Results from an Interval Management (IM) Flight Test and Its Potential Benefit to Air Traffic Management Operations

Science.gov (United States)

Baxley, Brian; Swieringa, Kurt; Berckefeldt, Rick; Boyle, Dan

2017-01-01

NASA's first Air Traffic Management Technology Demonstration (ATD-1) subproject successfully completed a 19-day flight test of an Interval Management (IM) avionics prototype. The prototype was built based on IM standards, integrated into two test aircraft, and then flown in real-world conditions to determine if the goals of improving aircraft efficiency and airport throughput during high-density arrival operations could be met. The ATD-1 concept of operation integrates advanced arrival scheduling, controller decision support tools, and the IM avionics to enable multiple time-based arrival streams into a high-density terminal airspace. IM contributes by calculating airspeeds that enable an aircraft to achieve a spacing interval behind the preceding aircraft. The IM avionics uses its data (route of flight, position, etc.) and Automatic Dependent Surveillance-Broadcast (ADS-B) state data from the Target aircraft to calculate this airspeed. The flight test demonstrated that the IM avionics prototype met the spacing accuracy design goal for three of the four IM operation types tested. The primary issue requiring attention for future IM work is the high rate of IM speed commands and speed reversals. In total, during this flight test, the IM avionics prototype showed significant promise in contributing to the goals of improving aircraft efficiency and airport throughput.

Induction of T helper 1 response by immunization of BALB/c mice with the gene encoding the second subunit of Echinococcus granulosus antigen B (EgAgB8/2

Directory of Open Access Journals (Sweden)

Boutennoune H.

2012-05-01

Full Text Available A pre-designed plasmid containing the gene encoding the second subunit of Echinococcus granulosus AgB8 (EgAgB8/2 was used to study the effect of the immunization route on the immune response in BALB/c mice. Mice were immunized with pDRIVEEgAgB8/ 2 or pDRIVE empty cassette using the intramuscular (i.m., intranasal (i.n. or the epidermal gene gun (g.g. routes. Analysis of the antibody response and cytokine data revealed that gene immunization by the i.m. route induced a marked bias towards a T helper type 1 (Th1 immune response as characterized by high IFN-γ gene expression and a low IgG1/IgG2a reactivity index (R.I. ratio of 0.04. The i.n. route showed a moderate IFN-γ expression but a higher IgG1/IgG2a R.I. ratio of 0.25 indicating a moderate Th1 response. In contrast, epidermal g.g. immunization induced a Th2 response characterized by high IL-4 expression and the highest IgG1/IgG2a R.I. ratio of 0.58. In conclusion, this study showed the advantage of genetic immunization using the i.m. route and i.n. over the epidermal g.g. routes in the induction of Th1 immunity in response to E. granulosus AgB gene immunization.

Quick scan IMS vendors

NARCIS (Netherlands)

Norp, A.H.J.; Pals, H.; Walraven, F.A.

2007-01-01

IMS is gaining momentum in the market. First operators are deploying IMS, while other operators are considering buying IMS. Operators have two approaches for introducing IMS and building an IMS eco-system: • Buying IMS from a large vendor or system integrator. Vendors like Alcatel-Lucent, Ericsson

IMS Application Developer's Handbook Creating and Deploying Innovative IMS Applications

CERN Document Server

Noldus, Rogier; Mulligan, Catherine; Fikouras, Ioannis; Ryde, Anders; Stille, Mats

2011-01-01

IMS Application Developer Handbook will give a hands-on view of exactly what needs to be done by IMS application developers to write an application and take it "live" on an operator's network. It will offer practical guidance on building innovative applications using the features and capabilities of the IMS network, show how the rapidly changing development environment is impacting on the business models employed in the industry and how existing network solutions can be moved towards IMS. The book will also elaborate on how IMS applies basic VoIP principles and techniques to realise a true mul

I'm a Map, I'm a Green Tree

Science.gov (United States)

Anderson, Daniel

2010-01-01

I'm talking about the ways we represent ourselves and our world. I've put some thoughts on the topic together here--a gathering that enacts new media creating and takes up conceptual layers like metaphors, models, and composing. The primary sources are videos from the Get a Mac campaign, aka I'm a Mac; I'm a PC ads. Posthuman concepts blending…

Wozu und wie kooperative Arbeitsformen im studienbegleitenden Deutschunterricht?

Directory of Open Access Journals (Sweden)

Karmelka Barić

2016-04-01

Full Text Available Ausgehend von einer Reflexion über die im Beruf und im Leben notwendigen Kompetenzen in der Kommunikation sowie von der Überzeugung, dass es notwendig ist, diese Kompetenzen schon im Studium durch geeignete Arbeitsverfahren und Themen zu entwickeln, werden Kooperation und Autonomie fördernde Arbeitsformen für den studienbegleitenden Deutsch- und Fremdsprachenunterricht (SDU/SFU vorgestellt. Diese Arbeitsformen sind auf andere Sprachen übertragbar und aus dem Lehrwerk Mit Deutsch studieren arbeiten leben A2/B1 (Lévy-Hillerich, Serena, Barić & Cickovska 2010 und der dazu gehörenden Lernplattform entnommen. Das Lehrwerk selbst ist eine Umsetzung der SDU-Rahmencurricula, die im Laufe von über zwanzig Jahren in zehn Ländern im Rahmen eines 1994 am Goethe-Institut Warschau begonnenen Hochschulprojekts und der daraus entstandenen Forschungstätigkeit entstanden sind. Grundlage des Projekts ist ein ganzheitlicher soziopädagogischer Ansatz, der LernerInnen als Menschen betrachtet, die im Präsenz- oder im virtuellen Unterricht in der Sprache und durch die Sprache fach- und sprachübergreifende Kooperationsfähigkeiten entwickeln, die sich später im Leben in der Gesellschaft auswirken. Nach der Vorstellung des Projekts und seiner wissenschaftlichen Hintergründe im ersten Teil des Beitrags werden im zweiten Teil die sich aus dem Ansatz ergebenden Arbeitsformen untersucht: Dabei werden die sich dazu eignenden Themen, die Lernhilfen für StudentInnen, die den LehrerInnen zufallenden Rollen sowie die Ansprüche an Lehrbücher/Unterrichtsmaterialien und Online-/Blended-Learning-Lernszenarien besprochen. Der abschließende Überblick im dritten Teil über die Schwierigkeiten, die beim kooperativen Lernen im SDU/SFU auftreten können, ist gleichzeitig eine offenbleibende Frage danach, wie LehrerInnen aus- und fortgebildet werden sollten, um sich den Anforderungen einer sich dauernd verändernden Lernlandschaft stellen zu können.   The paper

Die Pluralbildung im Deutschen - ein Versuch im Rahmen der Optimalitätstheorie

Directory of Open Access Journals (Sweden)

Wegener, Heide

1999-01-01

Full Text Available Die Pluralbildung im Deutschen ist nicht chaotisch, aber komplex. Unabhängig davon, ob man für die Pluralbildung Regeln, Schemata oder die Wortstruktur als Erklärungsmodell benutzt, bleibt die Tatsache einer beachtlichen Zahl miteinander konkurrierender Formen zu erklären. Dies gilt schon deshalb, weil die Variation unter den Pluralformen wohl mit dazu beiträgt, dass trotz der Arbeiten von Mugdan 1977 und Köpcke 1987, 1993, der klaren Darstellung des Pluralsystems in vielen Grammatiken, z.B. Eisenberg 1986, 1989, 1998 noch immer bisweilen die Meinung besteht, die Pluralbildung im Deutschen sei arbiträr.Es soll gezeigt werden, dass das Pluralsystem des Deutschen nach Beschränkungen aufgebaut ist, die morphologischer und silbenphonologischer Natur sind und sich im Rahmen der Optimalitätstheorie (OT beschreiben lassen. Die OT nimmt an, dass Wortformen universalen Beschränkungen (Constraints unterliegen, und dass diese prinzipiell verletzbar sind. Ich werde zunächst die für die Pluralbildung relevanten Beschränkungen definieren, dann an heimischen Pluralformen und -varianten ihr Zusammenwirken zeigen und schließlich den Assimilationsprozess von Fremdwörtern mit Hilfe dieser Beschränkungen und der Beschränkungshierarchien zu erklären versuchen. Daran werden schließlich Überlegungen zu Verarbeitung und Lernbarkeit der Pluralformen geknüpft.

Simplified demultiplexing scheme for two PDM-IM/DD systems utilizing a single Stokes analyzer over 25-km SMF.

Science.gov (United States)

Pan, Yan; Yan, Lianshan; Yi, Anlin; Jiang, Lin; Pan, Wei; Luo, Bin; Zou, Xihua

2017-10-15

We propose a four-linear state of polarization multiplexed intensity modulation and direct detection (IM/DD) scheme based on two orthogonal polarization division multiplexing (PDM) on-off keying systems. We also experimentally demonstrate a simple demultiplexing algorithm for this scheme by utilizing only a single Stokes analyzer. At the rate of 4×10  Gbit/s, the experimental results show that the power penalty of the proposed scheme is about 1.5 dB, compared to the single PDM-IM/DD for back-to-back (B2B) transmission. Compared to B2B, just about 1.7 dB power penalty is required after 25 km Corning LEAF optical fiber transmission. Meanwhile, the performance of the polarization tracking is evaluated, and the results show that the BER fluctuation is less than 0.5 dB with a polarization scrambling rate up to 708.75 deg/s.

Vienkamieniai asmenvardžiai su lie. darg-: jų pamatas ir ryšiai su dvikamieniais asmenvardžiais

Directory of Open Access Journals (Sweden)

Daiva Sinkevičiūtė

2011-12-01

Full Text Available DIE EINSTÄMMIGEN NAMEN MIT LIT. darg-: IHRERE GRUNDLAGE UND VERBINDUNGEN MIT DEN ZUSAMMENGESETZTEN NAMENZusammenfassungIn diesem Aufsatz wird die Grundlage der einstämmigen Namen mit darg- und ihrere Verbindungen mit diesen Stamm habenden zusammengesetzten Namen untersucht. Die vorhandenen Daten weisen darauf hin, daß die zusammengesetzten und einstämmigen Namen mit darg- nicht nur in Litauen, sondern auch in Lettland (? und Preußen anzutreffen sind. Baltische einstämmige Namen mit darg- bestehen: 1 aus dem ersten Stamm des zusammengesetzten Namens und dem Anfang des zweiten Stammes (litauische, lettische (? und preußische Namen, 2 aus dem ersten oder zweiten Stamm des zusammengesetzten Namens (litau­ische und preußische Namen.Den Stamm darg- habende einstämmige litauische Familiennamen, die sich auf die ersten oder zwei­ten Stämme, oder den ersten Stamm und den Anfang des zweiten Stammes der zusammengesetzten Na­men beziehen lassen, herrschen in den Arealen der Nord- und Südenniederlitauer vor. Durch die struktu­relle Analyse der zusammengesetzten und einstämmigen Namen mit darg- wird festgestellt, daß diese Namen miteinander in Verbindung stehen. Die niederlitauischen einstämmigen Namen mit darg- entstan­den aus den zusammengesetzten Namen der Strukturtypen Dar-gVC-, Dar-gVCC-. Die zusammengesetzten Namen mit dem Stamm darg- konnten aus den einstämmigen hypokoristischen Formen mit darg- später entstanden. Unter Berufung auf vorhandenes Material kann man behaupten, daß die hypokoristischen For­men mit darg- den Einfluß auf das System der zusammengesetzten Namen ausübten.

