47), cardiovascular death (HR: 1.45; 95% CI, 1.18-1.78), and cardiovascular death or myocardial infarction (HR: 1.52; 95% CI, 1.27-1.83). Compared with married participants, the increase in cardiovascular death or myocardial infarction was similar for the participants who were divorced or separated (HR: 1.41; 95% CI, 1.10-1.81), widowed (HR: 1.71; 95% CI, 1.32-2.20), or never married (HR: 1.40; 95% CI, 0.97-2.03). The findings persisted after adjustment for medications and other socioeconomic factors. Marital status is independently associated with cardiovascular outcomes in patients with or at high risk of cardiovascular disease, with higher mortality in the unmarried population. The mechanisms responsible for this increased risk require further study. © 2017 The Authors. Published on

  15. Cancer preventive services, socioeconomic status, and the Affordable Care Act.

    Science.gov (United States)

    Cooper, Gregory S; Kou, Tzuyung Doug; Dor, Avi; Koroukian, Siran M; Schluchter, Mark D

    2017-05-01

    Out-of-pocket expenditures are thought to be an important barrier to the receipt of cancer preventive services, especially for those of a lower socioeconomic status (SES). The Affordable Care Act (ACA) eliminated out-of-pocket expenditures for recommended services, including mammography and colonoscopy. The objective of this study was to determine changes in the uptake of mammography and colonoscopy among fee-for-service Medicare beneficiaries before and after ACA implementation. Using Medicare claims data, this study identified women who were 70 years old or older and had not undergone mammography in the previous 2 years and men and women who were 70 years old or older, were at increased risk for colorectal cancer, and had not undergone colonoscopy in the past 5 years. The receipt of procedures in the 2-year period before the ACA's implementation (2009-2010) and after its implementation (2011 to September 2012) was also identified. Multivariate generalized estimating equation models were used to determine the independent association and county-level quartile of median income and education with the receipt of testing. For mammography, a lower SES quartile was associated with less uptake, but the post-ACA disparities were smaller than those in the pre-ACA period. In addition, mammography rates increased from the pre-ACA period to the post-ACA period in all SES quartiles. For colonoscopy, in both the pre- and post-ACA periods, there was an association between uptake and educational level and, to some extent, income. However, there were no appreciable changes in colonoscopy and SES after implementation of the ACA. The removal of out-of-pocket expenditures may overcome a barrier to the receipt of recommended preventive services, but for colonoscopy, other procedural factors may remain as deterrents. Cancer 2017;123:1585-1589. © 2017 American Cancer Society. © 2017 American Cancer Society.

  16. 77 FR 49011 - Privacy Act of 1974; New System of Records, Office of General Counsel E-Discovery Management...

    Science.gov (United States)

    2012-08-15

    ... DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT [Docket No. FR-5613-N-06-A] Privacy Act of 1974; New System of Records, Office of General Counsel E-Discovery Management System--Change in Final Effective... the OGC E-Discovery Management System until after the opportunity for further comment is provided to...

  17. A briefing paper for the status of the flue gas desulfurization system at Indianapolis Power ampersand Light Company Petersburg Station Units 1 and 2

    International Nuclear Information System (INIS)

    Rutledge, C.K.; Wolsiffer, S.R.; Gray, S.M.; Martin, J.E.; Wedig, C.P.

    1992-01-01

    This paper presents a brief description of the status of the retrofit wet limestone flue gas desulfurization system project at Indianapolis Power ampersand Light Company (IPL) Petersburg Units 1 and 2. This project was initiated by IPL in response to the Clean Air Act of 1990 and is intended to treat the flue gas from two base load units with a combined capacity of approximately 700 MW gross electrical output

  18. Hormonal status and age differentially affect tolerance to the disruptive effects of delta-9-tetrahydrocannabinol (Δ9-THC on learning in female rats

    Directory of Open Access Journals (Sweden)

    Peter J Winsauer

    2015-07-01

    Full Text Available The effects of hormone status and age on the development of tolerance to D9-THC were assessed in sham-operated (intact or ovariectomized (OVX female rats that received either intraperitoneal saline or 5.6 mg/kg of D9-THC daily from postnatal day (PD 75 to 180 (early adulthood onward or PD 35 to 140 (adolescence onward. During this time, the 4 groups for each age (i.e., intact/saline, intact/THC, OVX/saline, and OVX/THC were trained in a learning and performance procedure and dose-effect curves were established for D9-THC (0.56-56 mg/kg and the cannabinoid type-1 receptor (CB1R antagonist rimonabant (0.32-10 mg/kg. Despite the persistence of small rate-decreasing and error-increasing effects in intact and OVX females from both ages during chronic D9-THC, all of the D9-THC groups developed tolerance. However, the magnitude of tolerance, as well as the effect of hormone status, varied with the age at which chronic D9-THC was initiated. There was no evidence of dependence in any of the groups. Hippocampal protein expression of CB1R, AHA1 (a co-chaperone of CB1R and HSP90β (a molecular chaperone modulated by AHA-1 was affected more by OVX than chronic D9-THC; striatal protein expression was not consistently affected by either manipulation. Hippocampal BDNF expression varied with age, hormone status, and chronic treatment. Thus, hormonal status differentially affects the development of tolerance to the disruptive effects of delta-9-tetrahydrocannabinol (D9-THC on learning and performance behavior in adolescent, but not adult, female rats. These factors and their interactions also differentially affect cannabinoid signaling proteins in the hippocampus and striatum, and ultimately, neural plasticity.

  19. Project Radiation protection East. Status Report, July 1997

    Energy Technology Data Exchange (ETDEWEB)

    Snihs, J.O.; Sundewall, H.; Grapengiesser, S. [STEGRA Consultants (Sweden); Bennerstedt, T. [TeknoTelje (Sweden)

    1997-12-01

    Project Radiation Protection East is a Swedish program for radiation protection work in Central and Eastern Europe. The projects are assessed, planned and performed in close cooperation with partner organizations in the East. Since 1994 radiation protection cooperation concerning the former Soviet Navy training reactors in Paldiski, Estonia, is included in the project. This report presents a summary over some 140 projects, their status, allocated funds and their distribution over countries and project areas. 12 tabs.

  20. Correlation of clinicopathological outcomes with changes in IHC4 status after NACT in locally advanced breast cancers: do pre-NACT ER/PR status act as better prognosticators?

    Directory of Open Access Journals (Sweden)

    Chatterjee S

    2015-12-01

    Full Text Available Sanjoy Chatterjee,1 Animesh Saha,1 Indu Arun,2 Sonali Susmita Nayak,2 Subir Sinha,3 Sanjit Agrawal,4 Mayur Parihar,5 Rosina Ahmed4 1Department of Radiation Oncology, 2Department of Pathology, 3Department of Medical Statistics, 4Department of Breast Surgery, 5Department of Molecular Pathology, Tata Medical Center, Kolkata, West Bengal, India Background: Following neoadjuvant chemotherapy (NACT for breast cancer, changes in estrogen receptor (ER, progesterone receptor (PR, HER2 status, and Ki-67 index (IHC4 status and its correlation with pathological complete response (pCR or relapse-free survival (RFS rates could lead to better understanding of tumor management. Patients and methods: Pre- and post-NACT IHC4 status and its changes were analyzed in 156 patients with breast cancer. Associations between pCR, RFS rates to IHC4 status pre- and post-NACT were investigated. Results: pCR was found in 25.3% patients. Both ER and PR positive tumors had the lowest (14.3% pCR compared to ER and PR negative (29% or either ER-/PR-positive (38.6% tumors. PR positivity was significantly associated with less likelihood of pCR (15% versus 34%. The pCR rate was low for luminal A subtype (13.68% compared to 24.36%, 26.31%, and 33.33% for luminal B, HER2-enriched, and triple-negative subtypes, respectively. There was significant reduction in ER expression and Ki-67 index post-NACT. RFS of patients in whom the hormonal status changed from positive to negative was better compared to those of patients in whom the hormonal status changed from negative to positive. Conclusion: Although changes in IHC4 occurred post-NACT, pre-NACT hazard ratio status prognosticated RFS better. pCR and RFS rates were lower in PR-positive tumors. Keywords: neoadjuvant chemotherapy, IHC4 status changes, survival 

  1. Ecclesia in Africa: Using Acts 1:8 as an Investigation of Intertextuality ...

    African Journals Online (AJOL)

    Intertextuality helps to illustrate the mutual enrichment each text brings to the other. Acts1:8 brings a new self-understanding and new identity to the Catholic Church in Africa. At the same time Acts 1:8 acquires a new significance when read in the context of the Church in Africa. African Journal of Cross-Cultural Psychology ...

  2. The E1 proteins

    International Nuclear Information System (INIS)

    Bergvall, Monika; Melendy, Thomas; Archambault, Jacques

    2013-01-01

    E1, an ATP-dependent DNA helicase, is the only enzyme encoded by papillomaviruses (PVs). It is essential for replication and amplification of the viral episome in the nucleus of infected cells. To do so, E1 assembles into a double-hexamer at the viral origin, unwinds DNA at the origin and ahead of the replication fork and interacts with cellular DNA replication factors. Biochemical and structural studies have revealed the assembly pathway of E1 at the origin and how the enzyme unwinds DNA using a spiral escalator mechanism. E1 is tightly regulated in vivo, in particular by post-translational modifications that restrict its accumulation in the nucleus. Here we review how different functional domains of E1 orchestrate viral DNA replication, with an emphasis on their interactions with substrate DNA, host DNA replication factors and modifying enzymes. These studies have made E1 one of the best characterized helicases and provided unique insights on how PVs usurp different host-cell machineries to replicate and amplify their genome in a tightly controlled manner. - Highlights: • The papillomavirus E1 helicase orchestrates replication of the viral DNA genome. • E1 assembles into a double-hexamer at the viral origin with the help of E2. • E1 interacts with cellular DNA replication factors. • E1 unwinds DNA using a spiral escalator mechanism. • Nuclear accumulation of E1 is regulated by post-translational modifications

  3. Experimental measurements and nuclear model calculations on the excitation functions of $^{nat}Ce(^{3}He, xn)$ and $^{141}$therapeutic radionuclide $^{140}$Nd

    CERN Document Server

    Hilgers, K; Coenen, H H; Qaim, S M

    2005-01-01

    For production of the therapy related Auger electron emitting neutron deficient nuclide /sup 140/Nd (T/sub fraction 1/2/=3.37d) two routes were investigated: the nuclear reaction range from 15 to 36 MeV and the reaction /sup 141/Pr(p,2n)/sup 140isotopes, namely /sup 139/Nd and /sup 141/Nd, as well as to cerium(IV)-oxide and praseodymium (III)-oxide were obtained by sedimentation and the conventional stacked-foil technique was used for cross section measurements. All the experimental data obtained in this work were compared with the results of theoretical calculations using the exciton model code ALICE-IPPE as well as with literature experimental data, if available. In general, good agreement between experimental and theoretical results was found. The theoretical thick target yields of all the product nuclides were calculated from the measured excitation functions. The theoretical thick target yield of amounts to 12 MBq/mu Acenterdoth and over the energy range E/sub p/=30rightward arrow15 Me V to 210 MBq/mu; A...