Organic anion transporter 3- and organic anion transporting polypeptides 1B1- and 1B3-mediated transport of catalposide

Directory of Open Access Journals (Sweden)

Jeong HU

2015-01-01

Full Text Available Hyeon-Uk Jeong,1 Mihwa Kwon,2 Yongnam Lee,3 Ji Seok Yoo,3 Dae Hee Shin,3 Im-Sook Song,2 Hye Suk Lee1 1College of Pharmacy, The Catholic University of Korea, Bucheon 420-743, Korea; 2College of Pharmacy and Research Institute of Pharmaceutical Sciences, Kyungpook National University, Daegu 702-701, Korea; 3Central R&D Institute, Yungjin Pharm Co., Ltd., Suwon 443-270, Korea Abstract: We investigated the in vitro transport characteristics of catalposide in HEK293 cells overexpressing organic anion transporter 1 (OAT1, OAT3, organic anion transporting polypeptide 1B1 (OATP1B1, OATP1B3, organic cation transporter 1 (OCT1, OCT2, P-glycoprotein (P-gp, and breast cancer resistance protein (BCRP. The transport mechanism of catalposide was investigated in HEK293 and LLC-PK1 cells overexpressing the relevant transporters. The uptake of catalposide was 319-, 13.6-, and 9.3-fold greater in HEK293 cells overexpressing OAT3, OATP1B1, and OATP1B3 transporters, respectively, than in HEK293 control cells. The increased uptake of catalposide via the OAT3, OATP1B1, and OATP1B3 transporters was decreased to basal levels in the presence of representative inhibitors such as probenecid, furosemide, and cimetidine (for OAT3 and cyclosporin A, gemfibrozil, and rifampin (for OATP1B1 and OATP1B3. The concentration-dependent OAT3-mediated uptake of catalposide revealed the following kinetic parameters: Michaelis constant (Km =41.5 µM, maximum uptake rate (Vmax =46.2 pmol/minute, and intrinsic clearance (CLint =1.11 µL/minute. OATP1B1- and OATP1B3-mediated catalposide uptake also showed concentration dependency, with low CLint values of 0.035 and 0.034 µL/minute, respectively. However, the OCT1, OCT2, OAT1, P-gp, and BCRP transporters were apparently not involved in the uptake of catalposide into cells. In addition, catalposide inhibited the transport activities of OAT3, OATP1B1, and OATP1B3 with half-maximal inhibitory concentration values of 83, 200, and 235 µ

Organisationsprobleme im Ökomarketing

OpenAIRE

Dienel, Wolfram

2000-01-01

Organisationsprobleme im Ökomarketing - eine transaktionskostentheoretische Analyse im Absatzkanal konventioneller Lebensmittelhandel Die im Vergleich zum großen Nachfragepotential zögerliche Entwicklung des Ökomarkts in Deutschland ist auf Organisationsprobleme zurückzuführen. Die Organisationsprobleme behindern insbesondere die großskalige Ökomarkterschließung über die konventionellen Supermarktketten, erschweren aber auch die Effizienzsteigerung im kleiner strukturierten alternativen N...

IMS Learning Design: De stand van zaken

NARCIS (Netherlands)

Tattersall, Colin; Manderveld, Jocelyn

2005-01-01

Tattersall, C. & Manderveld, J. (2004) IMS Learning Design: De stand van zaken In: Gorissen, P., Manderveld, J., Benneker, F. & Cordewener, B. Leertechnologie in de Lage Landen (pp. 31-33). Utrecht, Stichting Surf. Ook beschikbaar in dspace: http://hdl.handle.net/1820/270

Characterization of developmental immature fiber (im) mutant and Texas Marker-1 (TM-1) cotton fibers by Attenuated Total Reflection Fourier Transform Infrared (ATR FT-IR) spectroscopy

Science.gov (United States)

The immature fiber (im) mutant is one type of cotton fiber mutants with unique characteristics of non-fluffy cotton bolls. Compared to its near-isogenic wild type Texas Marker-1 (TM-1), im fiber has thin secondary cell wall and is less mature. In this work, we applied the previously proposed princip...

Development of a plug-type IMS-MS instrument and its applications in resolving problems existing in in-situ detection of illicit drugs and explosives by IMS.

Science.gov (United States)

Du, Zhenxia; Sun, Tangqiang; Zhao, Jianan; Wang, Di; Zhang, Zhongxia; Yu, Wenlian

2018-07-01

Ion mobility spectrometry (IMS) which acts as a rapid analysis technique is widely used in the field detection of illicit drugs and explosives. Due to limited separation abilities of the pint-sized IMS challenges and problems still exist regarding high false positive and false negative responses due to the interference of the matrix. In addition, the gas-phase ion chemistry and special phenomena in the IMS spectra, such one substance showing two peaks, were not identified unambiguously. In order to explain or resolve these questions, in this paper, an ion mobility spectrometry was coupled to a mass spectrometry (IMS-MS). A commercial IMS is embedded in a custom-built ion chamber shell was attached to the mass spectrometer. The faraday plate of IMS was fabricated with a hole for the ions to passing through to the mass spectrometer. The ion transmission efficiency of IMS-MS was optimized by optimizing the various parameters, especially the distance between the faraday plate and the cone of mass spectrum. This design keeps the integrity of the two original instruments and the mass spectrometry still works with multimode ionization source (i.e., IMS-MS, ESI-MS, APCI-MS modes). The illicit drugs and explosive samples were analyzed by the IMS-MS with 63 Ni source. The results showed that the IMS-MS is of high sensitivity. The ionization mechanism of the illicit drug and explosive samples with 63 Ni source were systematically studied. In addition, the interferent which interfered the detection of cocaine was identified as dibutyl phthalate (DBP) by this platform. The reason why the acetone solution of amphetamine showed two peaks was explained. Copyright © 2018 Elsevier B.V. All rights reserved.

Down-conversion IM-DD RF photonic link utilizing MQW MZ modulator.

Science.gov (United States)

Xu, Longtao; Jin, Shilei; Li, Yifei

2016-04-18

We present the first down-conversion intensity modulated-direct detection (IM-DD) RF photonic link that achieves frequency down-conversion using the nonlinear optical phase modulation inside a Mach-Zehnder (MZ) modulator. The nonlinear phase modulation is very sensitive and it can enable high RF-to-IF conversion efficiency. Furthermore, the link linearity is enhanced by canceling the nonlinear distortions from the nonlinear phase modulation and the MZ interferometer. Proof-of-concept measurement was performed. The down-conversion IM-DD link demonstrated 28dB improvement in distortion levels over that of a conventional IM-DD link using a LiNbO3 MZ modulator.

Immunogenicity and safety of high-dose hepatitis B vaccine among drug users: A randomized, open-labeled, blank-controlled trial.

Science.gov (United States)

Feng, Yongliang; Shi, Jing; Gao, Linying; Yao, Tian; Feng, Dan; Luo, Dan; Li, Zhansheng; Zhang, Yawei; Wang, Fuzhen; Cui, Fuqiang; Li, Li; Liang, Xiaofeng; Wang, Suping

2017-06-03

Due to the low uptake, adherence, and completion of vaccination among drug users, and their compromised immune responses to hepatitis B vaccination, the current practice of hepatitis B vaccination may not provide optimal protection. The aim of this study was to evaluate the immunogenicity and safety of 60 µg and 20 µg hepatitis B vaccines among drug users. A randomized, open-labeled, blank-controlled trial was conducted among drug users at 2 drug rehabilitation centers in China. The eligible participants were drug users who were serologically negative for the hepatitis B surface antigen (HBsAg) and the hepatitis B surface antibody (anti-HBs). Participants were randomized in a ratio of 1:1:1 to receive 20 µg (IM20 group) or 60 µg (IM60 group) of hepatitis B vaccine or blank control at months 0, 1, and 6, and followed at months 6, 7, and 12. Seroconversion rates of 94.7% and 92.6% were observed in IM20 and IM60 groups at month 7, and correspondingly decreased to 89.5% and 91.7% respectively at month 12. The IM60 group showed significantly higher geometric mean concentrations (GMCs) of anti-HBs (2022.5 and 676.7 mIU mL-1) than the IM20 group did (909.6 and 470.5 mIU mL-1) at months 7 and 12 (P B vaccines showed good immunogenicity among the drug users.

Pragmatic awareness of Suggestions: From (Im)Polite Mannerism to Attitudinal Appropriateness

OpenAIRE

Hamid Allami; Nasim Boustani

2017-01-01

The present research seeks to determine: (a) Iranian EFL learners’ application of suggestion semantic formulae ;(b) their attitude of appropriateness in terms of confidence in the employment of appropriate supportive moves; (c), their (im)polite mannerism with respect to the selected strategies; and (d) the relationship between attitude of appropriateness and mannerism of (im)politeness. An Oxford Quick placement Test (OQPT) was administered among 60 Iranian EFL learners to check their langua...

Cyberbullying und Empathie : affektive, kognitive und medienbasierte Empathie im Kontext von Cyberbullying im Kindes- und Jugendalter

OpenAIRE

Pfetsch, Jan; Müller, Christin R.; Ittel, Angela

2014-01-01

"Bei medial vermittelter Kommunikation sinkt sowohl die Hemmschwelle für aggressive Verhaltensweisen wie Cyberbullying als auch die Wahrscheinlichkeit empathischer Reaktionen. Im Fokus der vorliegenden Studie mit 979 Schülerinnen und Schülern der 4.-8. Klassen (M=12.01, SD=1.68 Jahre, 55% weiblich) stand die Frage, ob Cyberbullies geringere Ausprägungen für affektive, kognitive und medienbasierte Empathie aufweisen als Unbeteiligte. Empathie wurde im Selbst- und Peerbericht erhoben. Hypothese...

Facebook Ethnography: The Poststructural Ontology of Transnational (Im Migration Research

Directory of Open Access Journals (Sweden)

David Joseph Piacenti PhD

2014-02-01

Full Text Available This theoretical article discusses the creative utility of Facebook as a new ethnographic tool in which to study transnational (im migration. Facebook ethnography allows the (im migration researcher to transcend the four structural dualities that constrain transnational ethnographic research: (a geographic constraints, (b travel funding constraints, (c travel time constraints, and (d the logistical constraints of entrée into new ethnographic contexts. Facebook ethnography also allows the qualitative researcher to temporarily transcend the ontological structuralist dualities of traditional research methods, producing a new poststructural epistemological and ontological methodology.

The potential impact of low dose ionizing γ-radiation on immune response activity up-regulated by Ikaros in IM-9 B lymphocytes

International Nuclear Information System (INIS)

Kim Sung Jn; Jang, Seon A; Yang, Kwang Hee; Kim, Ji Young; Kim, Cha Soon; Nam, Seon Young; Jeong, Mee Seon; Jin, Young Woo

2011-01-01

The biological effects of low dose ionizing radiation (LDIR) remain insufficiently understood. We examined for the scientific evidence to show the biological effects of LDIR using radiation-sensitive immune cells. We found that Ikaros protein was responded to low dose-dependent effects of gamma radiation in IM-9 B lymphocytes. Ikaros encodes zinc finger transcription factors that is important regulators of a hematopoietic stem cells (HSCs) progression to the B lymphoid lineage development, differentiation and proliferation. In this study, we observed that cell proliferation was enhanced from 10% to 20% by LDIR (0.05 Gy) in IM-9 B lymphocytes. The Ikaros protein was phosphorylated in its serine/threonine (S/T) region and decreased its DNA binding activity in the cells exposed to LDIR. We found that Ikaros phosphorylation was up-regulated by CK2/AKT pathway and the residues of ser-304 and ser-306 in Ikaros was phosphorylated by LDIR. We also observed that Ikaros protein was localized from the nucleus to the cytoplasm after LDIR and bound with Autotaxin (ENPP2, ATX) protein, stimulating proliferation, migration and survival of immune cells. In addition, we found that the lysoPLD activity of ATX was dependent on Ikaros-ATX binding activity. These results indicate that the Ikaros is an important regulator of immune activation. Therefore, we suggest that low dose ionizing radiation can be considered as a beneficial effects, stimulating the activation of immune cells.

Die Darstellung Rudolf Virchows in der Vossischen Zeitung im Zeitraum vom 1. Januar 1844 bis zum 31. Dezember 1865

OpenAIRE

Feddersen, Lars Harald

2010-01-01

DIE DARSTELLUNG RUDOLF VIRCHOWS IN DER VOSSISCHEN ZEITUNG IM ZEITRAUM VOM 1. JANUAR 1844 BIS ZUM 31. DEZEMBER 1865 Rudolf Virchow erforschte u.a. als Pathologe, Hygieniker, Anthropologe, Ethnologe und Prähistoriker bedeutende Grundlagen der modernen Wissenschaft. Diese vielschichtigen Tätigkeitsbereiche zeichnen ihn als einen der bedeutendsten Wissenschaftler v.a. der Medizingeschichte aus. Als Politiker engagierte sich Virchow in erster Linie im sozial- und gesellschaftspolitischen Bereich. ...

Inductive Monitoring System (IMS)

Data.gov (United States)

National Aeronautics and Space Administration — IMS: Inductive Monitoring System The Inductive Monitoring System (IMS) is a tool that uses a data mining technique called clustering to extract models of normal...

Integrating IMS LD and IMS QTIv2 using CopperCore Service Integration

NARCIS (Netherlands)

Vogten, Hubert

2006-01-01

Vogten, H. (2006). Integrating IMS LD and IMS QTIv2 using CopperCore Service Integration. Presentation at International Workshop in Learning Networks for Lifelong Competence Development. March, 30-31, 2006. Sofia, Bulgaria: TENCompetence Conference. Retrieved June 30th, 2006, from

Downregulated microRNA-148b in circulating PBMCs in chronic myeloid leukemia patients with undetectable minimal residual disease: a possible biomarker to discontinue imatinib safely

Directory of Open Access Journals (Sweden)

Ohyashiki JH

2014-08-01

Full Text Available Junko H Ohyashiki,1 Kazushige Ohtsuki,1 Izuru Mizoguchi,2 Takayuki Yoshimoto,2 Seiichiro Katagiri,3 Tomohiro Umezu,1,4 Kazuma Ohyashiki3,4 1Department of Molecular Oncology, Institute of Medical Science, 2Department of Immunoregulation, Institute of Medical Science, 3Department of Hematology, 4Department of Molecular Science, Tokyo Medical University, Tokyo, Japan Background: A subset of patients with chronic myeloid leukemia (CML can sustain a complete molecular response after discontinuing imatinib mesylate (IM. We focused on microRNAs (miRNAs, with the aim of finding a molecular biomarker to discriminate which patients can safely and successfully discontinue IM use. Methods: To identify miRNAs that showed altered expression in patients who had discontinued IM (STOP-IM group, we first screened miRNA expression of peripheral blood mononuclear cells by using a TaqMan miRNA array on samples from five unselected patients from the STOP-IM group, seven CML patients receiving IM (IM group, and five healthy volunteers. We then performed miRNA quantification in 49 CML patients with deep molecular response. Mann–Whitney U and chi-square tests were used to determine statistical significance for comparisons between the control (healthy volunteers and test groups (STOP-IM and IM groups. Multiple groups were compared by one-way analysis of variance. Results: Downregulation of miR-148b was noted in patients in the STOP-IM group and in a subset of the IM group. We then subdivided the IM patients into two groups: one with downregulated miR-148b expression (IM-1; less than the cut-off value and the other without downregulated miR-148b expression (IM-2; greater than the cut-off value. The number of patients who had a sustained stable molecular response was significantly lower in IM-2 group. This group also had a significantly lower percentage of natural killer cells. Conclusion: Downregulated miR-148 may contribute to immune surveillance in STOP-IM patients

ifo Konjunkturprognose 2015/2016: Deutsche Wirtschaft im Aufschwung

OpenAIRE

Wollmershäuser, Timo; Nierhaus, Wolfgang; Berg, Tim Oliver; Breuer, Christian; Garnitz, Johanna; Grimme, Christian; Henzel, Steffen; Hristov, Atanas; Hristov, Nikolay; Meister, Wolfgang; Schröter, Felix; Steiner, Andreas; Wieland, Elisabeth; Wohlrabe, Klaus; Wolf, Anna

2015-01-01

Die deutsche Wirtschaft befindet sich derzeit in einem kräftigen Aufschwung. Das reale Bruttoinlandsprodukt wird in diesem Jahr voraussichtlich um 1,9% expandieren und im kommenden Jahr um 1,8%. Der private Konsum bleibt die Stütze des Aufschwungs, da die Einkommensperspektiven der privaten Haushalte aufgrund der sich weiter verbessernden Arbeitsmarktlage gut sind. Allerdings entfallen allmählich die Kaufkraftgewinne durch den Ölpreisrückgang, so dass sich die Konsumdynamik im Prognosezeitrau...

Report on converging insert moulding with µ-IM

DEFF Research Database (Denmark)

Islam, Aminul

moulding with µ-IM  Task 5.2.1 and COTECH demonstrator: guide line for 5PRC production based on the concept of Task 5.2.1 Information and results provided by this deliverable will be directly used for one of the COTECH demonstrators production which will call for convergent insert moulding with µ......Task 5.2.1 deals with the technical feasibility of converging the state-of-the-art µ IM process with insert moulding to offer a wide range of multi-material µ components. The main objective of this deliverable is to summarize state-of-the-art information and to make the guideline needed...... for the convergence. In particular the following aspects are summed up in the deliverable:  Need for converging insert moulding with µ-IM  Objectives and expected outcome from task 5.2.1  State-of-the-art micro insert moulding and different scenario of micro insert moulding  Challenges ahead of converging insert...

Zur mediopassiven 2. Und 3. Person dualis im indogermanischen

Directory of Open Access Journals (Sweden)

Bojan Čop

1972-12-01

Full Text Available Bekanntlich gibt es in einigen seltenen idg. Sprachen (im Arischen, Griechischen, Tocharischen auch Personal - suffixe für die 2. u n d 3. P. Du. des Mediopassivs. Von diesen sind die griechischen Ausgänge – 2. und 3. Du primär, 2. Du. sekundär, Du. sekundär sicher junge Neubildungen, s. z. B. Brugmann, Grdr.2 II 3 II, 657, § 602; Schwyzer, Gr. Gr. I 670, 672. Ein voll ausgebildetes System solcher Endungen besitzt das Arische; im Tocharischen kommt nur eine einzige Form mit solcher Endung vor, die die 2. P. Du. Med. lmperativi darstellt. Unter solchen Umständen scheint es schwierig, aus diesem Material wahrscheinliche Schlüsse für da_s Urindogermanische zu machen. Und doch ist gerade die tocharische Form, die uns eine ausserordentlich grosse Hilfe leistet, wenn man sie richtig zu beurteilen vermag. Die tocharische Endung, verbunden mit den arischen, wird unter Einschluss der allgemeinen Tendenzen und Regelungen im System der indogermanischen Personalsuffixe ohne Schwierigkeit die urindogermanische Urform erscheinen lassen.

IMS applications analysis

Energy Technology Data Exchange (ETDEWEB)

RODACY,PHILIP J.; REBER,STEPHEN D.; SIMONSON,ROBERT J.; HANCE,BRADLEY G.

2000-03-01

This report examines the market potential of a miniature, hand-held Ion Mobility Spectrometer. Military and civilian markets are discussed, as well as applications in a variety of diverse fields. The strengths and weaknesses of competing technologies are discussed. An extensive Ion Mobility Spectrometry (IMS) bibliography is included. The conclusions drawn from this study are: (1) There are a number of competing technologies that are capable of detecting explosives, drugs, biological, or chemical agents. The IMS system currently represents the best available compromise regarding sensitivity, specificity, and portability. (2) The military market is not as large as the commercial market, but the military services are more likely to invest R and D funds in the system. (3) Military applications should be addressed before commercial applications are addressed. (4) There is potentially a large commercial market for rugged, hand-held Ion Mobility Spectrometer systems. Commercial users typically do not invest R and D funds in this type of equipment rather, they wait for off-the-shelf availability.

Implantate im Mittelohrbereich - Teil 2 (Ergänzungen 2007)

Science.gov (United States)

Stieve, M.; Lenarz, Thomas

In Deutschland leben ca. 12 Millionen Menschen, die an einer ein- oder beidseitigen Schwerhörigkeit leiden. Diese kann angeboren oder im Laufe des Lebens erworben sein. Klinisch und therapeutisch wichtig ist die Unterscheidung hinsichtlich des Schädigungsortes im Bereich des Mittelohres, d. h. eine Schalleitungsschwerhörigkeit, oder im Bereich des Innenohres, d. h. eine Schallempfindungsschwerhörigkeit, wobei hier der Schädigungsort auch am Hörnerven oder in den zentralen Hörabschnitten liegen kann. Therapeutisch lassen sich sowohl Schwerhörigkeiten im Bereich des Mittelohres als auch im Innenohr und sogar im Hirnstammbereich (Hirnstammimplantat) behandeln. 1,9 Millionen Schwerhörige haben eine Erkrankung im Mittelohrbereich, d. h. der Schall kann nur ungenügend auf das Innenohr übertragen werden. Die Ursache besteht meist in einer chronischen Mittelohrentzündung, die zu einer Zerstörung des Trommelfells und der Gehörknöchelchenkette geführt haben. Therapeutisch und damit als Prinzip der operativen Hörverbesserung steht primär der Verschluß des Trommelfells oder eine Rekonstruktion der Gehörknöchelchen. Mittelohroperationen werden mikrochirurgisch unter dem Operationsmikroskop durchgeführt, wobei zunächst durch eine sanierende Operation der Entzündungsprozeß entfernt wird und nach einer Ausheilungszeit die Gehörknöchelchenkette durch künstliche Prothesen rekonstruiert werden kann.

Delegation und Kooperation im Gesundheitswesen

OpenAIRE

Rosenau, Henning

2010-01-01

Delegation und Kooperation im Gesundheitswesen. - In: Tıpta işbirliği ve hukuksal sorunlar = Delegation und Kooperation im Gesundheitswesen / ed.: Hakan Hakeri ... - Samsun : Adalet, 2010. - S. 7-18

Innovationsmanagement im Marketing: Anleitung zur Innovations-Sensibilisierung und deren Umsetzung im Rahmen der Neuen Lernkultur

OpenAIRE

Mangisch, Christian; Blatter, Martin

2009-01-01

Der Kurs “Innovationsmanagement im Marketing“ vermittelt den Teilnehmenden Wissen zum Innovationsmanagement, zum innovativen Team und zu innovativen Marketing Trends. Diese Kurse sind online auf dem folgenden Link www.ritzycampus.ch zu finden. Die Teilnehmer müssen für den Online-Kurs keine speziellen Kenntnisse oder Voraussetzungen mitbringen. Diese Online-Kurse im Fach Marketing sind an ein breites Publikum gerichtet. Sie ermöglichen den Studierenden im Eigenstudium die Grundlagen der Theme...

Calibration and validation of a MCC/IMS prototype for exhaled propofol online measurement.

Science.gov (United States)

Maurer, Felix; Walter, Larissa; Geiger, Martin; Baumbach, Jörg Ingo; Sessler, Daniel I; Volk, Thomas; Kreuer, Sascha

2017-10-25

Propofol is a commonly used intravenous general anesthetic. Multi-capillary column (MCC) coupled Ion-mobility spectrometry (IMS) can be used to quantify exhaled propofol, and thus estimate plasma drug concentration. Here, we present results of the calibration and analytical validation of a MCC/IMS pre-market prototype for propofol quantification in exhaled air. Calibration with a reference gas generator yielded an R 2 ≥0.99 with a linear array for the calibration curve from 0 to 20 ppb v . The limit of quantification was 0.3 ppb v and the limit of detection was 0.1 ppb v . The device is able to distinguish concentration differences >0.5 ppb v for the concentration range between 2 and 4 ppb v and >0.9 ppb v for the range between 28 and 30 ppb v . The imprecision at 20 ppb v is 11.3% whereas it is 3.5% at a concentration of 40 ppb v . The carry-over duration is 3min. The MCC/IMS we tested provided online quantification of gaseous propofol over the clinically relevant range at measurement frequencies of one measurement each minute. Copyright © 2017 Elsevier B.V. All rights reserved.

ImSET 3.1: Impact of Sector Energy Technologies Model Description and User's Guide

Energy Technology Data Exchange (ETDEWEB)

Scott, Michael J.; Livingston, Olga V.; Balducci, Patrick J.; Roop, Joseph M.; Schultz, Robert W.