  4. Current Status of TRR-1/M1

    International Nuclear Information System (INIS)

    Sittichai, Chaiyut

    2000-01-01

    In 1961, the first Thai Research Reactor, TRR-1, having power of 1 MW was established. It was located at Office of Atomic Energy for Peace (OAEP) in Bangkok. TRR-1 was completely commissioned in June 1962. Plate typed high-enriched uranium (HEU) and U 3 O 8 -Al were used as fuel. Light water used as moderator and coolant. During 1975-1977, TRR-1 was shut down for modification. The reactor core and control system were disassembled and replaced by TRIGA Mark III. It is a circular hexagonal core typed reactor designed by General Atomics Company (GA). Afterwards, TRR-1 was officially renamed to Thai Research Reactor 1/Modification 1 (TRR-1/M1). TRR-1/M1 is a multipurpose reactor with nominal power of 2 MW. This swimming pool typed reactor uses low-enriched uranium (LEU) as fuel and light water as coolant and moderator. To date, the reactor has been operated with core No.12 that released power 1135 MWD to serve the user. The reactor has been serving for various kinds of utilization, for example, to produce radioisotope, neutron beam experiments and reactor physics experiments. This report explains in detail regarding operational experience and current status of this reactor, for example, reactor operation and reactor utilization. (author)

  5. 26 CFR 1.941-2 - Meaning of terms used in connection with China Trade Act corporations.

    Science.gov (United States)

    2010-04-01

    ... Trade Act corporations. 1.941-2 Section 1.941-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES China Trade Act Corporations § 1.941-2 Meaning of terms used in connection with China Trade Act corporations. (a) A China Trade Act corporation...

  6. The Nuclear Waste Policy Act, as amended, with appropriations acts appended. Revision 1

    International Nuclear Information System (INIS)

    1995-02-01

    This act provides for the development of repositories for the disposal of high-level radioactive wastes, low-level radioactive wastes, and spent nuclear fuels. In addition, it establishes research and development programs, as well as demonstration programs regarding the disposal of these wastes. This Act consists of the Act of Jan. 7, 1983 (Public Law 97-425; 96 Stat. 2201), as amended by Public Law 100-203 and Public Law 102-486

  7. Brain omega-3 polyunsaturated fatty acids modulate microglia cell number and morphology in response to intracerebroventricular amyloid-β 1-40 in mice.

    Science.gov (United States)

    Hopperton, Kathryn E; Trépanier, Marc-Olivier; Giuliano, Vanessa; Bazinet, Richard P

    2016-09-29

    Neuroinflammation is a proposed mechanism by which Alzheimer's disease (AD) pathology potentiates neuronal death and cognitive decline. Consumption of omega-3 polyunsaturated fatty acids (PUFA) is associated with a decreased risk of AD in human observational studies and exerts protective effects on cognition and pathology in animal models. These fatty acids and molecules derived from them are known to have anti-inflammatory and pro-resolving properties, presenting a potential mechanism for these protective effects. Here, we explore this mechanism using fat-1 transgenic mice and their wild type littermates weaned onto either a fish oil diet (high in n-3 PUFA) or a safflower oil diet (negligible n-3 PUFA). The fat-1 mouse carries a transgene that enables it to convert omega-6 to omega-3 PUFA. At 12 weeks of age, mice underwent intracerebroventricular (icv) infusion of amyloid-β 1-40. Brains were collected between 1 and 28 days post-icv, and hippocampal microglia, astrocytes, and degenerating neurons were quantified by immunohistochemistry with epifluorescence microscopy, while microglia morphology was assessed with confocal microscopy and skeleton analysis. Fat-1 mice fed with the safflower oil diet and wild type mice fed with the fish oil diet had higher brain DHA in comparison with the wild type mice fed with the safflower oil diet. Relative to the wild type mice fed with the safflower oil diet, fat-1 mice exhibited a lower peak in the number of labelled microglia, wild type mice fed with fish oil had fewer degenerating neurons, and both exhibited alterations in microglia morphology at 10 days post-surgery. There were no differences in astrocyte number at any time point and no differences in the time course of microglia or astrocyte activation following infusion of amyloid-β 1-40. Increasing brain DHA, through either dietary or transgenic means, decreases some elements of the inflammatory response to amyloid-β in a mouse model of AD. This supports the

  8. 78 FR 57621 - Sunshine Act Meeting

    Science.gov (United States)

    2013-09-19

    ... CONSUMER PRODUCT SAFETY COMMISSION Sunshine Act Meeting TIME AND DATE: Wednesday, September 25..., Maryland. STATUS: Commission Meeting--Open to the public Matters To Be Considered Briefing Matter: Voluntary Recall Notice--Notice of Proposed Rulemaking. [[Page 57622

  9. 26 CFR 1.851-4 - Determination of status.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Determination of status. 1.851-4 Section 1.851-4 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Regulated Investment Companies and Real Estate Investment Trusts § 1.851-4 Determination of...

  10. Sequential Immunization with gp140 Boosts Immune Responses Primed by Modified Vaccinia Ankara or DNA in HIV-Uninfected South African Participants.

    Directory of Open Access Journals (Sweden)

    Gavin Churchyard

    Full Text Available The safety and immunogenicity of SAAVI DNA-C2 (4 mg IM, SAAVI MVA-C (2.9 x 109 pfu IM and Novartis V2-deleted subtype C gp140 (100 mcg with MF59 adjuvant in various vaccination regimens was evaluated in HIV-uninfected adults in South Africa.Participants at three South African sites were randomized (1:1:1:1 to one of four vaccine regimens: MVA prime, sequential gp140 protein boost (M/M/P/P; concurrent MVA/gp140 (MP/MP; DNA prime, sequential MVA boost (D/D/M/M; DNA prime, concurrent MVA/gp140 boost (D/D/MP/MP or placebo. Peak HIV specific humoral and cellular responses were measured.184 participants were enrolled: 52% were female, all were Black/African, median age was 23 years (range, 18-42 years and 79% completed all vaccinations. 159 participants reported at least one adverse event, 92.5% were mild or moderate. Five, unrelated, serious adverse events were reported. The M/M/P/P and D/D/MP/MP regimens induced the strongest peak neutralizing and binding antibody responses and the greatest CD4+ T-cell responses to Env. All peak neutralizing and binding antibody responses decayed with time. The MVA, but not DNA, prime contributed to the humoral and cellular immune responses. The D/D/M/M regimen was poorly immunogenic overall but did induce modest CD4+ T-cell responses to Gag and Pol. CD8+ T-cell responses to any antigen were low for all regimens.The SAAVI DNA-C2, SAAVI MVA-C and Novartis gp140 with MF59 adjuvant in various combinations were safe and induced neutralizing and binding antibodies and cellular immune responses. Sequential immunization with gp140 boosted immune responses primed by MVA or DNA. The best overall immune responses were seen with the M/M/P/P regimen.ClinicalTrials.gov NCT01418235.

  11. Radioimmunoassay for platelet activation specific protein GMP-140 on the platelet surface and in plasma

    International Nuclear Information System (INIS)

    Wu Guoxin; Li Jianyong; Ruan Changgeng

    1991-08-01

    Using monoclonal antibody (McAb) SZ-51 which is specific for an alpha-granule membrane protein (GMP-140) on the surface of human activated platelets, the platelet GMP-140 expression in fixed whole blood was measured by direct radioimmunoassay and GMP-140 microparticles in plasma was measured by sandwich method. The GMP-140 molecules per platelet or milliliter (mL) were calculated for the following subjects; acute myocardial infarction; cerebro thrombosis; diabetic mellitus; asthma attack; epidemic hemorrhagic fever etc.. By comparing with the concentration of thromboxane B 2 (TXB 2 ) and von Willebrand factor (vWF) in plasma, it is confirmed that the measurement of GMP-140 molecules is better than that of TXB 2 and vWF. It is a sensitive and specific method for evaluating the platelet activation degree in vivo. The establishment of this method will be useful to diagnosing the thrombotic disorders and studying the pathogenesis of some other diseases

  12. Comparative Immunogenicity of HIV-1 gp140 Vaccine Delivered by Parenteral, and Mucosal Routes in Female Volunteers; MUCOVAC2, A Randomized Two Centre Study.

    Directory of Open Access Journals (Sweden)

    Catherine A Cosgrove

    Full Text Available Defining optimal routes for induction of mucosal immunity represents an important research priority for the HIV-1 vaccine field. In particular, it remains unclear whether mucosal routes of immunization can improve mucosal immune responses.In this randomized two center phase I clinical trial we evaluated the systemic and mucosal immune response to a candidate HIV-1 Clade C CN54gp140 envelope glycoprotein vaccine administered by intramuscular (IM, intranasal (IN and intravaginal (IVAG routes of administration in HIV negative female volunteers. IM immunizations were co-administered with Glucopyranosyl Lipid Adjuvant (GLA, IN immunizations with 0.5% chitosan and IVAG immunizations were administered in an aqueous gel.Three IM immunizations of CN54 gp140 at either 20 or 100 μg elicited significantly greater systemic and mucosal antibodies than either IN or IVAG immunizations. Following additional intramuscular boosting we observed an anamnestic antibody response in nasally primed subjects. Modest neutralizing responses were detected against closely matched tier 1 clade C virus in the IM groups. Interestingly, the strongest CD4 T-cell responses were detected after IN and not IM immunization.These data show that parenteral immunization elicits systemic and mucosal antibodies in women. Interestingly IN immunization was an effective prime for IM boost, while IVAG administration had no detectable impact on systemic or mucosal responses despite IM priming.EudraCT 2010-019103-27 and the UK Clinical Research Network (UKCRN Number 11679.

  13. 41 CFR 102-192.140 - What are your general responsibilities as a Federal mail center manager?

    Science.gov (United States)

    2010-07-01

    ... responsibilities as a Federal mail center manager? 102-192.140 Section 102-192.140 Public Contracts and Property... ADMINISTRATIVE PROGRAMS 192-MAIL MANAGEMENT Mail Center Manager Requirements § 102-192.140 What are your general responsibilities as a Federal mail center manager? A Federal mail center manager should— (a) Implement policies and...

  14. Lysosomal-associated transmembrane protein 5 (LAPTM5 is a molecular partner of CD1e.

    Directory of Open Access Journals (Sweden)

    Catherine Angénieux

    Full Text Available The CD1e protein participates in the presentation of lipid antigens in dendritic cells. Its transmembrane precursor is transported to lysosomes where it is cleaved into an active soluble form. In the presence of bafilomycin, which inhibits vacuolar ATPase and consequently the acidification of endosomal compartments, CD1e associates with a 27 kD protein. In this work, we identified this molecular partner as LAPTM5. The latter protein and CD1e colocalize in trans-Golgi and late endosomal compartments. The quantity of LAPTM5/CD1e complexes increases when the cells are treated with bafilomycin, probably due to the protection of LAPTM5 from lysosomal proteases. Moreover, we could demonstrate that LAPTM5/CD1e association occurs under physiological conditions. Although LAPTM5 was previously shown to act as a platform recruiting ubiquitin ligases and facilitating the transport of receptors to lysosomes, we found no evidence that LATPM5 controls either CD1e ubiquitination or the generation of soluble lysosomal CD1e proteins. Notwithstanding these last observations, the interaction of LAPTM5 with CD1e and their colocalization in antigen processing compartments both suggest that LAPTM5 might influence the role of CD1e in the presentation of lipid antigens.

  15. 76 FR 26714 - Privacy Act of 1974; System of Records

    Science.gov (United States)

    2011-05-09

    ... DEPARTMENT OF DEFENSE Department of the Army [Docket ID USA-2011-0010] Privacy Act of 1974; System... specialty, credit hours accumulated, examination and lesson course completion status, assignment history... history, student academic status, curricula, course description, scheduling, testing, academic, graduation...