2009-05-22

This 3.1 version of the Impact of Sector Energy Technologies (ImSET) model represents the next generation of the previously-built ImSET model (ImSET 2.0) that was developed in 2005 to estimate the macroeconomic impacts of energy-efficient technology in buildings. In particular, a special-purpose version of the Benchmark National Input-Output (I-O) model was designed specifically to estimate the national employment and income effects of the deployment of Office of Energy Efficiency and Renewable Energy (EERE)–developed energy-saving technologies. In comparison with the previous versions of the model, this version features the use of the U.S. Bureau of Economic Analysis 2002 national input-output table and the central processing code has been moved from the FORTRAN legacy operating environment to a modern C++ code. ImSET is also easier to use than extant macroeconomic simulation models and incorporates information developed by each of the EERE offices as part of the requirements of the Government Performance and Results Act. While it does not include the ability to model certain dynamic features of markets for labor and other factors of production featured in the more complex models, for most purposes these excluded features are not critical. The analysis is credible as long as the assumption is made that relative prices in the economy would not be substantially affected by energy efficiency investments. In most cases, the expected scale of these investments is small enough that neither labor markets nor production cost relationships should seriously affect national prices as the investments are made. The exact timing of impacts on gross product, employment, and national wage income from energy efficiency investments is not well-enough understood that much special insight can be gained from the additional dynamic sophistication of a macroeconomic simulation model. Thus, we believe that this version of ImSET is a cost-effective solution to estimating the economic

Δim-lacunary statistical convergence of order α

Science.gov (United States)

Altınok, Hıfsı; Et, Mikail; Işık, Mahmut

2018-01-01

The purpose of this work is to introduce the concepts of Δim-lacunary statistical convergence of order α and lacunary strongly (Δim,p )-convergence of order α. We establish some connections between lacunary strongly (Δim,p )-convergence of order α and Δim-lacunary statistical convergence of order α. It is shown that if a sequence is lacunary strongly (Δim,p )-summable of order α then it is Δim-lacunary statistically convergent of order α.

Air Traffic Management Technology Demostration Phase 1 (ATD) Interval Management for Near-Term Operations Validation of Acceptability (IM-NOVA) Experiment

Science.gov (United States)

Kibler, Jennifer L.; Wilson, Sara R.; Hubbs, Clay E.; Smail, James W.

2015-01-01

The Interval Management for Near-term Operations Validation of Acceptability (IM-NOVA) experiment was conducted at the National Aeronautics and Space Administration (NASA) Langley Research Center (LaRC) in support of the NASA Airspace Systems Program's Air Traffic Management Technology Demonstration-1 (ATD-1). ATD-1 is intended to showcase an integrated set of technologies that provide an efficient arrival solution for managing aircraft using Next Generation Air Transportation System (NextGen) surveillance, navigation, procedures, and automation for both airborne and ground-based systems. The goal of the IMNOVA experiment was to assess if procedures outlined by the ATD-1 Concept of Operations were acceptable to and feasible for use by flight crews in a voice communications environment when used with a minimum set of Flight Deck-based Interval Management (FIM) equipment and a prototype crew interface. To investigate an integrated arrival solution using ground-based air traffic control tools and aircraft Automatic Dependent Surveillance-Broadcast (ADS-B) tools, the LaRC FIM system and the Traffic Management Advisor with Terminal Metering and Controller Managed Spacing tools developed at the NASA Ames Research Center (ARC) were integrated into LaRC's Air Traffic Operations Laboratory (ATOL). Data were collected from 10 crews of current 757/767 pilots asked to fly a high-fidelity, fixed-based simulator during scenarios conducted within an airspace environment modeled on the Dallas-Fort Worth (DFW) Terminal Radar Approach Control area. The aircraft simulator was equipped with the Airborne Spacing for Terminal Area Routes (ASTAR) algorithm and a FIM crew interface consisting of electronic flight bags and ADS-B guidance displays. Researchers used "pseudo-pilot" stations to control 24 simulated aircraft that provided multiple air traffic flows into the DFW International Airport, and recently retired DFW air traffic controllers served as confederate Center, Feeder, Final

[Kriegsland im Osten Eroberung, Kolonisierung und Militärherrschaft im Ersten Weltkrieg] / Markus Pöhlmann

Index Scriptorium Estoniae

Pöhlmann, Markus

2003-01-01

Rets.: Vejas Gabriel Liulevicius. Kriegsland im Osten Eroberung, Kolonisierung und Militärherrschaft im Ersten Weltkrieg. Aus dem Amerikanischen von Jürgen Bauer, Edith Nerke und Fee Engemann. Hamburg : 2002

CopperCore Service Integration, Integrating IMS Learning Design and IMS Question and Test Interoperability

NARCIS (Netherlands)

Vogten, Hubert; Martens, Harrie; Nadolski, Rob; Tattersall, Colin; Van Rosmalen, Peter; Koper, Rob

2006-01-01

Vogten, H., Martens, H., Nadolski, R., Tattersall, C., Rosmalen, van, P., Koper, R., (2006). CopperCore Service Integration, Integrating IMS Learning Design and IMS Question and Test Interoperability. Proceedings of the 6th IEEE International Conference on Advanced Learning Technologies (pp.

Application of Hadamard transform in IMS

International Nuclear Information System (INIS)

Sha Miaomiao; Liu Weihao; Chen Yong; Jiang Dazhen

2008-01-01

Hadamard transform can improve the SNR by increasing the ion duty cycle in IMS. In this paper, the ion spectral signals were processed by Hadamard transform based on the IMS detector hardware platform. The results showed that Hadamard transform can greatly improve the SNR of the IMS detector in contrast with traditional method. (authors)

Sequence-specific DNA alkylation by tandem Py-Im polyamide conjugates.

Science.gov (United States)

Taylor, Rhys Dylan; Kawamoto, Yusuke; Hashiya, Kaori; Bando, Toshikazu; Sugiyama, Hiroshi

2014-09-01

Tandem N-methylpyrrole-N-methylimidazole (Py-Im) polyamides with good sequence-specific DNA-alkylating activities have been designed and synthesized. Three alkylating tandem Py-Im polyamides with different linkers, which each contained the same moiety for the recognition of a 10 bp DNA sequence, were evaluated for their reactivity and selectivity by DNA alkylation, using high-resolution denaturing gel electrophoresis. All three conjugates displayed high reactivities for the target sequence. In particular, polyamide 1, which contained a β-alanine linker, displayed the most-selective sequence-specific alkylation towards the target 10 bp DNA sequence. The tandem Py-Im polyamide conjugates displayed greater sequence-specific DNA alkylation than conventional hairpin Py-Im polyamide conjugates (4 and 5). For further research, the design of tandem Py-Im polyamide conjugates could play an important role in targeting specific gene sequences. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

E2eUberIM

DEFF Research Database (Denmark)

Wac, Katarzyna; Cummings, Mark; Dey, Jayanta

2016-01-01

, high-quality services, we propose an innovative end-to-end service management framework called e2eUberIM. This framework contains a scalable, flexible, and volatile information model (UberIM) and a real-time, "organic" communication and storage process (e2eUber). It leverages the proprietary interfaces...... of different vendors, enabling the resulting enhanced operations system environment to automatically and in real-time optimize operational overhead while maximizing the user experience, and quickly field new innovative, composed "any-services" (XaaS). We document the e2eUberIM requirements and its design...

Imágenes e identidades

OpenAIRE

Guerrini, Sebastión

2013-01-01

Las identidades se estructuran en un proceso de identificación continua con imágenes. Esto afecta no solo a las identidades de las personas, sino también a las de las instituciones, organizaciones y empresas. En este sentido, el rol de ser del Diseño en Comunicación Visual es intentar afectar a las identidades de los espectadores de sus imágenes. Por esta razón, primero es importante definir qué son las imágenes. Facultad de Bellas Artes

Verificación de la contaminación del maíz por flatoxina B1

Directory of Open Access Journals (Sweden)

Lisa Vallone

2010-10-01

Full Text Available “Aflaflesh” es un instrumento computarizado, diseñado para combinar un metodo de adquisición de datos visuales, con sofisticados sistemas operativosde software y análisis de imágenes. Esto, mediante la exposicion de la fluorescencia de maíz sometido a la radiación UV, ya que si hay contaminación con aflatoxinas B1, es posible transformar directamente el número de pixeles de la fluorescencia, en la concentración de AFB1 correspondiente.

Season of infectious mononucleosis and risk of multiple sclerosis at different latitudes; the EnvIMS Study.

Science.gov (United States)

Lossius, Andreas; Riise, Trond; Pugliatti, Maura; Bjørnevik, Kjetil; Casetta, Ilaria; Drulovic, Jelena; Granieri, Enrico; Kampman, Margitta T; Landtblom, Anne-Marie; Lauer, Klaus; Magalhaes, Sandra; Myhr, Kjell-Morten; Pekmezovic, Tatjana; Wesnes, Kristin; Wolfson, Christina; Holmøy, Trygve

2014-05-01

Seasonal fluctuations in solar radiation and vitamin D levels could modulate the immune response against Epstein-Barr virus (EBV) infection and influence the subsequent risk of multiple sclerosis (MS). Altogether 1660 MS patients and 3050 controls from Norway and Italy participating in the multinational case-control study of Environmental Factors In Multiple Sclerosis (EnvIMS) reported season of past infectious mononucleosis (IM). IM was generally reported more frequently in Norway (p=0.002), but was associated with MS to a similar degree in Norway (odds ratio (OR) 2.12, 95% confidence interval (CI) 1.64-2.73) and Italy (OR 1.72, 95% CI 1.17-2.52). For all participants, there was a higher reported frequency of IM during spring compared to fall (p<0.0005). Stratified by season of IM, the ORs for MS were 1.58 in spring (95% CI 1.08-2.31), 2.26 in summer (95% CI 1.46-3.51), 2.86 in fall (95% CI 1.69-4.85) and 2.30 in winter (95% CI 1.45-3.66). IM is associated with MS independently of season, and the association is not stronger for IM during spring, when vitamin D levels reach nadir. The distribution of IM may point towards a correlation with solar radiation or other factors with a similar latitudinal and seasonal variation.

Advanced Interval Management (IM) Concepts of Operations

Science.gov (United States)

Barmore, Bryan E.; Ahmad, Nash'at N.; Underwood, Matthew C.

2014-01-01

This document provides a high-level description of several advanced IM operations that NASA is considering for future research and development. It covers two versions of IM-CSPO and IM with Wake Mitigation. These are preliminary descriptions to support an initial benefits analysis

Power-efficient method for IM-DD optical transmission of multiple OFDM signals.

Science.gov (United States)

Effenberger, Frank; Liu, Xiang

2015-05-18

We propose a power-efficient method for transmitting multiple frequency-division multiplexed (FDM) orthogonal frequency-division multiplexing (OFDM) signals in intensity-modulation direct-detection (IM-DD) optical systems. This method is based on quadratic soft clipping in combination with odd-only channel mapping. We show, both analytically and experimentally, that the proposed approach is capable of improving the power efficiency by about 3 dB as compared to conventional FDM OFDM signals under practical bias conditions, making it a viable solution in applications such as optical fiber-wireless integrated systems where both IM-DD optical transmission and OFDM signaling are important.

Integrating IMS Learning Design and IMS Question and Test Interoperability using CopperCore Service Integration

NARCIS (Netherlands)

Vogten, Hubert; Martens, Harrie; Nadolski, Rob; Tattersall, Colin; Van Rosmalen, Peter; Koper, Rob

2006-01-01

Please, cite this publication as: Vogten, H., Martens, H., Nadolski, R., Tattersall, C., van Rosmalen, P., & Koper, R. (2006). Integrating IMS Learning Design and IMS Question and Test Interoperability using CopperCore Service Integration. Proceedings of International Workshop in Learning Networks

Deutsch-slawischer Siedlungs- und Sprachkontakt im Gebiet zwischen Saale und Neiße – vorgestellt an ausgewählten Ortsnamen (Siedlungsnamen

Directory of Open Access Journals (Sweden)

Inge Bily

2015-12-01

Full Text Available Saale und Elbe bilden im Wesentlichen die westliche Begrenzung des ehemals kompakten altsorbischen Sprachgebietes. Im Norden schließt das Altsorbische an das Altpolabische, im Osten und Südosten an das Polnische und Tschechische an. Eigennamen bilden eine wichtige Quelle sowohl für die Aufhellung der Geschichte der Besiedlung wie auch ethnischer, sprachlicher und sozialer Verhältnisse, denn historische Siedlungsprozesse fanden ihren Niederschlag u.a. in historischen Belegen von Namen. Diese Belege wie auch die Ableitungsbasen und Benennungsmotive ebenso wie die phonologischen und morphologischen Merkmale der Namen des altsorbischen Kontaktgebietes enthalten eine Vielzahl von Zeugnissen deutsch-slawischer Kontinuität. Auf der Grundlage umfangreicher Studien zu Ortsnamen stellt der Beitrag ausgewählte Beispiele vor. Im ehemals altsorbischen Kontaktgebiet können Ortsnamen (Siedlungsnamen und ihre historische Überlieferung Hinweise auf Siedlungs- und Sprachkontakt geben. Dies belegen eine ganze Reihe von Merkmalen, so z.B.: 1. Unterscheidende Bestimmungswörter 2. Parallele Namengebung mit zeitweiliger Mehrnamigkeit 3. Umbenennung 4. Übersetzung 5. Benennungsparallelismus im deutsch-slawischen Kontaktgebiet 6. Scheinbare sekundäre semantische Verankerung (SSSV 7. Namenpaare 8. Unterscheidende Zusätze 9. Mischnamen (Hybride

MALDI (matrix assisted laser desorption ionization) Imaging Mass Spectrometry (IMS) of skin: Aspects of sample preparation.

Science.gov (United States)

de Macedo, Cristiana Santos; Anderson, David M; Schey, Kevin L

2017-11-01

MALDI (matrix assisted laser desorption ionization) Imaging Mass Spectrometry (IMS) allows molecular analysis of biological materials making possible the identification and localization of molecules in tissues, and has been applied to address many questions on skin pathophysiology, as well as on studies about drug absorption and metabolism. Sample preparation for MALDI IMS is the most important part of the workflow, comprising specimen collection and preservation, tissue embedding, cryosectioning, washing, and matrix application. These steps must be carefully optimized for specific analytes of interest (lipids, proteins, drugs, etc.), representing a challenge for skin analysis. In this review, critical parameters for MALDI IMS sample preparation of skin samples will be described. In addition, specific applications of MALDI IMS of skin samples will be presented including wound healing, neoplasia, and infection. Copyright © 2017 Elsevier B.V. All rights reserved.

İletişim Çalışmalarında Yeni Bir Mecra: Finansal İletişim

Directory of Open Access Journals (Sweden)

Gökhan Gökgöz

2013-09-01

Full Text Available 1970’li yıllar toplumsal ve politik tarih açısından önemli bir uğrağı temsil eder. Bu yılların başında yaşanan kriz, ekonominin işleyiş süreçlerini, devletin yapısını ve toplumsal alanın tasavvur edilme biçimini büyük ölçüde değiştirmiştir. Bu dönemde, finansal sermaye, kapitalizm içerisinde bir hegemonik lider olarak ön plana çıkmış; devlet, bir yandan üretimin çekirdeğinden uzak bir yerde konumlandırılırken diğer yandan paranın dolaşım kanallarının rehabilitasyonu işine odaklanmış; insana ilişkin değerler, kültürel mefhumlar ve toplumsal pratikler ise birer değişken olarak ekonomi-politikanın merkezine taşınmıştır. Kültür ile ekonomi arasındaki geleneksel ilişki bozulmuş; bir ekonomi-politikanın başarısı, toplumsal aktörlere temas etme kabiliyeti ile paralel hale gelmiştir. Finansallaşma sürecinde bu temas, iletişim politikaları vasıtasıyla sağlanır; ekonomi-politika ve bundan sorumlu merkezi kurumlarla toplumsal alan arasındaki bağ, iletişim stratejileri üzerinden kurulur; ekonomik alan ile kültürel alan arasındaki boşluk, iletişim kanalları içerisinden taşınan enformasyon marifetiyle doldurulur; insana ilişkin öngörülemezlikler, iletişim süreçleri vasıtasıyla öngörülebilir kılınır. Bu çalışmada, iletişim çalışmaları içerisinde yeni bir mecra olarak çağrılan “finansal iletişim”in farklı temas noktalarına işaret edilecek ve her bir uğrağın finansal iletişim alanına bağlandığı nokta, modeller üzerinden gösterilecektir. 

The effects of physical aging at elevated temperatures on the viscoelastic creep on IM7/K3B

Science.gov (United States)

Gates, Thomas S.; Feldman, Mark

1994-01-01

Physical aging at elevated temperature of the advanced composite IM7/K3B was investigated through the use of creep compliance tests. Testing consisted of short term isothermal, creep/recovery with the creep segments performed at constant load. The matrix dominated transverse tensile and in-plane shear behavior were measured at temperatures ranging from 200 to 230 C. Through the use of time based shifting procedures, the aging shift factors, shift rates and momentary master curve parameters were found at each temperature. These material parameters were used as input to a predictive methodology, which was based upon effective time theory and linear viscoelasticity combined with classical lamination theory. Long term creep compliance test data was compared to predictions to verify the method. The model was then used to predict the long term creep behavior for several general laminates.

An IMS testbed for SIP applications

DEFF Research Database (Denmark)

Caba, Cosmin Marius; Soler, José

2013-01-01

The paper presents the design and implementation of an emulation platform for the IP Multimedia Subsystem. The SIP Servlet API v1.1 has been used to implement the final system. The purpose of the emulation is to offer to IMS service developers an environment where they can integrate development...

IM-16: A new microporous germanosilicate with a novel framework topology containing d4r and mtw composite building units

International Nuclear Information System (INIS)

Lorgouilloux, Yannick; Dodin, Mathias; Paillaud, Jean-Louis; Caullet, Philippe; Michelin, Laure; Josien, Ludovic; Ersen, Ovidiu; Bats, Nicolas

2009-01-01

The synthesis and the structure of IM-16 a new germanosilicate with a novel zeolitic topology prepared hydrothermally with the ionic liquid 3-ethyl-1-methyl-3H-imidazol-1-ium as the organic structure-directing agent are reported. The structure of calcined and partially rehydrated IM-16 of chemical formula |(H 2 O) 0.16 |[Si 3.47 Ge 2.53 O 12 ] was solved from powder XRD data in space group Cmcm with a=15.0861(2) A, b=17.7719(3) A, c=19.9764(3) A, V=5355.84(12) A 3 (Z=16). This new zeolite framework type contains 10-MRs channels and may be described from the d4r and mtw composite building units. - Graphical abstract: The synthesis and the structure of IM-16 a new germanosilicate with a novel zeolitic topology prepared hydrothermally with the ionic liquid 3-ethyl-1-methyl-3H-imidazol-1-ium as the organic structure-directing agent are reported. This new zeolite framework type contains 10-MRs channels and may be described from the d4r and mtw composite building units

Clasificador genérico de objetos en imágenes AVHRR

OpenAIRE

Pascual Ramírez, Fermín; Paz Pellat, Fernando; Martínez Menes, Mario; Palacios Vélez, Enrique; Mejía Sáenz, Enrique; Rubio Granados, Erasmo

2010-01-01

El presente artículo describe un algoritmo para llevar a cabo una clasificación genérica de objetos utilizando imágenes del sensor advanced very high resolution radiometer (AVHRR), basado en la firma espectral de los objetos genéricos (suelo, mezcla suelo-vegetación, cuerpos de agua, nubes, etc.). Debido a las particularidades de las bandas disponibles en el sensor AVHRR, se presenta un algoritmo específico utilizando la banda 3a (B3a) y otro utilizando la banda 3b (B3b) de este sensor. Los a...

Bluetooth in the car: chances and limits; Bluetooth im Auto: Moeglichkeiten und Grenzen

Energy Technology Data Exchange (ETDEWEB)

Hascher, W.

2000-06-01

Car manufacturers, electronic suppliers and research institutions such as the MIT in the U.S. everywhere work on complementing or replaced the wiring harness by radio links. One way of doing this is ''Bluetooth'', a short-distance-radio technology on the 2.4GHz-band.(orig.). [German] Weltweit wird in den Automobilkonzernen, bei den Elektronik-Zulieferfirmen und in Forschungseinrichtungen (z.B. beim MIT in den USA) daran gearbeitet, den 'Kabelbaum' im Kfz durch Funkverbindungen zu ergaenzen bzw. Teile davon zu ersetzen. Eine Loesung hierfuer ist 'Bluetooth', eine Kurzstrecken-Funktechnologie im 2,4-GHz-Band. (orig.)

Ion Mobility Spectrometer / Mass Spectrometer (IMS-MS)

Energy Technology Data Exchange (ETDEWEB)

Hunka, Deborah E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Austin, Daniel [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2005-10-01

The use of Ion Mobility Spectrometry (IMS)in the Detection of Contraband Sandia researchers use ion mobility spectrometers for trace chemical detection and analysis in a variety of projects and applications. Products developed in recent years based on IMS-technology include explosives detection personnel portals, the Material Area Access (MAA) checkpoint of the future, an explosives detection vehicle portal, hand-held detection systems such as the Hound and Hound II (all 6400), micro-IMS sensors (1700), ordnance detection (2500), and Fourier Transform IMS technology (8700). The emphasis to date has been on explosives detection, but the detection of chemical agents has also been pursued (8100 and 6400).

W8...b4 IM, how did u rite??! Digital Writing in the Composition Classroom

Science.gov (United States)

Partridge, Bryan

2011-01-01

From word processing computers, to mobile telephones, to the advent of the Internet, and finally to online communication venues like Instant Messenger (IM), the past four decades have brought an increasing prevalence of technology into our culture that is altering the English language. While decried by parents and lamented by teachers, these…

imFASP: An integrated approach combining in-situ filter-aided sample pretreatment with microwave-assisted protein digestion for fast and efficient proteome sample preparation.

Science.gov (United States)

Zhao, Qun; Fang, Fei; Wu, Ci; Wu, Qi; Liang, Yu; Liang, Zhen; Zhang, Lihua; Zhang, Yukui

2016-03-17

An integrated sample preparation method, termed "imFASP", which combined in-situ filter-aided sample pretreatment and microwave-assisted trypsin digestion, was developed for preparation of microgram and even nanogram amounts of complex protein samples with high efficiency in 1 h. For imFASP method, proteins dissolved in 8 M urea were loaded onto a filter device with molecular weight cut off (MWCO) as 10 kDa, followed by in-situ protein preconcentration, denaturation, reduction, alkylation, and microwave-assisted tryptic digestion. Compared with traditional in-solution sample preparation method, imFASP method generated more protein and peptide identifications (IDs) from preparation of 45 μg Escherichia coli protein sample due to the higher efficiency, and the sample preparation throughput was significantly improved by 14 times (1 h vs. 15 h). More importantly, when the starting amounts of E. coli cell lysate decreased to nanogram level (50-500 ng), the protein and peptide identified by imFASP method were improved at least 30% and 44%, compared with traditional in-solution preparation method, suggesting dramatically higher peptide recovery of imFASP method for trace amounts of complex proteome samples. All these results demonstrate that the imFASP method developed here is of high potential for high efficient and high throughput preparation of trace amounts of complex proteome samples. Copyright © 2016 Elsevier B.V. All rights reserved.

A New IMS Based Inter-working Solution

Science.gov (United States)

Zhu, Zhongwen; Brunner, Richard

With the evolution of third generation network, more and more multimedia services are developed and deployed. Any new service to be deployed in IMS network is required to inter-work with existing Internet communities or legacy terminal users in order to appreciate the end users, who are the main drivers for the service to succeed. The challenge for Inter-working between IMS (IP Multimedia Subsystem) and non-IMS network is “how to handle recipient’s address”. This is because each network has its own routable address schema. For instance, the address for Google Talk user is xmpp:xyz@google.com, which is un-routable in IMS network. Hereafter a new Inter-working (IW) solution between IMS and non-IMS network is proposed for multimedia services that include Instant Messaging, Chat, and File transfer, etc. It is an end-to-end solution built on IMS infrastructure. The Public Service Identity (PSI) defined in 3GPP standard (3rd Generation Partnership Project) is used to allow terminal clients to allocate this IW service. When sending the SIP (Session Initial Protocol) request out for multimedia services, the terminal includes the recipient’s address in the payload instead of the “Request-URI” header. In the network, the proposed solution provides the mapping rules between different networks in MM-IW (Multimedia IW). The detailed technical description and the corresponding use cases are present. The comparison with other alternatives is made. The benefits of the proposed solution are highlighted.