  16. Dicty_cDB: Contig-U10768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 158 8e-44 EF077650_1( EF077650 |pid:none) Israeli tick typhus rickettsia str... 158 8e-44 DQ836220_1( DQ...0 |pid:none) Male-killing Rickettsia from Adali... 157 1e-43 EF177484_1( EF177484 |pid:none) Israeli tick ty...9 |pid:none) Bartonella sp. RT246YN citrate syn... 140 2e-31 DQ821854_1( DQ821854 |pid:none) Israeli tick ty

  17. Expression and Regulatory Network Analysis of miR-140-3p, a New Potential Serum Biomarker for Autism Spectrum Disorder

    Directory of Open Access Journals (Sweden)

    Matilde Cirnigliaro

    2017-08-01

    Full Text Available Given its prevalence and social impact, Autism Spectrum Disorder (ASD is drawing much interest. Molecular basis of ASD is heterogeneous and only partially known. Many factors, including disorders comorbid with ASD, like TS (Tourette Syndrome, complicate ASD behavior-based diagnosis and make it vulnerable to bias. To further investigate ASD etiology and to identify potential biomarkers to support its precise diagnosis, we used TaqMan Low Density Array technology to profile serum miRNAs from ASD, TS, and TS+ASD patients, and unaffected controls (NCs. Through validation assays in 30 ASD, 24 TS, and 25 TS+ASD patients and 25 NCs, we demonstrated that miR-140-3p is upregulated in ASD vs.: NC, TS, and TS+ASD (Tukey's test, p-values = 0.03, = 0.01, < 0.0001, respectively. ΔCt values for miR-140-3p and YGTSS (Yale Global Tic Severity Scale scores are positively correlated (Spearman r = 0.33; Benjamini-Hochberg p = 0.008 and show a linear relationship (p = 0.002. Network functional analysis showed that nodes controlled by miR-140-3p, especially CD38 and NRIP1 which are its validated targets, are involved in processes convergingly dysregulated in ASD, such as synaptic plasticity, immune response, and chromatin binding. Biomarker analysis proved that serum miR-140-3p can discriminate among: (1 ASD and NC (Area under the ROC curve, AUC: 0.70; sensitivity: 63.33%; specificity: 68%; (2 ASD and TS (AUC: 0.72; sensitivity: 66.66%; specificity: 70.83%; (3 ASD and TS+ASD (AUC: 0.78; sensitivity: 73.33%; specificity: 76%. Characterization of miR-140-3p network would contribute to further clarify ASD etiology. Serum miR-140-3p could represent a potential non-invasive biomarker for ASD, easy to test through liquid biopsy.

  18. 45 CFR 286.140 - What special provisions apply to victims of domestic violence?

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false What special provisions apply to victims of domestic violence? 286.140 Section 286.140 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL TANF PROVISIONS...

  19. 20 CFR 626.1 - Scope and purpose of the Job Training Partnership Act.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Scope and purpose of the Job Training... LABOR INTRODUCTION TO THE REGULATIONS UNDER THE JOB TRAINING PARTNERSHIP ACT § 626.1 Scope and purpose of the Job Training Partnership Act. It is the purpose of the Job Training Partnership Act (JTPA or...

  20. Characterization of humoral responses to soluble trimeric HIV gp140 from a clade A Ugandan field isolate.

    Science.gov (United States)

    Visciano, Maria Luisa; Tagliamonte, Maria; Stewart-Jones, Guillaume; Heyndrickx, Leo; Vanham, Guido; Jansson, Marianne; Fomsgaard, Anders; Grevstad, Berit; Ramaswamy, Meghna; Buonaguro, Franco M; Tornesello, Maria Lina; Biswas, Priscilla; Scarlatti, Gabriella; Buonaguro, Luigi

    2013-07-08

    Trimeric soluble forms of HIV gp140 envelope glycoproteins represent one of the closest molecular structures compared to native spikes present on intact virus particles. Trimeric soluble gp140 have been generated by several groups and such molecules have been shown to induce antibodies with neutralizing activity against homologous and heterologous viruses. In the present study, we generated a recombinant trimeric soluble gp140, derived from a previously identified Ugandan A-clade HIV field isolate (gp14094UG018). Antibodies elicited in immunized rabbits show a broad binding pattern to HIV envelopes of different clades. An epitope mapping analysis reveals that, on average, the binding is mostly focused on the C1, C2, V3, V5 and C5 regions. Immune sera show neutralization activity to Tier 1 isolates of different clades, demonstrating cross clade neutralizing activity which needs to be further broadened by possible structural modifications of the clade A gp14094UG018. Our results provide a rationale for the design and evaluation of immunogens and the clade A gp14094UG018 shows promising characteristics for potential involvement in an effective HIV vaccine with broad activity.

  1. 7 CFR 1220.600 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1220.600 Section 1220.600 Agriculture... CONSUMER INFORMATION Procedures To Request a Referendum Definitions § 1220.600 Act. Act means the Soybean, Promotion, Research, and Consumer Information Act set forth in title XIX, subtitle E, of the Food...

  2. 7 CFR 1220.101 - Act.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1220.101 Section 1220.101 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.101 Act. The term Act means the Soybean Promotion, Research, and Consumer Information Act, subtitle E of title XIX, of the Food...

  3. Nutritional status of children with clinical conditions.

    Science.gov (United States)

    Murphy, Alexia J; Hill, Rebecca J; Buntain, Helen; White, Melinda; Brookes, Denise; Davies, Peter S W

    2017-06-01

    Nutritional status is an important consideration in many pediatric clinical conditions. This paper aimed to examine and compare the nutritional status, represented by body cell mass (BCM), of children with cancer, Crohn's disease (CD), cystic fibrosis (CF) and anorexia nervosa (AN). Anthropometry was measured and BCM was calculated from whole body potassium-40 counting in 259 children being treated for clinical conditions (n = 66 cancer; n = 59 AN; n = 75 CF; n = 59 CD) and 108 healthy children. BCM was adjusted for height (BCMI) and expressed as a Z-score relative to laboratory reference data. The CD (-0.80 ± 1.61; p = 0.0001) and AN (-1.13 ± 0.99; p = 0.0001) groups had significantly lower BMI Z-score than the healthy control (0.13 ± 0.75), cancer (0.50 ± 1.40) and CF groups (-0.09 ± 0.95). The cancer (-1.16 ± 1.60; p = 0.0001), CD (-1.13 ± 1.36; p = 0.0001) and AN (-0.97 ± 1.18; p = 0.0001) groups had significantly reduced BCM compared to the healthy control (0.07 ± 0.93) and CF group (0.31 ± 1.08). According to BCMI Z-score, 42.4% of patients with cancer, 41.7% of the patients with CD, 27.1% of patients with AN, and 4.0% of patients with CF were considered malnourished. This study demonstrates that children undergoing treatment for clinical conditions may have alterations in BCM, independent of BMI. Children with cancer, CD and AN all had a high prevalence of malnutrition. Assessment of body composition, not just body size, is vital to understand nutritional status in children with clinical conditions. Copyright © 2016 Elsevier Ltd and European Society for Clinical Nutrition and Metabolism. All rights reserved.

  4. 1 CFR 15.4 - Reproduction and certification of copies of acts and documents.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Reproduction and certification of copies of... Reproduction and certification of copies of acts and documents. The Director of the Federal Register shall furnish to requesting agencies, at cost, reproductions or certified copies of original acts and documents...

  5. Dicty_cDB: Contig-U13747-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Simonyella variegata isolate AFTOL... 146 5e-34 DQ986817_1( DQ986817 |pid:none) Lecanora...chinus voucher TSJ... 141 1e-32 DQ782829_1( DQ782829 |pid:none) Lecanora hybocarpa isolate AFTOL-I... 141 1e...DQ447888_1( DQ447888 |pid:none) Cheimonophyllum candidissimum isol... 140 3e-32 EF105431_1( EF105431 |pid:none) Lecanora...2_1( EF105432 |pid:none) Lecanora sulphurea RNA polymerase ... 136 6e-31 AF389538_1( AF389538 |pid:none) Ino

  6. 1 CFR 3.3 - Reproduction and certification of copies of acts and documents.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Reproduction and certification of copies of... GENERAL SERVICES TO THE PUBLIC § 3.3 Reproduction and certification of copies of acts and documents. The... furnishing of reproductions of acts and documents and certificates of authentication for them. Section 1258...

  7. The impact of SHS exposure on health status and exacerbations among patients with COPD

    Directory of Open Access Journals (Sweden)

    Mark D Eisner

    2009-05-01

    Full Text Available Mark D Eisner1,3, Carlos Iribarren3, Edward H Yelin2, Stephen Sidney3, Patricia P Katz2, Gabriela Sanchez3, Paul D Blanc11Division of Occupational and Environmental Medicine and Division of Pulmonary and Critical Care Medicine; 2Institute for Health Policy Studies, Department of Medicine, University of California, San Francisco, CA, USA; 3Division of Research, Kaiser Permanente, Oakland, CA, USAAbstract: Secondhand smoke (SHS is a major contributor to indoor air pollution. Because it contains respiratory irritants, it may adversely influence the clinical course of persons with chronic obstructive pulmonary disease (COPD. We used data from nonsmoking members of the FLOW cohort of COPD (n = 809 to elucidate the impact of SHS exposure on health status and exacerbations (requiring emergency department visits or hospitalization. SHS exposure was measured by a validated survey instrument (hours of exposure during the past week. Physical health status was measured by the SF-12 Physical Component Summary Score and disease-specific health-related quality of life (HRQL by the Airways Questionnaire 20-R. Health care utilization for COPD was determined from Kaiser Permanente Northern California computerized databases. Compared to no SHS exposure, higher level SHS exposure was associated with poorer physical health status (mean score decrement −1.78 points; 95% confidence interval [CI] −3.48 to −0.074 points after controlling for potential confounders. Higher level SHS exposure was also related to poorer disease-specific HRQL (mean score increment 0.63; 95% CI 0.016 to 1.25 and less distance walked during the Six-Minute Walk test (mean decrement −50 feet; 95% CI −102 to 1.9. Both lower level and higher level SHS exposure was related to increased risk of emergency department (ED visits (hazard ratio [HR] 1.40; 95% CI 0.96 to 2.05 and HR 1.41; 95% CI 0.94 to 2.13. Lower level and higher level SHS exposure were associated with a greater risk of

  8. Centrally Acting Oximes in Reactivation of Tabun-Phosphoramidated AChE

    Science.gov (United States)

    Kovarik, Zrinka; Maček, Nikolina; Sit, Rakesh K.; Radić, Zoran; Fokin, Valery V.; Sharpless, K. Barry; Taylor, Palmer

    2012-01-01

    Organophosphates (OP) inhibit acetylcholinesterase (AChE, E.C.3.1.1.7), both in peripheral tissues and central nervous system (CNS), causing adverse and sometimes fatal effects due to the accumulation of neurotransmitter acetylcholine (ACh). The currently used therapy, focusing on the reactivation of inhibited AChE, is limited to peripheral tissues because commonly used quaternary pyridinium oxime reactivators do not cross the blood brain barrier (BBB) at therapeutically relevant levels. A directed library of thirty uncharged oximes that contain tertiary amine or imidazole protonable functional groups that should cross the BBB as unionized species was tested as tabun-hAChE conjugate reactivators along with three reference oximes: DAM (diacetylmonoxime), MINA (monoisonitrosoacetone), and 2-PAM. The oxime RS150D [N-((1-(3-(2-((hydroxyimino)methyl)-1H-imidazol-1-yl)propyl)-1H-1,2,3-triazol-4-yl)methyl)benzamide] was highlighted as the most promising reactivator of the tabun-hAChE conjugate. We also observed that oximes RS194B [N-(2-(azepan-1-yl)ethyl)-2-(hydroxyimino)acetamide] and RS41A [2-(hydroxyimino)-N-(2-(pyrrolidin-1-yl)ethyl)acetamide], which emerged as lead uncharged reactivators of phosphylated hAChE with other OPs (sarin, cyclosarin and VX), exhibited only moderate reactivation potency for tabun inhibited hAChE. This implies that geometry of oxime access to the phosphorus atom conjugated to the active serine is an important criterion for efficient reactivation, along with the chemical nature of the conjugated moiety: phosphorate, phosphonate, or phosphoramidate. Moreover, modification of the active center through mutagenesis enhances the rates of reactivation. The phosphoramidated-hAChE choline-binding site mutant Y337A showed three-times enhanced reactivation capacity with non-triazole imidazole containing aldoximes (RS113B, RS113A and RS115A) and acetamide derivative (RS194B) than with 2PAM. PMID:22960624

  9. Recent operating experience with Varian 70 GHz and 140 GHz gyrotrons

    International Nuclear Information System (INIS)

    Felch, K.; Bier, R.; Fox, L.; Huey, H.; Ives, L.; Jory, H.; Lopez, N.; Shively, J.; Spang, S.

    1985-01-01

    The design features and initial test results of Varian 70 GHz and 140 GHz CW gyrotrons are presented. The first experimental 140 GHz tube has achieved an output power of 102 kW at 24% efficiency under pulsed conditions in the desired TE 031 0 cavity mode. Further tests aimed at achieving the design goal of 100 kW CW are currently underway. The 70 GHz tube has achieved an output power of 200 kW under pulsed conditions and possesses a wide dynamic range for output power variations. 6 refs., 8 figs

  10. Magnetic moment measurement of 140Ba nuclei using transient field technique

    International Nuclear Information System (INIS)

    Saxena, Mansi; Mandal, S.; Siwal, Davinder; Rainovski, G.; Danchev, M.; Damyanova, A.; Gladnishki, K.; Leske, J.; Bauer, C.; Bloch, T.; John, P.; Pietralla, N.; Wollersheim, H.J.; Kojouharov, I.; Pietri, S.; Schaffner, H.

    2011-01-01

    Mixed symmetry states have been identified in the neutron proton version of the Interacting Boson Model. The motivation of this experiment is to identify uniquely one phonon mixed symmetry states in 140 Ba nuclei by g factor measurement of the states. Magnetic moments measurements provide substantial information on the microscopic structure of the nuclei as the magnetic moment of a nuclei is described by the wave function of one state only. In this present paper we report the preliminary results of the g factor measurement of the first 2 + state of 140 Ba

  11. Accuracy and Utility of Estimating Lean Body Mass and Nutritional Status in Patients with Chronic Kidney Disease on Long-Term Hemodialysis Using Anthropometric Skinfold Thickness Measurements.

    Science.gov (United States)

    Leong, Khai Gene; Chee, Jia Lian; Karahalios, Amalia; Skelley, Annabelle; Wong, Kim

    2018-01-01

    Malnutrition is common in patients on hemodialysis (prevalence of 30% to 50%) and is associated with higher mortality. Lean body mass (LBM) assessment is an accurate way of assessing nutritional status. The dual-energy X-ray absorptiometry (DEXA) scan is a reliable method in assessing body compositions and LBM; however, it is expensive and largely inaccessible. Anthropometric skinfold thickness measurement (ASFM) is useful in assessing LBM. It is cheaper and accessible, but underutilized clinically. The subjective global score (SGA) is a well-established method of assessing nutritional status. All three methods of assessing nutritional status were compared. In this pilot observational study, there was a significant correlation between LBM% estimated by DEXA and ASFM (mean difference -1.46% [95% CI -4.09 to 1.18]; LOA -14.0 to 11.1). Nutritional status by SGA could only detect those severely malnourished when using LBM% by ASFM as comparison. Our study demonstrated that ASFM is a useful method of assessing LBM and nutritional status, which can be easily utilized clinically. Copyright© by the American Nephrology Nurses Association.

  12. 17 CFR 140.91 - Delegation of authority to the Director of the Division of Trading and Markets.

    Science.gov (United States)

    2010-04-01

    ... Director of the Division of Trading and Markets. 140.91 Section 140.91 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ORGANIZATION, FUNCTIONS, AND PROCEDURES OF THE COMMISSION Functions § 140.91 Delegation of authority to the Director of the Division of Trading and Markets. (a) The...

  13. 12 CFR 550.140 - Must I adopt and follow written policies and procedures in exercising fiduciary powers?

    Science.gov (United States)

    2010-01-01

    ... procedures in exercising fiduciary powers? 550.140 Section 550.140 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY FIDUCIARY POWERS OF SAVINGS ASSOCIATIONS Exercising Fiduciary Powers § 550.140 Must I adopt and follow written policies and procedures in exercising fiduciary powers? You...

  14. 77 FR 22749 - Petition To List 83 Species of Coral as Threatened or Endangered Under the Endangered Species Act...

    Science.gov (United States)

    2012-04-17

    ... threatened or endangered under the Endangered Species Act (ESA) and to notify the public about future public... Candidate Coral Species Petitioned Under the U.S. Endangered Species Act (Status Review Report) and the draft Management Report for 82 Corals Status Review under the Endangered Species Act: Assessment of...

  15. The detection of hard x-rays (10-140 KeV) by channel plate electron multipliers

    International Nuclear Information System (INIS)

    Bateman, J.E.

    1976-12-01

    Results are presented indicating that hard X-rays in the energy range 10 to 50 keV can be detected with good efficiency (5 to 10%) in channel plate electron multipliers (CPEM). From 50 keV to 140 keV the detection efficiency lies in the range 1 to 2%. A simple physical model is developed which indicates that not only can good detection efficiency be obtained but that very good X-ray imaging is possible. The model predicts that with further development, a wideband, hard X-ray detector can be realised with a detection efficiency in the range 5 to 20% and spatial response better than 10 lp/mm in the energy range 10 to 140 keV. (author)

  16. Atomic Energy Act with ordinances. 16. ed.

    International Nuclear Information System (INIS)

    Ziegler, E.

    1992-01-01

    The convenient edition contains the entire body of German atomic energy and radiation protection laws in their updated version as of June 1992. Thus it also takes the amendments of the Atomic Energy Act (Article 22 Paragraph 1 Sentence 1 and Paragraph 3 as well as Article 46 Paragraph 3 Atomic Energy Act) into account on the basis of the Law on the Establishment of a Federal Export Office from February 28, 1992 (Code of Federal Laws I, pp. 376 ff). As a result of this law, which became effective as of April 1, 1992, within the scope of business of the Federal Ministry for Economic Affairs, a federal export office was established which was endowed with the status of a federal agency. This office is in charge of administrative and supervisory tasks on the federal level. Within the framework of the atomic energy law this agency is in charge of export and import permits as well as the supervision of the export and import of nuclear fuel and other radioactive materials. (orig./HP) [de

  17. Adolescent Controversial Status Brokers: A Double-Edged Sword

    Science.gov (United States)

    Borowski, Sarah; Zeman, Janice; Carboni, Inga; Gilman, Rich; Thrash, Todd

    2017-01-01

    Using a 3-wave longitudinal, multidimensional approach, this study investigated the influence of social network position and social status on the psychosocial outcomes of 440 youth (45.1% girls; M[subscript age] = 16.1 years; 90.9% Caucasian) over 26 months, focusing on the controversial status classification (i.e., youth who are highly liked and…

  18. Narcissism and the Pursuit of Status.

    Science.gov (United States)

    Zeigler-Hill, Virgil; Vrabel, Jennifer K; McCabe, Gillian A; Cosby, Cheryl A; Traeder, Caitlin K; Hobbs, Kelsey A; Southard, Ashton C

    2018-04-10

    The purpose of the present studies was to examine the connections that narcissistic admiration and narcissistic rivalry had with various aspects of status. Study 1 examined the associations that narcissism had with the motivation to seek status in a sample of 1,219 community members. Study 2 examined whether narcissism interacted with the status seeking motive to predict how individuals pursued status in a sample of 760 community members and college students. Study 3 used a daily diary approach to examine whether narcissism moderated the associations that daily perceptions of status and affiliation had with state self-esteem in 356 college students. Our results revealed that narcissistic admiration and narcissistic rivalry were somewhat similar in their desire for status but had divergent associations with other aspects of status (e.g., strategies employed to attain status, perceptions of status, reactions to perceived status). The results of the present studies suggest that narcissistic admiration is associated with an agentic orientation to the pursuit of status, whereas narcissistic rivalry is associated with an antagonistic orientation to the pursuit of status. Discussion focuses on the implications of these results for our understanding of the connections between narcissism and status. This article is protected by copyright. All rights reserved. © 2018 Wiley Periodicals, Inc.

  19. 40 CFR 1048.140 - What are the provisions for certifying Blue Sky Series engines?

    Science.gov (United States)

    2010-07-01

    ... Blue Sky Series engines? 1048.140 Section 1048.140 Protection of Environment ENVIRONMENTAL PROTECTION... Sky Series engines? This section defines voluntary standards for a recognized level of superior emission control for engines designated as “Blue Sky Series” engines. If you certify an engine family under...

  20. Biophysical characterization of the structural change of Nopp140, an intrinsically disordered protein, in the interaction with CK2α

    International Nuclear Information System (INIS)

    Na, Jung-Hyun; Lee, Won-Kyu; Kim, Yuyoung; Jeong, Cherlhyun; Song, Seung Soo; Cha, Sun-Shin; Han, Kyou-Hoon; Shin, Yeon-Kyun; Yu, Yeon Gyu

    2016-01-01

    Nucleolar phosphoprotein 140 (Nopp140) is a nucleolar protein, more than 80% of which is disordered. Previous studies have shown that the C-terminal region of Nopp140 (residues 568–596) interacts with protein kinase CK2α, and inhibits the catalytic activity of CK2. Although the region of Nopp140 responsible for the interaction with CK2α was identified, the structural features and the effect of this interaction on the structure of Nopp140 have not been defined due to the difficulty of structural characterization of disordered protein. In this study, the disordered feature of Nopp140 and the effect of CK2α on the structure of Nopp140 were examined using single-molecule fluorescence resonance energy transfer (smFRET) and electron paramagnetic resonance (EPR). The interaction with CK2α was increased conformational rigidity of the CK2α-interacting region of Nopp140 (Nopp140C), suggesting that the disordered and flexible conformation of Nopp140C became more rigid conformation as it binds to CK2α. In addition, site specific spin labeling and EPR analysis confirmed that the residues 574–589 of Nopp140 are critical for binding to CK2α. Similar technical approaches can be applied to analyze the conformational changes in other IDPs during their interactions with binding partners. - Highlights: • Nopp140 is intrinsically disordered protein (IDP). • Conformation of Nopp140 became more rigid conformation due to interaction with CK2α. • smFRET and EPR could be applied to analyze the structural changes of IDPs.