High resolution crystal structure of PedB: a structural basis for the classification of pediocin-like immunity proteins

Directory of Open Access Journals (Sweden)

Cha Sun-Shin

2007-05-01

Full Text Available Abstract Background Pediocin-like bacteriocins, ribosomally-synthesized antimicrobial peptides, are generally coexpressed with cognate immunity proteins in order to protect the bacteriocin-producer from its own bacteriocin. As a step for understanding the mode of action of immunity proteins, we determined the crystal structure of PedB, a pediocin-like immunity protein conferring immunity to pediocin PP-1. Results The 1.6 Å crystal structure of PedB reveals that PedB consists of an antiparallel four-helix bundle with a flexible C-terminal end. PedB shows structural similarity to an immunity protein against enterocin A (EntA-im but some disparity to an immunity protein against carnobacteriocin B2 (ImB2 in both the C-terminal conformation and the local structure constructed by α3, α4, and their connecting loop. Structure-inspired mutational studies reveal that deletion of the last seven residues of the C-terminus of PedB almost abolished its immunity activity. Conclusion The fact that PedB, EntA-im, and ImB2 share a four-helix bundle structure strongly suggests the structural conservation of this motif in the pediocin-like immunity proteins. The significant difference in the core structure and the C-terminal conformation provides a structural basis for the classification of pediocin-like immunity proteins. Our mutational study using C-terminal-shortened PedBs and the investigation of primary sequence of the C-terminal region, propose that several polar or charged residues in the extreme C-terminus of PedB which is crucial for the immunity are involved in the specific recognition of pediocin PP-1.

Argumentellipse in der "weichen" Nachricht im Deutschen und im Slowenischen

Directory of Open Access Journals (Sweden)

Uršula Krevs

1998-12-01

Full Text Available Argumentellipsen werden in der sprachlichen Kommunikation ohne weiteres akzeptiert, obwohl sie allenfalls in gewissem Sinne wegen ihrer Elliptizität abweichend wirken. Im folgenden interessiert uns, wie die Argumentellipse als syntaktische Entität in den Text eingebettet wird und welche Funktionen sie ausübt. Unsere Aufmerksamkeit gilt bier der Textsorte "weiche" Nachricht, die als Abweichung des Grundmusters gilt. Um im Sprachenpaar Deutsch-Slowenisch die in dieser Textsorte realisierten Argumentellipsen vergleichen zu können, wurde die Homogenität in der Thematik angestrebt und die Texte aus dem gleichen Kommunikationsbereich gewählt. So wurden die Korpora zwei Zeitschriften, die sich mit der gleichen Sportart beschäftigen, entnommen: der deutschen Zeitschrift "Rotpunkt" und der slowenischen Zeitschrift  "Grif '.

A. S. G O. C ullmann , Der Staat im Neuen Testament. J. C . B. Mohr ...

African Journals Online (AJOL)

Test

Dit is nietemin nie die eerste maal dat Cullmann oor die onderwerp skryf nie. Vroeër het daar reeds van hom verskyn, Konigsherrschaft. Christ und Kirche im Neuen Testament, en effens later, Die ersten christliche. Qlaubensbekenntnisse en betreklik onlangs, Christus und die Zeit. In al hierdie werke raak hy fasette van die ...

Creación de Imágenes Mentales según la Naturaleza y Forma de los Estímulos

OpenAIRE

Arroyo, Isidoro

2017-01-01

Ciencias Sociales, Psicología, Ciencias de la Información Esta tesis doctoral estudia las características del recuerdo de las imágenes mentales en 120 sujetos, estudiantes de enseñanza primaria, con edades comprendidas entre 9 y 11 años, generadas por estímulos, según: a) modalidad sensorial de presentación: visual o auditiva (palabra y sonido), b) grado de concreción, c) grado de riqueza de la imagen mental (i.m.), E) capacidad de viveza individual de i.m., Medida por el v.v.i.q de marks ...

Gene Directed Enzyme Prodrug Therapy Using Rabbit Cytochrome P450 4B1 in Murine Colon Adenocarcinoma

Energy Technology Data Exchange (ETDEWEB)

Kim, Sung Joo; Kang, Joo Hyun; Lee, Tae Sup; Kim, Kyeong Min; Woo, Kwang Sun; Chung, Wee Sup; Cheon, Gi Jeong; Choi, Chang Woon; Lim, Sang Moo [Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of)

2007-07-01

The conventional cancer therapy is chemotherapy, surgical resection and/or radiotherapy. Chemotherapy using cytotoxic drug has some problems with lack of tumor selectivity resulting in toxicity to normal tissues. To enhance the tumor selectivity of cytotoxic drug, the application of suicidal gene therapy technology was designed. Suicidal gene therapy is based on the expression in tumor cells of a gene encoding an enzyme that converts a non-toxic prodrug into a cytotoxic product. Representative suicidal genes are Herpes simplex virus type 1 thymidine kinase (HSV1- tk) and cytosine deaminase (cd). Recently, a new prodrug-converting enzyme based on rabbit cytochrome P450 4B1 gene (cyp4B1) has been reported for therapy of experimental brain tumor. This enzyme activates the prodrugs such as 4-ipomeanol (4-IM) and 2- aminoanthracene (2-AA) to highly reactive furane epoxide and unsaturated dialdehyde intermediate, respectively. DNA alkylation seems to be the main mechanism of cytotoxicity of these activated drugs. In this study, we isolated cyp4B1 cDNA from rabbit lung, transduced cyp4B1 expression vector into murine colon cancer cell, and then analyzed the cytotoxic properties of cyp4b1-activated 2-AA in cyp4B1 transduced cells to verify the cyp4B1 enzyme system for gene directed enzyme prodrug therapy.

Gene Directed Enzyme Prodrug Therapy Using Rabbit Cytochrome P450 4B1 in Murine Colon Adenocarcinoma

International Nuclear Information System (INIS)

Kim, Sung Joo; Kang, Joo Hyun; Lee, Tae Sup; Kim, Kyeong Min; Woo, Kwang Sun; Chung, Wee Sup; Cheon, Gi Jeong; Choi, Chang Woon; Lim, Sang Moo

2007-01-01

The conventional cancer therapy is chemotherapy, surgical resection and/or radiotherapy. Chemotherapy using cytotoxic drug has some problems with lack of tumor selectivity resulting in toxicity to normal tissues. To enhance the tumor selectivity of cytotoxic drug, the application of suicidal gene therapy technology was designed. Suicidal gene therapy is based on the expression in tumor cells of a gene encoding an enzyme that converts a non-toxic prodrug into a cytotoxic product. Representative suicidal genes are Herpes simplex virus type 1 thymidine kinase (HSV1- tk) and cytosine deaminase (cd). Recently, a new prodrug-converting enzyme based on rabbit cytochrome P450 4B1 gene (cyp4B1) has been reported for therapy of experimental brain tumor. This enzyme activates the prodrugs such as 4-ipomeanol (4-IM) and 2- aminoanthracene (2-AA) to highly reactive furane epoxide and unsaturated dialdehyde intermediate, respectively. DNA alkylation seems to be the main mechanism of cytotoxicity of these activated drugs. In this study, we isolated cyp4B1 cDNA from rabbit lung, transduced cyp4B1 expression vector into murine colon cancer cell, and then analyzed the cytotoxic properties of cyp4b1-activated 2-AA in cyp4B1 transduced cells to verify the cyp4B1 enzyme system for gene directed enzyme prodrug therapy

Representation of Coordination Mechanisms in IMS Learning Design to Support Group-based Learning

NARCIS (Netherlands)

Miao, Yongwu; Burgos, Daniel; Griffiths, David; Koper, Rob

2007-01-01

Miao, Y., Burgos, D., Griffiths, D., & Koper, R. (2008). Representation of Coordination Mechanisms in IMS Learning Design to Support Group-based Learning. In L. Lockyer, S. Bennet, S. Agostinho & B. Harper (Eds.), Handbook of Research on Learning Design and Learning Objects: Issues, Applications and

Lipozyme IM-catalyzed interesterification for the production of margarine fats in a 1 kg scale stirred tank reactor

DEFF Research Database (Denmark)

Zhang, Hong; Xu, Xuebing; Mu, Huiling

2000-01-01

Lipozyme IM-catalyzed interesterification of the oil blend between palm stearin and coconut oil (75/25 w/w) was studied for the production of margarine fats in a 1 kg scale batch stirred tank reactor. Parameters such as lipase load, water content, temperature, and reaction time were investigated...

IMS Learning Design Frequently Asked Questions

NARCIS (Netherlands)

Tattersall, Colin; Manderveld, Jocelyn; Hummel, Hans; Sloep, Peter; Koper, Rob; De Vries, Fred

2004-01-01

This list of frequently asked questions was composed on the basis of questions asked of the Educational Technology Expertise Centrum. The questions addessed are: Where can I find the IMS Learning Design Specification? What is meant by the phrase “Learning Design”? What is the IMS LD Specification

Thermal aging of melt-spun NdFeB magnetic powder in hydrogen

Science.gov (United States)

Pinkerton, Frederick E.; Balogh, Michael P.; Ellison, Nicole; Foto, Aldo; Sechan, Martin; Tessema, Misle M.; Thompson, Margarita P.

2016-11-01

High energy product neodymium-iron-boron (NdFeB) magnets are the premier candidate for demanding electrified vehicle traction motor applications. Injection molded (IM) or compression molded (CM) magnets made using NdFeB powders are promising routes to improve motor efficiency, cost, and manufacturability. However, IM and CM NdFeB magnets are susceptible to substantial thermal aging losses at motor operating temperatures when exposed to the automatic transmission fluid (ATF) used as a lubricant and cooling medium. The intrinsic coercivity Hci of NdFeB IM and CM magnets degrades by as much as 18% when aged for 1000 h in ATF at 150 °C, compared to a 3% loss when aged in air. Here we report aging studies of rapidly quenched NdFeB powder in air, ATF, and H2 gas. Expansion of the NdFeB crystal lattice in both ATF and H2 identified hydrogen dissociated from the ATF during aging and diffused into the primary NdFeB phase as the probable cause of the coercivity loss of IM and CM magnets.

Resilience of the IMS system

DEFF Research Database (Denmark)

Kamyod, Chayapol; Nielsen, Rasmus Hjorth; Prasad, Neeli R.

2014-01-01

The paper focuses on end-to-end resilience analysis of the IMS based network through the principal resilience parameters by using OPNET. The resilience behaviours of communication across multiple IMS domains are investigated at different communication scenarios and compared with previous state......-of-the-art. Moreover, the resilience effects when adding a redundancy of the S-CSCF unit are examined. The results disclose interesting resilience behaviours for long distance communications....

Environmental trace analysis by means of supersensitive GC-IMS

Energy Technology Data Exchange (ETDEWEB)

Leonhardt, J.W. [IUTLimited, Berlin, (Germany)

1997-10-01

The effective control of pollutants in ambient air requires their fast in situ identification and concentration determination of chemical compounds in the range of micrograms per m{sup 3}. There are attempts to use conventional analytical techniques as portable GC and GC-MS. These systems are relatively expensive. A new supersensitive ion Mobility Sensor (IMS) was developed and checked by IUT Ltd, which meets the new demands. The use of tritium sources is an advantage in comparison with other IMS being equipped by nickel-63, the application of which is rather critical in respect of the radiation protection. On the other hand an integrated separation column allows to reduce interferences by matrix effects. The technical parameters of the IUT GC- IMS and some of its most important applications are briefly presented 6 refs., 1 tab., 5 figs.

Evaluation of the Indian Migration Study Physical Activity Questionnaire (IMS-PAQ): a cross-sectional study.