  1. Biophysical characterization of the structural change of Nopp140, an intrinsically disordered protein, in the interaction with CK2α

    Energy Technology Data Exchange (ETDEWEB)

    Na, Jung-Hyun [Department of Chemistry, Kookmin University, Jeongneung-dong, Seongbuk-gu, Seoul 02707 (Korea, Republic of); Biomedical Research Institute, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Department of Chemistry and Nano Science, Ewha Womans University, Seoul 03760 (Korea, Republic of); Lee, Won-Kyu [Department of Chemistry, Kookmin University, Jeongneung-dong, Seongbuk-gu, Seoul 02707 (Korea, Republic of); Kim, Yuyoung; Jeong, Cherlhyun [Biomedical Research Institute, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Song, Seung Soo [Department of Chemistry, Kookmin University, Jeongneung-dong, Seongbuk-gu, Seoul 02707 (Korea, Republic of); Cha, Sun-Shin [Department of Chemistry and Nano Science, Ewha Womans University, Seoul 03760 (Korea, Republic of); Han, Kyou-Hoon [Division of Biosystems Research, Korea Research Institute of Bioscience and Biotechnology, Daejeon 34141 (Korea, Republic of); Shin, Yeon-Kyun [Biomedical Research Institute, Korea Institute of Science and Technology, Seoul 02792 (Korea, Republic of); Department of Biochemistry, Biophysics and Molecular Biology, Iowa State University, Ames, IA 50011 (United States); Yu, Yeon Gyu, E-mail: ygyu@kookmin.ac.kr [Department of Chemistry, Kookmin University, Jeongneung-dong, Seongbuk-gu, Seoul 02707 (Korea, Republic of)

    2016-08-19

    Nucleolar phosphoprotein 140 (Nopp140) is a nucleolar protein, more than 80% of which is disordered. Previous studies have shown that the C-terminal region of Nopp140 (residues 568–596) interacts with protein kinase CK2α, and inhibits the catalytic activity of CK2. Although the region of Nopp140 responsible for the interaction with CK2α was identified, the structural features and the effect of this interaction on the structure of Nopp140 have not been defined due to the difficulty of structural characterization of disordered protein. In this study, the disordered feature of Nopp140 and the effect of CK2α on the structure of Nopp140 were examined using single-molecule fluorescence resonance energy transfer (smFRET) and electron paramagnetic resonance (EPR). The interaction with CK2α was increased conformational rigidity of the CK2α-interacting region of Nopp140 (Nopp140C), suggesting that the disordered and flexible conformation of Nopp140C became more rigid conformation as it binds to CK2α. In addition, site specific spin labeling and EPR analysis confirmed that the residues 574–589 of Nopp140 are critical for binding to CK2α. Similar technical approaches can be applied to analyze the conformational changes in other IDPs during their interactions with binding partners. - Highlights: • Nopp140 is intrinsically disordered protein (IDP). • Conformation of Nopp140 became more rigid conformation due to interaction with CK2α. • smFRET and EPR could be applied to analyze the structural changes of IDPs.

  2. Nuclear Liability Act. RS, c.29 (1st supp.), s.1

    International Nuclear Information System (INIS)

    1985-01-01

    The Revised Statutes of Canada 1985 which entered into force on 12 December 1988 revoked the Nuclear Liability Act of 1970, replacing it with a new version. The new Act (Chapter N-28 of the Revised Statutes) updates the previous text and makes some linguistic corrections. The principles of the Act of 1970 remain unchanged, namely absolute liability of the nuclear operator, such liability being limited in amount and in time [fr

  3. An interpretation of schedule 1 of the Radioactive Substances Act 1993 and related issues

    International Nuclear Information System (INIS)

    Hill, M.; Wakerley, M.W.

    2000-09-01

    Schedule 1 of the UK's Radioactive Substances Act 1993 was originally Schedule 3 of the 1960 Act of the same name. It is possible that different methods are currently being employed to interpret how Schedule 1 should be used. This report provides an interpretation and guidance on this and related issues. It is primarily for technical specialists already familiar with the workings of the Act. This report covers the period 1999/2000

  4. Myomaker, Regulated by MYOD, MYOG and miR-140-3p, Promotes Chicken Myoblast Fusion

    Directory of Open Access Journals (Sweden)

    Wen Luo

    2015-11-01

    Full Text Available The fusion of myoblasts is an important step during skeletal muscle differentiation. A recent study in mice found that a transmembrane protein called Myomaker, which is specifically expressed in muscle, is critical for myoblast fusion. However, the cellular mechanism of its roles and the regulatory mechanism of its expression remain unclear. Chicken not only plays an important role in meat production but is also an ideal model organism for muscle development research. Here, we report that Myomaker is also essential for chicken myoblast fusion. Forced expression of Myomaker in chicken primary myoblasts promotes myoblast fusion, whereas knockdown of Myomaker by siRNA inhibits myoblast fusion. MYOD and MYOG, which belong to the family of myogenic regulatory factors, can bind to a conserved E-box located proximal to the Myomaker transcription start site and induce Myomaker transcription. Additionally, miR-140-3p can inhibit Myomaker expression and myoblast fusion, at least in part, by binding to the 3ʹ UTR of Myomaker in vitro. These findings confirm the essential roles of Myomaker in avian myoblast fusion and show that MYOD, MYOG and miR-140-3p can regulate Myomaker expression.

  5. Prevalência e determinantes de obesidade e sobrepeso em mulheres em idade reprodutiva residentes na região semiárida do Brasil Prevalence and determinants of obesity and overweight among reproductive age women living in the semi-arid region of Brazil

    Directory of Open Access Journals (Sweden)

    Luciano Lima Correia

    2011-01-01

    Full Text Available O estudo estimou a prevalência e identificou fatores determinantes do sobrepeso e obesidade em mulheres em idade fértil na região semiárida do Brasil. Na amostra por conglomerados de oito mil domicílios do estado do Ceará, foram pesquisadas 6.845 mulheres. Sobrepeso e obesidade foram medidos pelo Índice de Massa Corporal, utilizando-se a análise multivariada para a identificação dos fatores determinantes. As prevalências de sobrepeso e obesidade foram de 32,6% e 16,1%, respectivamente. Na análise ajustada, a obesidade esteve positivamente associada a: idade >30 anos (RP=1,55, estado civil casada (RP=1,36, escolaridade fundamental (RP=1,40, idade na menarca 1 filho (RP=1,65, uso de contraceptivos (RP=1,31. Os fatores relacionados à saúde e à nutrição, referentes à obesidade mórbida, foram: hipertensão arterial (RP=3,11, diabetes (RP=2,08, insatisfação com a imagem corporal (RP=4,26 e procedimentos para perder peso (RP=2,73. Sobrepeso e obesidade são altamente prevalentes na região semiárida. A educação foi o único fator socioeconômico passível de ser modificado. Os fatores reprodutivos identificados apontam para a necessidade de mobilização dos serviços de pré-natal, pós-parto e planejamento familiar na prevenção e no controle da obesidade.The study estimated the prevalence and determinants of overweight and obesity in women of reproductive age in the Semi-Arid Region of Brazil. In the cluster sampling of 8,000 households of the state of Ceará, 6,845 women were surveyed. Overweight and obesity were measured by the body mass index and risk factors identified by multivariate analysis. The prevalences of overweight and obesity were 32.6% and 16.1%, respectively. After adjusted analysis, obesity was positively associated with age >30 years (PR = 1.55, marital status, married (PR = 1.36, elementary education (PR = 1.40, age at menarche 1 child (PR = 1.65 and contraceptive use (PR = 1.31. Specific health and

  6. Socioeconomic Status and Bullying: A Meta-Analysis

    Science.gov (United States)

    Wolke, Dieter

    2014-01-01

    We examined whether socioeconomic status (SES) could be used to identify which schools or children are at greatest risk of bullying, which can adversely affect children’s health and life. We conducted a review of published literature on school bullying and SES. We identified 28 studies that reported an association between roles in school bullying (victim, bully, and bully-victim) and measures of SES. Random effects models showed SES was weakly related to bullying roles. Adjusting for publication bias, victims (odds ratio [OR] = 1.40; 95% confidence interval [CI] = 1.24, 1.58) and bully-victims (OR = 1.54; 95% CI = 1.36, 1.74) were more likely to come from low socioeconomic households. Bullies (OR = 0.98; 95% CI = 0.97, 0.99) and victims (OR = 0.95; 95% CI = 0.94, 0.97) were slightly less likely to come from high socioeconomic backgrounds. SES provides little guidance for targeted intervention, and all schools and children, not just those with more socioeconomic deprivation, should be targeted to reduce the adverse effects of bullying. PMID:24825231

  7. Artéria torácica interna enxertada: patência e estado funcional em repouso e após dobutamina Internal thoracic artery graft (ITAG: patency and functional status at rest and during dobutamine-stress echocardiography

    Directory of Open Access Journals (Sweden)

    José Sebastião de Abreu

    2008-01-01

    Full Text Available FUNDAMENTO: A artéria torácica interna enxertada (ATIE patente usualmente tem fração diastólica (FD> 50% do fluxo. O estado funcional pode ser avaliado pelo índice de reserva coronariano (IRC. OBJETIVO: Avaliar, pela ecocardiografia e pelo Doppler em nível supraclavicular, a patência e o estado funcional da ATIE. MÉTODOS: Foram coletados prospectivamente e analisados os dados de 66 pacientes submetidos a ecocardiograma sob estresse com dobutamina (EED. O grupo I (GI ocorreu com 49 ATIE sem estenose. No grupo II (GII (10 ATIE havia estenose significativa (> 50% e 50%, ocorreu em 49 ATIE (GI=40, GII=8 e GIII=1 no repouso e em 61 ATIE (GI=49, GII=10 e GIII=2 durante EED. Sensibilidade, especificidade, valor preditivo positivo (VPP, valor preditivo negativo (VPN e acurácia foram, respectivamente, em repouso, 81%, 86% ,98%, 35 % e 82%; e no EED, 100%, 71%, 97%, 100% e 97%. As ATIE com FD>50% em repouso estavam patentes e as com FD1,8, isso ocorreu em 42 ATIE (39 do GI, 2 do GII e 1 GIII, verificando-se sensibilidade = 79%; especificidade = 85,7%; VPP = 94%; VPN = 59%; e acurácia = 80,9%. O IRC no GI foi maior (p=0,02 que em GII e GIII. CONCLUSÃO: Em nosso estudo, a avaliação não-invasiva da ATIE foi efetiva para verificar patência e estado funcional.BACKGROUND: The patent internal thoracic artery graft (ITAG usually has a diastolic fraction (DF > 50% of the flow. The functional assessment can be evaluated by the coronary reserve index (CRI. OBJECTIVE: The objective was to evaluate the patency and functional status of the ITAG through echocardiography and Doppler. METHODS: Data from sixty-six patients who underwent dobutamine-stress echocardiography (DSE were prospectively collected and analyzed. Group I (GI had 49 ITAG without stenosis, Group II (GII, 10 ITAG with significant stenosis (> 50% and 50%, it was observed in 49 ITAG (GI= 40, GII= 8 and GIII= 1 at rest and in 61 ITAG (GI=49, GII=10 and GIII=2 during DSE. The sensitivity

  8. Investigating the Status of Tablet Computers and E-Books Use of Open Education Faculty Students: A Case Study

    Science.gov (United States)

    Koçak, Ömer; Yildirim, Önder; Kursun, Engin; Yildirim, Gürkan

    2016-01-01

    The increase in tablet computers and e-books use brings to mind the question of how users benefited from these technologies. In this sense, the present study investigated the status of students' tablet computers and e-books use and the reasons why students prefer to use and not use of tablet computers and e-books. Students' study habits while…

  9. 47 CFR 51.807 - Arbitration and mediation of agreements by the Commission pursuant to section 252(e)(5) of the Act.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Arbitration and mediation of agreements by the Commission pursuant to section 252(e)(5) of the Act. 51.807 Section 51.807 Telecommunication FEDERAL... Implementation of Section 252 of the Act § 51.807 Arbitration and mediation of agreements by the Commission...

  10. 10 CFR 140.13b - Amount of liability insurance required for uranium enrichment facilities.

    Science.gov (United States)

    2010-01-01

    ... enrichment facilities. 140.13b Section 140.13b Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) FINANCIAL... required for uranium enrichment facilities. Each holder of a license issued under Parts 40 or 70 of this chapter for a uranium enrichment facility that involves the use of source material or special nuclear...

  11. Molecular analysis of an actin gene, CarACT1, from chickpea (Cicer arietinum L.).

    Science.gov (United States)

    Peng, Hui; Cheng, Huiying; Yu, Xingwang; Shi, Qinghua; Zhang, Hua; Li, Jiangui; Ma, Hao

    2010-02-01

    Actins are ubiquitous and highly conserved proteins that play key roles in cell formation and cellular activities. In this study, an actin gene was isolated from chickpea for the first time and designated as CarACT1 (for Cicer arietinum L. actin gene 1; Genbank accession no. EU529707). It encoded a putative protein with 377 amino acids and contained five exons and four introns within genomic DNA sequence. CarACT1 was localized in cytoplasm and showed high similarity to other well known actins from various species. Reverse transcription-polymerase chain reaction (RT-PCR) assay proved that CarACT1 transcripts were ubiquitously accumulated in all major organs, such as seedling roots, stems, leaves, flowers, young pods, and seeds, as well as in diverse developmental stages, such as leaf senescence, seed development and germination. Our results suggested that CarACT1 is an actin gene with physiological functions and may be served as a potential reference gene for transcription level of interesting genes in chickpea.

  12. Magnetic hyperfine field in Tb Zn compound measured by PAC spectroscopy using {sup 111}Cd and {sup 140}Ce

    Energy Technology Data Exchange (ETDEWEB)

    Bosch-Santos, B.; Cabrera-Pasca, G.A.; Carbonari, A.W.; Costa, M.S.; Saxena, R.N., E-mail: brianna@usp.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    The ferromagnetic compound Tb Zn has been investigated by perturbed {gamma}-{gamma} angular correlation (PAC) spectroscopy using {sup 111}In{yields}{sup 111}Cd (t{sub 1/2} = 85 ns) and {sup 140}La{yields}{sup 140}Ce (t{sub 1/2} = 3,4 ns) as probe nuclei. Measurements were carried out in the temperature range of 10 - 295K for the {sup 111}Cd probe and below Curie temperature (T{sub C}) for the {sup 140}Ce probe. The study of magnetic properties of rare earth (R) and zinc compounds of the type RZn is interesting because Zn ion is a closed shell atom and the rare earth elements present a localized magnetism associated with 4f electrons, which do not participate in chemical bonds. Therefore, the magnetic properties of these compounds are only originated from the 4f electrons of rare earth. Furthermore, the compounds exhibit the highly symmetric cubic structure of the CsCl prototype and have a Curie temperature of TbZn is T{sub C} {approx} 204 K. (author)

  13. The status of podiatry in the United Kingdom.

    Science.gov (United States)

    Mandy, Phil

    2008-12-01

    This paper reviews the sources of professional status and analyses these in relation to the podiatry profession in the United Kingdom. It is argued that the nature and act of professional practice and the patient/professional relationship are of particular importance in defining the status of the profession. These effects are discussed in relation to podiatry and compared to a high status professional group, that of dentistry. Finally the effects of attempting to change professional status are discussed.

  14. BRAF V600E mutational status in bile duct adenomas and hamartomas.

    Science.gov (United States)

    Pujals, Anaïs; Bioulac-Sage, Paulette; Castain, Claire; Charpy, Cécile; Zafrani, Elie Serge; Calderaro, Julien

    2015-10-01

    Bile duct adenomas (BDA) and bile duct hamartomas (BDH) are benign bile duct lesions considered neoplastic or secondary to ductal plate malformation, respectively. We have reported previously a high prevalence of BRAF V600E mutations detected by allele-specific polymerase chain reaction assay in BDA, and suggested that BDA may be precursors to a subset of intrahepatic cholangiocarcinomas harbouring V600E mutations. The aim of the present study was to assess the existence of BRAF V600E mutations, using immunohistochemical methods, in additional BDA as well as in BDH. Fifteen BDA and 35 BDH were retrieved from the archives of the pathology departments of two French university hospitals. All cases were reviewed by two pathologists specialized in liver diseases. BRAF V600E mutational status was investigated by immunohistochemistry. Mutated BRAF mutant protein was detected in 53% of the BDA and in none of the cases of BDH. Our findings suggest that BDA and BDH are different processes, and that BDA represent true benign neoplasms. They also support the hypothesis that mutated BDA might precede the development of the subset of intrahepatic cholangiocarcinomas harbouring BRAF V600E mutations. © 2015 John Wiley & Sons Ltd.

  15. A Phenotypic Screen for Functional Mutants of Human Adenosine Deaminase Acting on RNA 1.

    Science.gov (United States)

    Wang, Yuru; Havel, Jocelyn; Beal, Peter A

    2015-11-20

    Adenosine deaminases acting on RNA (ADARs) are RNA-editing enzymes responsible for the conversion of adenosine to inosine at specific locations in cellular RNAs. ADAR1 and ADAR2 are two members of the family that have been shown to be catalytically active. Earlier, we reported a phenotypic screen for the study of human ADAR2 using budding yeast S. cerevisiae as the host system. While this screen has been successfully applied to the study of ADAR2, it failed with ADAR1. Here, we report a new reporter that uses a novel editing substrate and is suitable for the study of ADAR1. We screened plasmid libraries with randomized codons for two important residues in human ADAR1 (G1007 and E1008). The screening results combined with in vitro deamination assays led to the identification of mutants that are more active than the wild type protein. Furthermore, a screen of the ADAR1 E1008X library with a reporter construct bearing an A•G mismatch at the editing site suggests one role for the residue at position 1008 is to sense the identity of the base pairing partner for the editing site adenosine. This work has provided a starting point for future in vitro evolution studies of ADAR1 and led to new insight into ADAR's editing site selectivity.

  16. Comparison Review of Short-Acting and Long-Acting Glucagon-like Peptide-1 Receptor Agonists.

    Science.gov (United States)

    Uccellatore, Annachiara; Genovese, Stefano; Dicembrini, Ilaria; Mannucci, Edoardo; Ceriello, Antonio

    2015-09-01

    Glucagon-like peptide-1 (GLP-1) receptor agonists (GLP-1 RAs) are useful tools for treating type 2 diabetes mellitus. In their recent position statement, the American Diabetes Association and European Association for the Study of Diabetes recommend GLP1-RAs as add-on to metformin when therapeutic goals are not achieved with monotherapy, particularly for patients who wish to avoid weight gain or hypoglycemia. GLP1-RAs differ substantially in their duration of action, frequency of administration and clinical profile. Members of this class approved for clinical use include exenatide twice-daily, exenatide once-weekly, liraglutide and lixisenatide once-daily. Recently, two new once-weekly GLP1-RAs have been approved: dulaglutide and albiglutide. This article summarizes properties of short- and long-acting GLP-1 analogs, and provides useful information to help choose the most appropriate compound for individual patients.

  17. -5p and -3p strands of miR-145 and miR-140 during mesenchymal stem cell chondrogenic differentiation.

    Science.gov (United States)

    Kenyon, Jonathan D; Sergeeva, Olga; Somoza, Rodrigo A; Li, Ming; Caplan, Arnold I; Khalil, Ahmad M; Lee, Zhenghong

    2018-04-20

    The chondrogenic differentiation of mesenchymal stem cells (MSCs) is mediated by transcription factors and small non-coding RNAs such as micro-RNAs (miRNAs). Each miRNA is initially transcribed as a long transcript, which matures to produce -5p and -3p strands. It is widely believed that the mature and functional miRNA from any given pre-miRNA, usually the -5p strand, is functional, while the opposing -3p strand is degraded. However, recent cartilage literature started to show functional -3p stands for a few miRNAs. This study aimed at examining both -5p and -3p strands of two key miRNAs miR-140 and miR-145 that are known to be involved in the chondrogenic differentiation of MSCs. The level (copy number) of both -5p and -3p strands of miR-145 and miR-140 along the timeline of MSC chondrogenic differentiation was determined by PCR. The gene expression profiles of several genes related to MSC chondrogenesis were compared with these miRNA profiles along the same timeline. While miR-145-3p is declining in step with miR-145-5p in pellet cultures during the process, the -3p strand is only 1% - 2% of the total miR-145 products. In contrast, the mature -3p and -5p products of miR-140 are found to increase with near equal molar expression throughout chondrogenic differentiation. Numerous genes are expressed by cartilage progenitor cells during development. One such target gene, Sox9 is a regulatory target of the dominant miR-145-5p, consistent with the data. Further experimental validations are warranted to confirm that ACAN, FOXO1 and RUNX3 as direct targets of miR-145-5p in the context of MSC chondrogenesis. Similarly, TRSP1 and ACAN are worth further validation as direct targets of miR-145-3p. For miR-140, SOX4 shall be further validated as a direct target of miR-140-5p while KLF4, PTHLH, and WNT5A can be validated as direct targets of miR-140-3p.

  18. Structure of a yeast 40S-eIF1-eIF1A-eIF3-eIF3j initiation complex.

    Science.gov (United States)

    Aylett, Christopher H S; Boehringer, Daniel; Erzberger, Jan P; Schaefer, Tanja; Ban, Nenad

    2015-03-01

    Eukaryotic translation initiation requires cooperative assembly of a large protein complex at the 40S ribosomal subunit. We have resolved a budding yeast initiation complex by cryo-EM, allowing placement of prior structures of eIF1, eIF1A, eIF3a, eIF3b and eIF3c. Our structure highlights differences in initiation-complex binding to the ribosome compared to that of mammalian eIF3, demonstrates a direct contact between eIF3j and eIF1A and reveals the network of interactions between eIF3 subunits.

  19. Association of nutritional status and functional capacity in gastrointestinal cancer patients.

    Science.gov (United States)

    Pérez-Cruz, Elizabeth; Camacho-Limas, Christian Patricio

    To determine the nutritional status and its association with functional capacity in patients with digestive tract cancer. We retrospectively studied all adult patients hospitalized who were diagnosed as having a cancer of the digestive tract. Nutritional status and functional capacity were assessed. Descriptive statistic and odds ratio were used to determine the association in SPSS 14.0. 57 patients were included, 96% had weight loss. Using subjective global assessment (SGA) as a method of screening, 82.5% of the patients were found malnutrition and by biochemical and immunological test 82% and 65% respectively. Functional capacity was assessed by Karnofsky index, finding that 75.5% of the patients have some activity limitation. Results show an association between malnutrition by SGA and limitation in functional capacity (c2 = 1.56; p = 0.212; OR: 2.46; 95% confidence interval [95% CI]: 0.581-10.465). In addition, we observe an association between the total lymphocyte count and limitation in functional capacity (χ2 = 6.94; p = 0.008; OR: 5.23; 95% CI: 1.441-19.025). Malnutrition in patients with digestive tract cancer was associated with limitation in functional capacity. Copyright: © 2017 SecretarÍa de Salud

  20. 7 CFR 915.140 - Avocados not subject to regulation.

    Science.gov (United States)

    2010-01-01

    ... 915.140 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE AVOCADOS..., and that the residue from the seed separation process will not be allowed to enter fresh channels of...