Science.gov (United States)

Sullivan, Ruth; Kinra, Sanjay; Ekelund, Ulf; Bharathi, A V; Vaz, Mario; Kurpad, Anura; Collier, Tim; Reddy, K Srinath; Prabhakaran, Dorairaj; Ebrahim, Shah; Kuper, Hannah

2012-02-09

Socio-cultural differences for country-specific activities are rarely addressed in physical activity questionnaires. We examined the reliability and validity of the Indian Migration Study Physical Activity Questionnaire (IMS-PAQ) in urban and rural groups in India. A sub-sample of IMS participants (n = 479) was used to examine short term (≤ 1 month [n = 158]) and long term (> 1 month [n = 321]) IMS-PAQ reliability for levels of total, sedentary, light and moderate/vigorous activity (MVPA) intensity using intraclass correlation (ICC) and kappa coefficients (k). Criterion validity (n = 157) was examined by comparing the IMS-PAQ to a uniaxial accelerometer (ACC) worn ≥ 4 days, via Spearman's rank correlations (ρ) and k, using Bland-Altman plots to check for systematic bias. Construct validity (n = 7,000) was established using linear regression, comparing IMS-PAQ against theoretical constructs associated with physical activity (PA): BMI [kg/m2], percent body fat and pulse rate. IMS-PAQ reliability ranged from ICC 0.42-0.88 and k = 0.37-0.61 (≤ 1 month) and ICC 0.26 to 0.62; kappa 0.17 to 0.45 (> 1 month). Criterion validity was ρ = 0.18-0.48; k = 0.08-0.34. Light activity was underestimated and MVPA consistently and substantially overestimated for the IMS-PAQ vs. the accelerometer. Criterion validity was moderate for total activity and MVPA. Reliability and validity were comparable for urban and rural participants but lower in women than men. Increasing time spent in total activity or MVPA, and decreasing time in sedentary activity were associated with decreasing BMI, percent body fat and pulse rate, thereby demonstrating construct validity. IMS-PAQ reliability and validity is similar to comparable self-reported instruments. It is an appropriate tool for ranking PA of individuals in India. Some refinements may be required for sedentary populations and women in India.

Interfaz Gráfica de Usuario (GUI) para la Manipulación Interactiva de Imágenes en Aplicaciones Web

OpenAIRE

Luján Vásquez, Renzo

2011-01-01

Desarrollar una aplicación cliente con interfaz gráfica para un software de búsqueda de imágenes de biopsias ópticas, con el propósito de ayudar a endoscopistas a obtener un diagnóstico médico a partir de la manipulación y análisis de imágenes estáticas.

Der antiskeptische Boden unter dem Gehirn im Tank

OpenAIRE

Müller, Olaf L.

2001-01-01

Crispin Wright hat die bislang beste Rekonstruktion von Putnams Beweis gegen die skeptische Hypothese vom Gehirn im Tank vorgelegt. Aber selbst in Wrights Fassung hat der Beweis einen Mangel: Er wird mithilfe eines Prädikates wie z.B. "Tiger" geführt und funktioniert nur, wenn man sich darauf verlassen kann, dass es Tiger wirklich gibt. Aber die Skeptikerin bestreitet, über die Existenz von Tigern bescheid zu wissen. Das Problem lässt sich dadurch beheben, dass man den Beweis – statt mit dem ...

Eisengehalt von Fleisch - Ermittlung des Eisengehalts im Fleisch verschiedener Tierarten

OpenAIRE

Westphal, Karsten; Klose, Ralf; Golze, Manfred

2009-01-01

Der Bericht beinhaltet Ergebnisse von Fleischuntersuchungen auf den Eisengehalt. Untersucht wurden 308 Schweinefleischproben und etwa 300 Fleischproben der Tierarten Rind, Bison, Auerochse, Büffel, Schaf, Ziege, Kaninchen, Wildschwein, Rehwild, Rotwild und Fasan. Die sächsischen Ergebnisse bestätigen Untersuchungen anderer Bundesländer und belegen den starken Rückgang des Eisengehaltes im Schweinefleisch. Er lag im Mittel bei 4,1 mg/kg Frischmasse (FM). Vor 30 Jahren lag der Eisengehalt...

Individualisierte Produkte im Fokus der intergrierten Produktentwicklung

OpenAIRE

Baumberger, C.;Gahr, A.

2017-01-01

Individualisierte Produkte stellen neue Herausforderungen an die Produktentwicklung – vornehmlich im Bereich der Produktstrukturplanung, der kundenindividuellen Produktadaption und dem Zielkostenmanagement. Diese Themen werden am Lehrstuhl für Produktentwicklung im Rahmen des Sonderforschungsbereiches 582 behandelt.

Managing P2P services via the IMS

NARCIS (Netherlands)

Liotta, A.; Lin, L.

2007-01-01

The key aim of our work was to illustrate the benefits and means to deploy P2P services via the IMS. Having demonstrated the technical viability of P2P-IMS we have also found a way to add a new management dimension to existing P2P systems. P2P-IMS comes with a natural "data management" mechanism,

Geschlechterstereotype im Einsatz

Directory of Open Access Journals (Sweden)

Erika Kegyes

2007-11-01

Full Text Available Die umfangreiche Monographie gehört zum Forschungsbereich der kritischen angewandten Linguistik (Critical Applied Linguistics und liegt sowohl theoretisch als auch praktisch im Schnittpunkt der gender- und werbesprachlichen Untersuchungen.

Muriithi, IM

African Journals Online (AJOL)

Muriithi, IM. Vol 8, No 2 (2014) - Articles Correlation of magnetic resonance imaging findings with arthroscopy in the evaluation of rotator cuff pathology. Abstract PDF · Vol 8, No 2 (2014) - Articles Patterns of knee, hip and hand osteoarthritis in Kenyatta National Hospital Abstract PDF. ISSN: 1994-1072. AJOL African ...

Ion mobility spectrometer / mass spectrometer (IMS-MS).

Energy Technology Data Exchange (ETDEWEB)

Hunka Deborah Elaine; Austin, Daniel E.

2005-07-01

The use of Ion Mobility Spectrometry (IMS) in the Detection of Contraband Sandia researchers use ion mobility spectrometers for trace chemical detection and analysis in a variety of projects and applications. Products developed in recent years based on IMS-technology include explosives detection personnel portals, the Material Area Access (MAA) checkpoint of the future, an explosives detection vehicle portal, hand-held detection systems such as the Hound and Hound II (all 6400), micro-IMS sensors (1700), ordnance detection (2500), and Fourier Transform IMS technology (8700). The emphasis to date has been on explosives detection, but the detection of chemical agents has also been pursued (8100 and 6400). Combining Ion Mobility Spectrometry (IMS) with Mass Spectrometry (MS) is described. The IMS-MS combination overcomes several limitations present in simple IMS systems. Ion mobility alone is insufficient to identify an unknown chemical agent. Collision cross section, upon which mobility is based, is not sufficiently unique or predictable a priori to be able to make a confident peak assignment unless the compounds present are already identified. Molecular mass, on the other hand, is much more readily interpreted and related to compounds. For a given compound, the molecular mass can be determined using a pocket calculator (or in one's head) while a reasonable value of the cross-section might require hours of computation time. Thus a mass spectrum provides chemical specificity and identity not accessible in the mobility spectrum alone. In addition, several advanced mass spectrometric methods, such as tandem MS, have been extensively developed for the purpose of molecular identification. With an appropriate mass spectrometer connected to an ion mobility spectrometer, these advanced identification methods become available, providing greater characterization capability.

Singular vector-based targeted observations of chemical constituents: description and first application of the EURAD-IM-SVA v1.0

Science.gov (United States)

Goris, N.; Elbern, H.

2015-12-01

Measurements of the large-dimensional chemical state of the atmosphere provide only sparse snapshots of the state of the system due to their typically insufficient temporal and spatial density. In order to optimize the measurement configurations despite those limitations, the present work describes the identification of sensitive states of the chemical system as optimal target areas for adaptive observations. For this purpose, the technique of singular vector analysis (SVA), which has proven effective for targeted observations in numerical weather prediction, is implemented in the EURAD-IM (EURopean Air pollution and Dispersion - Inverse Model) chemical transport model, yielding the EURAD-IM-SVA v1.0. Besides initial values, emissions are investigated as critical simulation controlling targeting variables. For both variants, singular vectors are applied to determine the optimal placement for observations and moreover to quantify which chemical compounds have to be observed with preference. Based on measurements of the airship based ZEPTER-2 campaign, the EURAD-IM-SVA v1.0 has been evaluated by conducting a comprehensive set of model runs involving different initial states and simulation lengths. For the sake of brevity, we concentrate our attention on the following chemical compounds, O3, NO, NO2, HCHO, CO, HONO, and OH, and focus on their influence on selected O3 profiles. Our analysis shows that the optimal placement for observations of chemical species is not entirely determined by mere transport and mixing processes. Rather, a combination of initial chemical concentrations, chemical conversions, and meteorological processes determines the influence of chemical compounds and regions. We furthermore demonstrate that the optimal placement of observations of emission strengths is highly dependent on the location of emission sources and that the benefit of including emissions as target variables outperforms the value of initial value optimization with growing

Entwicklung der Reglementierung von 10 MEM-Berufen im Kontext von Bildungsreformen und dem Wandel in der Arbeitswelt: Eine Kurzstudie im Auftrag von LIBS: Eine Kurzstudie im Auftrag von LIBS Industrielle Berufslehren Schweiz, Baden

OpenAIRE

Egg, Maria Esther; Renold, Ursula

2015-01-01

Im Auftrag der LIBS Industrielle Berufslehren Schweiz, hat die KOF die Entwicklung von 10 MEM1-Berufsbildern seit dem ersten Berufsbildungsgesetz dargestellt und diese eingebettet in eine kurze Zusammenfassung der wichtigsten Etappenschritte des Schweizer Berufsbildungssystems.

Bremssysteme im Personenkraftwagen

Science.gov (United States)

Reif, Konrad

Für die ersten drei Punkte ist die Betriebsbremsanlage ("Fußbremse“) zuständig. Der Fahrer aktiviert sie durch Betätigen des Bremspedals. Die Feststellbremsanlage ("Handbremse“) hält das Fahrzeug im Stillstand.

Politische Inhalte im Internet: Angebot und Nachfrage politischer Inhalte im World Wide Web am Beispiel von Volksabstimmungen in der Schweiz

OpenAIRE

Rademacher, Patrick Horst Josef

2010-01-01

Welche Bedeutung kommt dem Internet in der Politikvermittlung zu? Dieser Frage geht Patrick Rademacher nach, indem er untersucht, welche Anbieter politische Inhalte im Internet zur Verfügung stellen, wie sie dabei vorgehen und wie die Struktur der Inhalte beschaffen ist. Darüber hinaus analysiert er, inwiefern die online angebotenen Inhalte auf eine Nachfrage durch die Bürger treffen. Im Untersuchungskontext von Volksabstimmungen in der Schweiz hat der Autor hierfür im Jahr 2008 umfangreiche ...

Improved detection of Mycobacterium bovis infection in bovine lymph node tissue using immunomagnetic separation (IMS-based methods.

Directory of Open Access Journals (Sweden)

Linda D Stewart

Full Text Available Immunomagnetic separation (IMS can selectively isolate and concentrate Mycobacterium bovis cells from lymph node tissue to facilitate subsequent detection by PCR (IMS-PCR or culture (IMS-MGIT. This study describes application of these novel IMS-based methods to test for M. bovis in a survey of 280 bovine lymph nodes (206 visibly lesioned (VL, 74 non-visibly lesioned (NVL collected at slaughter as part of the Northern Ireland bovine TB eradication programme. Their performance was evaluated relative to culture. Overall, 174 (62.1% lymph node samples tested positive by culture, 162 (57.8% by IMS-PCR (targeting IS6110, and 191 (68.2% by IMS-MGIT culture. Twelve (6.9% of the 174 culture positive lymph node samples were not detected by either of the IMS-based methods. However, an additional 79 M. bovis positive lymph node samples (27 (13.1% VL and 52 (70.3% NVL were detected by the IMS-based methods and not by culture. When low numbers of viable M. bovis are present in lymph nodes (e.g. in NVLs of skin test reactor cattle decontamination prior to culture may adversely affect viability, leading to false negative culture results. In contrast, IMS specifically captures whole M. bovis cells (live, dead or potentially dormant which are not subject to any deleterious treatment before detection by PCR or MGIT culture. During this study only 2.7% of NVL lymph nodes tested culture positive, whereas 70.3% of the same samples tested M. bovis positive by the IMS-based tests. Results clearly demonstrate that not only are the IMS-based methods more rapid but they have greater detection sensitivity than the culture approach currently used for the detection of M. bovis infection in cattle. Adoption of the IMS-based methods for lymph node testing would have the potential to improve M. bovis detection in clinical samples.