  1. 31 CFR 103.140 - Anti-money laundering programs for dealers in precious metals, precious stones, or jewels.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Anti-money laundering programs for... FOREIGN TRANSACTIONS Anti-Money Laundering Programs Anti-Money Laundering Programs § 103.140 Anti-money...) Anti-money laundering program requirement. (1) Each dealer shall develop and implement a written anti...

  2. A new method for the determination of unknown neutron fluence for 14.0 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Malik, Fariha [Physics Reasearch Division, PINSTECH, Nilore, Islamabad (Pakistan)]. E-mail: fariha@pinstech.org.pk; Khan, Ehsan U. [Department of Physics, CIIT, Islamabad (Pakistan); Qureshi, Imtinan [Physics Reasearch Division, PINSTECH, Nilore, Islamabad (Pakistan); Husaini, Syed N. [Physics Reasearch Division, PINSTECH, Nilore, Islamabad (Pakistan); Ahmad, Waqar [Physics Reasearch Division, PINSTECH, Nilore, Islamabad (Pakistan); Rajput, Usman [Physics Reasearch Division, PINSTECH, Nilore, Islamabad (Pakistan); Raza, Qaiser [Applied Physics Division, PINSTECH, Nilore, Islamabad (Pakistan)

    2006-11-15

    Measuring the correct neutron fluence in various energy intervals in and around the neutron sources is important for the purpose of personnel and environmental neutron dosimetry. In this paper, we present a new method for the measurement of the fluence of mono-energetic neutrons having the energy of 14.0 MeV. The samples exposed to neutrons from the 14.0 MeV neutron generator at PINSTECH with various fluence values ranging from 10{sup 7} to 10{sup 10} n cm{sup -2} were etched for 10 min in 6 N NaOH at 70.0{+-}1.0 {sup o}C and the transmittance of UV radiation was measured using a spectrophotometer. This procedure was repeated 20 times after etching the same sample each time for increasing time intervals till the stage when transmittance reached the constant minimum value. An exponential decay of the transmittance has been observed with respect to the increasing etching time interval in each of the samples exposed to various neutron fluence. Further, it has also been observed that there is a linear relationship between the transmittance decay constant and neutron fluence. Hence, the linear graph can be used as a calibration for measuring the unknown fluence of 14.0 MeV neutrons.

  3. 16 CFR 424.1 - Unfair or deceptive acts or practices.

    Science.gov (United States)

    2010-01-01

    ... ADVERTISING AND MARKETING PRACTICES § 424.1 Unfair or deceptive acts or practices. In connection with the sale... advertisement, if those stores do not have the advertised products in stock and readily available to customers...

  4. Maturação da maçã 'Gala' com a aplicação pré-colheita de aminoetoxivinilglicina e ethephon Maturation of the 'Gala' apple with preharvest sprays of aminoethoxyvynilglycine and ethephon

    Directory of Open Access Journals (Sweden)

    Cristiano André Steffens

    2006-04-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da aplicação pré-colheita de aminoetoxivinilglicina (AVG e ethephon sobre a maturação da maçã 'Gala' colhidas em diferentes datas. Os tratamentos avaliados foram: controle, ethephon (140g ha-1, AVG (125g ha-1, AVG (125g ha-1 + ethephon (140g ha-1, AVG (95g ha-1 e AVG (95g ha-1 + ethephon (140g ha-1 em combinação com quatro épocas de colheita (131, 138, 145 e 152 dias após o pleno florescimento. A aplicação pré-colheita de AVG, seguida ou não de ethephon, proporcionou frutos com maior firmeza de polpa, cor de fundo da epiderme mais verde e menor produção de etileno, respiração e índice iodo-amido. Entretanto, o AVG retardou a evolução da cor vermelha dos frutos, principalmente na maior dose. A aplicação de ethephon, em plantas anteriormente tratadas com AVG, proporcionou frutos com cor vermelha semelhante ao tratamento controle sem prejudicar a ação do AVG no controle da maturação dos frutos. O atraso na colheita causou amarelecimento da epiderme, índice iodo-amido mais elevado, alta produção de etileno e menor acidez titulável.The objective of this work was to evaluate the effects of preharvest applications of aminoethoxyvinylglycine (AVG and ethephon on the maturation of the 'Gala' apple harvested on differents dates. The treatments were: control, ethephon (140g ha-1, AVG (125g ha-1, AVG (125g ha-1 + ethephon (140g ha-1, AVG (95g ha-1 and AVG (95g ha-1 + ethephon (140g ha-1. These treatments were combined with 4 harvest date (131, 138, 145 and 152 days after full bloom. The application of AVG, combined or not with ethephon, maintained higher flesh firmness, greener peel color, lower starch index, ethylene and CO2 production. However, AVG retarded the development of the red color of the fruit. The application of ethephon in AVG-treated plants increased the red color of the fruit that was similar to control fruit without influencing effect of AVG on the control of

  5. Probabilistic safety goals. Phase 1 - Status and experiences in Sweden and Finland

    International Nuclear Information System (INIS)

    Holmberg, J.E.; Knochenhauer, M.

    2007-03-01

    The outcome of a probabilistic safety assessment (PSA) for a nuclear power plant is a combination of qualitative and quantitative results. Quantitative results are typically presented as the Core Damage Frequency (CDF) and as the frequency of an unacceptable radioactive release. In order to judge the acceptability of PSA results, criteria for the interpretation of results and the assessment of their acceptability need to be defined. Ultimately, the goals are intended to define an acceptable level of risk from the operation of a nuclear facility. However, safety goals usually have a dual function, i.e., they define an acceptable safety level, but they also have a wider and more general use as decision criteria. The exact levels of the safety goals differ between organisations and between different countries. There are also differences in the definition of the safety goal, and in the formal status of the goals, i.e., whether they are mandatory or not. In this first phase of the project, the aim has been on providing a clear description of the issue of probabilistic safety goals for nuclear power plants, to define and describe important concepts related to the definition and application of safety goals, and to describe experiences in Finland and Sweden. Based on a series of interviews and on literature reviews as well as on a limited international over-view, the project has described the history and current status of safety goals in Sweden and Finland, and elaborated on a number of issues, including the following: 1) The status of the safety goals in view of the fact that they have been exceeded for much of the time they have been in use, as well as the possible implications of these exceedances. 2) Safety goals as informal or mandatory limits. 3) Strategies for handling violations of safety goals, including various graded approaches, such as ALARP (As Low As Reasonably Practicable). 4) Relation between safety goals defined on different levels, e.g., for core damage

  6. Probabilistic safety goals. Phase 1 - Status and experiences in Sweden and Finland

    Energy Technology Data Exchange (ETDEWEB)

    Holmberg, J.E. [VTT (Finland); Knochenhauer, M. [Relcon Scandpower AB (Sweden)

    2007-03-15

    The outcome of a probabilistic safety assessment (PSA) for a nuclear power plant is a combination of qualitative and quantitative results. Quantitative results are typically presented as the Core Damage Frequency (CDF) and as the frequency of an unacceptable radioactive release. In order to judge the acceptability of PSA results, criteria for the interpretation of results and the assessment of their acceptability need to be defined. Ultimately, the goals are intended to define an acceptable level of risk from the operation of a nuclear facility. However, safety goals usually have a dual function, i.e., they define an acceptable safety level, but they also have a wider and more general use as decision criteria. The exact levels of the safety goals differ between organisations and between different countries. There are also differences in the definition of the safety goal, and in the formal status of the goals, i.e., whether they are mandatory or not. In this first phase of the project, the aim has been on providing a clear description of the issue of probabilistic safety goals for nuclear power plants, to define and describe important concepts related to the definition and application of safety goals, and to describe experiences in Finland and Sweden. Based on a series of interviews and on literature reviews as well as on a limited international over-view, the project has described the history and current status of safety goals in Sweden and Finland, and elaborated on a number of issues, including the following: 1) The status of the safety goals in view of the fact that they have been exceeded for much of the time they have been in use, as well as the possible implications of these exceedances. 2) Safety goals as informal or mandatory limits. 3) Strategies for handling violations of safety goals, including various graded approaches, such as ALARP (As Low As Reasonably Practicable). 4) Relation between safety goals defined on different levels, e.g., for core damage

  7. Shape coexistence in 140Sm and the onset of deformation below N=82 from lifetime measurements

    Science.gov (United States)

    Cardona, M. A.; Lunardi, S.; Bazzacco, D.; de Angelis, G.; Roca, V.

    1991-08-01

    Different deformations for the two bands built above the (πh11/2)2 10+ and the (νh11/2)-2 10+ states in 140Sm have been determined from lifetime measurements using the reaction 106Pd(37Cl,p2n)140Sm at 143 MeV. The β values derived for the N=78 and N=80 core nuclei, coexisting in 140Sm, complete the systematics of nuclear deformation from N=72 to 80.

  8. Insatisfação com a imagem corporal e relação com estado nutricional, adiposidade corporal e sintomas de anorexia e bulimia em adolescentes Body image dissatisfaction and its relationship with nutritional status, body fat, and anorexia and bulimia symptoms in adolescents

    Directory of Open Access Journals (Sweden)

    Cilene Rebolho Martins

    2010-01-01

    Full Text Available Objetivos: Identificar a prevalência de insatisfação com a imagem corporal e de sintomas de anorexia e bulimia em adolescentes do sexo feminino da cidade de Santa Maria (RS e verificar a associação da insatisfação com a imagem corporal com estado nutricional, adiposidade corporal e sintomas de anorexia e bulimia. Método: Foram analisadas 258 adolescentes do sexo feminino (11 a 13 anos, estudantes de escolas públicas. Aplicou-se o Body Shape Questionnaire e o Teste de Atitudes Alimentares (EAT-26. Foram calculados o índice de massa corporal e o percentual de gordura. Foram utilizados o teste qui-quadrado e a regressão logística. Resultados: A prevalência de insatisfação com a imagem corporal foi de 25,3% e a de sintomas de anorexia e bulimia foi de 27,6%. A insatisfação com a imagem corporal apresentou associação com o estado nutricional, sendo que as adolescentes com excesso de peso apresentaram maior insatisfação (razão de chances = 2,64; IC95%= 1,02-6,83. Conclusão: As prevalências de insatisfação corporal e sintomas de anorexia e bulimia foram elevadas. O estado nutricional parece ser o melhor preditor da insatisfação corporal.Objectives: To identify the prevalence of body image dissatisfaction and anorexia and bulimia symptoms in adolescent girls from the city of Santa Maria, Brazil, and to determine the association of body image dissatisfaction with nutritional status, body fat, and anorexia and bulimia symptoms. Method: We investigated 258 adolescent girls (11 to 13 years from public schools. The Body Shape Questionnaire and the Eating Attitudes Test (EAT-26 were used. Body mass index and percent body fat were calculated. The chi-square test and logistic regression were used. Results: The prevalence of body image dissatisfaction was 25.3% and the prevalence of anorexia and bulimia symptoms was 27.6%. Body image dissatisfaction was associated with nutritional status, with overweight girls presenting higher

  9. The corrosion resistance of 140MXC, 530AS and 560AS coatings produced by thermal spraying

    Directory of Open Access Journals (Sweden)

    Edwin Alexis López Covaleda

    2013-01-01

    Full Text Available Three commercial materials were deposited using electric arc thermal spraying: 140MXC (with Fe, W, Cr, Nb, 530AS (AISI 1015 steel and 560AS (AISI 420 steel on AISI 4340 steel. The aim of this paper was to evaluate the best strategy for improving a coating-substrate system’s corrosion resistance, using the following combinations: homogeneous single coatings, bilayers consisting of 530AS or 560AS under 140MXC and 140MXC + 530AS and 140MXC + 560AS coatings deposited simultaneously. The coatings were characterised using optical microscopy, scanning electron microscopy and X-ray diffraction. Corrosion resistance was evaluated through potentiodynamic polarisation and hardness by using the Vickers test. Corrosion resistance depends on the amount of microstructure defects, the deposition strategy and the alloy elements. However, corrosion resistance was similar in single coatings of 140MXC and bilayers, having -630 V corrosion potential and 708 nA corrosion current. The details and corrosion mechanism of the coatings so produced are described in this paper.

  10. Modification of oxidative status in Plasmodium berghei-infected erythrocytes by E-2-chloro-8-methyl-3-[(4'-methoxy-1'-indanoyl-2'-methyliden]-quinoline compared to chloroquine

    Directory of Open Access Journals (Sweden)

    Juan Rodrigues

    2009-09-01

    Full Text Available E-2-chloro-8-methyl-3-[(4'-methoxy-1'-indanoyl-2'-methyliden]-quinoline (IQ is a new quinoline derivative which has been reported as a haemoglobin degradation and ß-haematin formation inhibitor. The haemoglobin proteolysis induced by Plasmodium parasites represents a source of amino acids and haeme, leading to oxidative stress in infected cells. In this paper, we evaluated oxidative status in Plasmodium berghei-infected erythrocytes in the presence of IQ using chloroquine (CQ as a control. After haemolysis, superoxide dismutase (SOD, catalase, glutathione cycle and NADPH + H+-dependent dehydrogenase enzyme activities were investigated. Lipid peroxidation was also assayed to evaluate lipid damage. The results showed that the overall activities of glucose-6-phosphate dehydrogenase and 6-phosphogluconate dehydrogenase were significantly diminished by IQ (by 53.5% and 100%, respectively. Glutathione peroxidase activity was also lowered (31% in conjunction with a higher GSSG/GSH ratio. As a compensatory response, overall SOD activity increased and lipid peroxidation decreased, protecting the cells from the haemolysis caused by the infection. CQ shared most of the effects showed by IQ; however it was able to inhibit the activity of isocitrate dehydrogenase and glutathione-S-transferase. In conclusion, IQ could be a candidate for further studies in malaria research interfering with the oxidative status in Plasmodium berghei infection.

  11. 77 FR 23173 - Privacy Act of 1974: Implementation

    Science.gov (United States)

    2012-04-18

    ... a significant economic impact on a substantial number of small entities. Paperwork Reduction Act The... governments, and the private sector. UMRA requires a written statement of economic and regulatory alternatives... subsections (c)(3); (d)(1), (2), (3) and (4); and (e)(1): (1) Air Intelligence Program (Justice/DEA-001) (2...

  12. Measurement of Angular Coefficients of Drell-Yan $e^+e^-$ pairs in $p \\bar{p}$ Collisions at $\\sqrt{s}$ = 1.96 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Bhatia, Sudeep Singh [Mississippi U.

    2013-01-01

    In this thesis we present the status of the measurement of angular distributions of final state electrons in $p \\bar{p} \\to \\gamma^* Z \\to e^+ e^- + X$ events produced in the Z boson mass region at $\\sqrt{s}$ = 1.96 TeV at the Tevatron. For this analysis, we are using the full Run II dataset corresponding to 9.7$\\,fb^{-1}$ of integrated luminosity collected with the D0 detector. The angular distributions as a function of the transverse momentum of the electron-positron pair are studied, and the Lam-Tung relation, valid only for a spin-1 description of the gluon is investigated. The final result will also describe the details of the production mechanism of Z bosons via quark anti-quark annihilation or quark-gluon Compton scattering.

  13. 78 FR 67201 - Sunshine Act Meeting

    Science.gov (United States)

    2013-11-08

    ... LEGAL SERVICES CORPORATION Sunshine Act Meeting DATE AND TIME: The Legal Services Corporation's... disrupting the meeting, please refrain from placing the call on hold if doing so will trigger recorded music or other sound. From time to time, the presiding Chair may solicit comments from the public. STATUS...

  14. 78 FR 39781 - Sunshine Act Meeting

    Science.gov (United States)

    2013-07-02

    ... LEGAL SERVICES CORPORATION Sunshine Act Meeting Notice Date and Time: The Legal Services... disrupting the meeting, please refrain from placing the call on hold if doing so will trigger recorded music or other sound. From time to time, the Chair may solicit comments from the public. Status of Meeting...

  15. 78 FR 33114 - Sunshine Act Meetings

    Science.gov (United States)

    2013-06-03

    ... LEGAL SERVICES CORPORATION Sunshine Act Meetings ACTION: Notice. Date And Time: The Legal Services... meeting, please refrain from placing the call on hold if doing so will trigger recorded music or other sound. From time to time, the Chair may solicit comments from the public. Status Of Meeting: Open...

  16. 78 FR 72929 - Sunshine Act Meeting

    Science.gov (United States)

    2013-12-04

    ... DEPARTMENT OF JUSTICE Parole Commission Sunshine Act Meeting TIME AND DATE: 12:00 p.m., Tuesday, December 10, 2013. PLACE: U.S. Parole Commission, 90 K Street NE., 3rd Floor, Washington, DC. STATUS: Closed. MATTERS TO BE CONSIDERED: Determination on four original jurisdiction cases. CONTACT PERSON FOR...

  17. 26 CFR 1.338-1 - General principles; status of old target and new target.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false General principles; status of old target and new target. 1.338-1 Section 1.338-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY... of old target and new target. (a) In general—(1) Deemed transaction. Elections are available under...

  18. Relationship between somatosensory event-related potential N140 aberrations and hemispatial agnosia in patients with stroke: a preliminary study.

    Science.gov (United States)

    Ueno, Tomoyuki; Hada, Yasushi; Shimizu, Yukiyo; Yamada, Thoru

    2018-06-01

    The somatosensory event-related potential N140 is thought to be related to selective attention. This study aimed to compare the somatosensory event-related potential N140 in healthy subjects to that in patients with stroke to determine whether N140 and attentiveness are associated in patients with stroke with or without hemispatial agnosia. Normal somatosensory event-related potential N140 values were determined using data from ten healthy subjects. Fifteen patients with stroke were divided into two groups based on the presence of hemispatial neglect. Somatosensory event-related potential N140 components were compared between the two groups. Stimulation of the affected limb in the hemispatial agnosia group resulted in significantly longer N140 latency at the contralateral vs. the ipsilateral electrode. This was the inverse of the relationship observed in normal subjects, with stimulation of the intact side in patients with hemispatial agnosia, and with stimulation of both the intact and affected sides in patients without agnosia. In the hemispatial agnosia group, the peak latency of N140 following stimulation of the affected side was significantly longer than it was following stimulation of the intact side and when compared to that in patients without agnosia. In addition, abnormal N140 peak latencies were observed at the Cz and ipsilateral electrodes in patients with hemispatial agnosia following stimulation of the intact side. These findings suggest that somatosensory event-related potential N140 is independently generated in each hemisphere and may reflect cognitive attention.

  19. The HIV1 protein Vpr acts to enhance constitutive DCAF1-dependent UNG2 turnover.

    Directory of Open Access Journals (Sweden)

    Xiaoyun Wen

    Full Text Available The HIV1 protein Vpr assembles with and acts through an ubiquitin ligase complex that includes DDB1 and cullin 4 (CRL4 to cause G2 cell cycle arrest and to promote degradation of both uracil DNA glycosylase 2 (UNG2 and single-strand selective mono-functional uracil DNA glycosylase 1 (SMUG1. DCAF1, an adaptor protein, is required for Vpr-mediated G2 arrest through the ubiquitin ligase complex. In work described here, we used UNG2 as a model substrate to study how Vpr acts through the ubiquitin ligase complex. We examined whether DCAF1 is essential for Vpr-mediated degradation of UNG2 and SMUG1. We further investigated whether Vpr is required for recruiting substrates to the ubiquitin ligase or acts to enhance its function and whether this parallels Vpr-mediated G2 arrest.We found that DCAF1 plays an important role in Vpr-independent UNG2 and SMUG1 depletion. UNG2 assembled with the ubiquitin ligase complex in the absence of Vpr, but Vpr enhanced this interaction. Further, Vpr-mediated enhancement of UNG2 degradation correlated with low Vpr expression levels. Vpr concentrations exceeding a threshold blocked UNG2 depletion and enhanced its accumulation in the cell nucleus. A similar dose-dependent trend was seen for Vpr-mediated cell cycle arrest.This work identifies UNG2 and SMUG1 as novel targets for CRL4(DCAF1-mediated degradation. It further shows that Vpr enhances rather than enables the interaction between UNG2 and the ubiquitin ligase. Vpr augments CRL4(DCAF1-mediated UNG2 degradation at low concentrations but antagonizes it at high concentrations, allowing nuclear accumulation of UNG2. Further, the protein that is targeted to cause G2 arrest behaves much like UNG2. Our findings provide the basis for determining whether the CRL4(DCAF1 complex is alone responsible for cell cycle-dependent UNG2 turnover and will also aid in establishing conditions necessary for the identification of additional targets of Vpr-enhanced degradation.

  20. Obesidade e sobrepeso em adolescentes: relação com atividade física, aptidão física, maturação biológica e "status" socioeconômico Obesity and overweight in adolescents: relationship among physical activity, physical fitness, biological maturity and socioeconomic status

    Directory of Open Access Journals (Sweden)

    Cláudia Figueiredo

    2011-06-01

    Full Text Available Este estudo relaciona atividade física (AF, aptidão física (AptF, maturação biológica e "status" socioe-conômico (ESE com as prevalências de risco ponderal de adolescentes. Foi desenvolvido no Concelho de Santo Tirso, região norte de Portugal e amostrou 961 alunos (463 meninos e 498 meninas com idades variando entre os 11 e os 18 anos. O índice de massa corporal foi utilizado para estabelecer o "status" ponderal com base nos pontos de corte propostos por COLE et al. A AF foi avaliada através do questionário de Baecke e a AptF com quatro testes da bateria Fitnessgram. O ESE foi estimado a partir do acesso aos escalões atribuídos pela Ação Social Escolar e a maturação biológica a partir do "offset" maturacional. A análise estatística foi efetuada nos "softwares" Pepi versão 4.0 e SPSS 18.0. O nível de significância foi mantido em 5%. Seis por cento dos alunos eram obesos e 19,5% tinham sobrepeso; meninos e meninas têm prevalências semelhantes de sobrepeso e obesidade. Os níveis médios de AF foram baixos a moderados independentemente do sexo ou "status" ponderal. Os meninos eram mais ativos que as meninas (p The aim of this study was to relate physical activity, physical fitness, maturation and socioeconomic status with the prevalence of ponderal risk in adolescents. This was a transversal study made in the Council of Santo Tirso in the north of Portugal. The sample consisted of 961students (463 boys and 498 girls, aged 11 to 18. Body mass index was used to establish ponderal status based on the cut points from COLE et al. Physical activity was evaluated by Baecke's questionnaire and physical fitness with four tests from Fitnessgram battery. Socioeconomic status was ranked according to the grades assigned by state school subsidies, while biological maturation estimation was based on maturational offset. Software programs Pepi version 4.0 and SPSS 18.0 were used for statistical analysis. The level of significance was kept

Some links on this page may take you to non-federal websites. Their policies may differ from this site.