Gruppenbezogene Menschenfeindlichkeit im Sport in Brandenburg

OpenAIRE

Delto, Hannes; Tzschoppe, Petra

2016-01-01

Mit der Querschnittsstudie "Wir und die Anderen – Gruppenbezogene Menschenfeindlichkeit im organisierten Sport in Brandenburg" wurde das Syndrom Gruppenbezogener Menschenfeindlichkeit im organisierten Sport untersucht. Das Konzept der Gruppenbezogenen Menschenfeindlichkeit – ausgehend von einer Ideologie der Ungleichwertigkeit – wurde von Prof. Wilhelm Heitmeyer (Universität Bielefeld) entwickelt. Die Ergebnisse ermöglichen explizite Aussagen über Ausmaß und Ursachen Gruppenbezogener Menschen...

Verletzungen und Fehlbeanspruchungen im leistungsorientierten Rudersport

OpenAIRE

Bussian, Marc Robert

2004-01-01

Die Stellung der Breitensportart Rudern als gesundheitsfördernde Sportform ist in der Literatur gleichlautend positiv beschrieben. Im leistungsorientierten Rudersport müssen neben den Verletzungen und Fehlbeanspruchungen der eigentlichen Sportart die unabdingbaren Nebentrainingsformen berücksichtigt werden. In den neunziger Jahren vollzog sich ein trainingsmethodischer Wandel, die Einführung eines erschwinglichen Rudersimulators und eine technische Weiterentwicklung im Boots- und Ruderbau. Ei...

Pengaruh Intensitas Mengakses Twitter Duta Im3 terhadap Kepuasan Pengalaman Adopsi dan Kepuasan Pengalaman Adopsi terhadap Keputusan Penggunaan Program Im3

OpenAIRE

Ayu Kinasih, Diyan Hafdinovianti; Pradekso, Tandiyo; Setiabudi, Djoko

2014-01-01

Nama : Diyan H Ayu KinasihNIM : D2C009029Judul : Pengaruh Intensitas Mengakses Twitter Duta IM3 terhadapKepuasan Pengalaman Adopsi dan Kepuasan PengalamanAdopsi terhadap Keputusan Penggunaan Program IM3ABSTRAKTwitter sebagai salah satu promotion tools yang digunakan oleh PTIndosat Tbk, diharapkan dapat memperkenalkan program-program serta eventyang dilakukan oleh Indosat. Melalui duta IM3 sebagai brand ambassador, Indosatmencoba meraih pasar anak muda dengan melakukan kegiatan promosi.Tipe pe...

The Application of Internal Marketing (IM in a Service Organization

Directory of Open Access Journals (Sweden)

R. Sharma

2013-07-01

Findings and Strategic Implications. To complement earlier theoretical proposition on IM, the findings indicate that there are several empirical aspects such as “costs, people and concept” which hinder successful implementation of IM. This study proposes several strategic HR recommendations to reduce the “implementation gap” in IM such as to conduct continuous staff training on IM knowledge on regular time intervals, to reduce excessive work load and pressure and engaging staff members in continuous personal development sessions. In addition, the findings reveal that IM training should be given priority to solve “people-oriented” issues.

Evaluation of the Indian Migration Study Physical Activity Questionnaire (IMS-PAQ: a cross-sectional study

Directory of Open Access Journals (Sweden)

Sullivan Ruth

2012-02-01

Full Text Available Abstract Background Socio-cultural differences for country-specific activities are rarely addressed in physical activity questionnaires. We examined the reliability and validity of the Indian Migration Study Physical Activity Questionnaire (IMS-PAQ in urban and rural groups in India. Methods A sub-sample of IMS participants (n = 479 was used to examine short term (≤1 month [n = 158] and long term (> 1 month [n = 321] IMS-PAQ reliability for levels of total, sedentary, light and moderate/vigorous activity (MVPA intensity using intraclass correlation (ICC and kappa coefficients (k. Criterion validity (n = 157 was examined by comparing the IMS-PAQ to a uniaxial accelerometer (ACC worn ≥4 days, via Spearman's rank correlations (ρ and k, using Bland-Altman plots to check for systematic bias. Construct validity (n = 7,000 was established using linear regression, comparing IMS-PAQ against theoretical constructs associated with physical activity (PA: BMI [kg/m2], percent body fat and pulse rate. Results IMS-PAQ reliability ranged from ICC 0.42-0.88 and k = 0.37-0.61 (≤1 month and ICC 0.26 to 0.62; kappa 0.17 to 0.45 (> 1 month. Criterion validity was ρ = 0.18-0.48; k = 0.08-0.34. Light activity was underestimated and MVPA consistently and substantially overestimated for the IMS-PAQ vs. the accelerometer. Criterion validity was moderate for total activity and MVPA. Reliability and validity were comparable for urban and rural participants but lower in women than men. Increasing time spent in total activity or MVPA, and decreasing time in sedentary activity were associated with decreasing BMI, percent body fat and pulse rate, thereby demonstrating construct validity. Conclusion IMS-PAQ reliability and validity is similar to comparable self-reported instruments. It is an appropriate tool for ranking PA of individuals in India. Some refinements may be required for sedentary populations and women in India.

Die Rule of Law im Völker- und im Europarecht – aktuelle Probleme

Directory of Open Access Journals (Sweden)

Helmut Tichy

2015-04-01

Full Text Available Diese am 5. März 2015 in Graz gehaltene Antrittsvorlesung eines Praxisprofessors, der im Hauptberuf Leiter des Völkerrechtsbüros im österreichischen Außenministerium ist, beschäftigt sich mit dem Begriff der Herrschaft des Rechts in den internationalen Beziehungen (Rule of Law und mit den Möglichkeiten Österreichs, zur Stärkung der Rule of Law und zur Lösung aktueller Probleme beizutragen. Dabei werden insbesondere die Mitwirkung an Kodifikationsbemühungen und an der Verbesserung der Einhaltung des humanitären Völkerrechts, die Umsetzung der Menschenrechte (auch in Österreich und Fragen der internationalen Gerichtsbarkeit angesprochen.

Gruppenbezogene Menschenfeindlichkeit im Sport in Sachsen

OpenAIRE

Delto, Hannes; Tzschoppe, Petra

2015-01-01

Mit der Querschnittsstudie „Wir und die Anderen – Gruppenbezogene Menschenfeindlichkeit im organisierten Sport in Sachsen“ wurde erstmals das Syndrom Gruppenbezogener Menschenfeindlichkeit im organisierten Sport untersucht. Das Konzept der Gruppenbezogenen Menschenfeindlichkeit – ausgehend von einer Ideologie der Ungleichwertigkeit – wurde von Prof. Wilhelm Heitmeyer (Universität Bielefeld) entwickelt. Die Ergebnisse ermöglichen explizite Aussagen über Ausmaß und Ursachen Gruppenbezogener Men...

Usability test of the ImPRO, computer-based procedure system

International Nuclear Information System (INIS)

Jung, Y.; Lee, J.

2006-01-01

ImPRO is a computer based procedure in both flowchart and success logic tree. It is evaluated on the basis of computer based procedure guidelines. It satisfies most requirements such as presentations and functionalities. Besides, SGTR has been performed with ImPRO to evaluate reading comprehension and situation awareness. ImPRO is a software engine which can interpret procedure script language, so that ImPRO is reliable by nature and verified with formal method. One bug, however, had hidden one year after release, but it was fixed. Finally backup paper procedures can be prepared on the same format as VDU in case of ImPRO failure. (authors)

Midlatitude magnetometer chains during the IMS

International Nuclear Information System (INIS)

Mcpherron, R.L.

1982-01-01

The International Magnetospheric Study (IMS) is an international program to study global problems of magnetospheric dynamics. A key element of the U.S. participation in this program was the establishment of a ground magnetometer network. This network included a number of arrays at high and low latitudes. This report describes three chains established at midlatitudes, including the IMS Midlatitude Chain, the AFGL Magnetometer Network, and the Bell Lab Conjugate Array. Descriptions of the type of equipment, station locations, types of data display, and availability of data for each chain are presented in this report. A major problem of the data analysis phase of the IMS will be reducing selected subsets of these data to a common format. Currently, there are no plans to do this in a systematic manner

Associations between United States Medical Licensing Examination (USMLE) and Internal Medicine In-Training Examination (IM-ITE) scores.

Science.gov (United States)

McDonald, Furman S; Zeger, Scott L; Kolars, Joseph C

2008-07-01

Little is known about the associations of previous standardized examination scores with scores on subsequent standardized examinations used to assess medical knowledge in internal medicine residencies. To examine associations of previous standardized test scores on subsequent standardized test scores. Retrospective cohort study. One hundred ninety-five internal medicine residents. Bivariate associations of United States Medical Licensing Examination (USMLE) Steps and Internal Medicine In-Training Examination (IM-ITE) scores were determined. Random effects analysis adjusting for repeated administrations of the IM-ITE and other variables known or hypothesized to affect IM-ITE score allowed for discrimination of associations of individual USMLE Step scores on IM-ITE scores. In bivariate associations, USMLE scores explained 17% to 27% of the variance in IME-ITE scores, and previous IM-ITE scores explained 66% of the variance in subsequent IM-ITE scores. Regression coefficients (95% CI) for adjusted associations of each USMLE Step with IM-ITE scores were USMLE-1 0.19 (0.12, 0.27), USMLE-2 0.23 (0.17, 0.30), and USMLE-3 0.19 (0.09, 0.29). No single USMLE Step is more strongly associated with IM-ITE scores than the others. Because previous IM-ITE scores are strongly associated with subsequent IM-ITE scores, appropriate modeling, such as random effects methods, should be used to account for previous IM-ITE administrations in studies for which IM-ITE score is an outcome.

Minería de imágenes

OpenAIRE

Fernández, Jacqueline; Miranda, Natalia Carolina; Guerrero, Roberto A.; Piccoli, María Fabiana

2006-01-01

Durante los últimos años, la proliferación de los medios digitales ha creado la necesidad del desarrollo de herramientas para la eficiente representación, acceso y recuperación de información visual. La minería de imágenes se ha convertido en una importante rama de investigación a causa del potencial que posee en descubrir patrones característicos a partir de un importante conjunto de imágenes. No obstante, la minería de imágenes es más que una simple extensión de la minería de datos al domin...

Medienerziehung im Vorschulbereich - Zum Projekt Mediengarten der Wiener Medienpädagogik

Directory of Open Access Journals (Sweden)

Gudrun Kern

2010-09-01

Full Text Available Im Zuge des Projekts Mediengarten der Wiener Medienpädagogik wurde in Kooperation mit angehenden KindergartenpädagogInnen eine Medienerziehung im Sinne einer Auseinandersetzung über Medien im Vorschulbereich anhand konkreter Angebote in Kindergärten konzipiert. Im folgenden Artikel werden die Schwerpunktsetzungen dieses Konzepts vorgestellt und durch praktische Beispiele verdeutlicht.

Detection of microbial volatile organic compounds (MVOC) by means of ion mobility spectroscopy (IMS); Detektion leicht fluechtiger organischer Verbindungen mikrobiellen Ursprungs (MVOC) mittels Ionenmobilitaetsspektrometrie (IMS)

Energy Technology Data Exchange (ETDEWEB)

Tiebe, Carlo

2010-07-01

Traces of microbial volatile organic compounds (MVOCs) can indicate the growth of moulds in the indoor air. The application of ion mobility spectrometry (IMS) is a very promising method for the detection of these MVOCs due to its high sensitivity. A mobile IMS device was tested to use this analytical-chemical method for in situ indoor air diagnostics. The first part of this work describes the test gas generation of 14 MVOCs in the laboratory. The test gases were produced by preparation of permeation procedures. Due to the MVOCs test gases IMS parameters like reduced mobility (K{sub 0}), relative drift time (t{sub rd}), the concentration dependency of MVOCs signals were determined and the limit of detection (LOD) was calculated. The LODs are in the range of 2 to 192 {mu}g m{sup -3} (1 to 51 ppb{sub V}). In the second part of this manuscript seven different mould species were cultivated on nutrient media and their MVOCs emissions were explored. It was found out, that the MVOCs emissions of moulds have a dependency of species and of their cultivation time. These results are confirmed by principal component analysis (PCA). The identification of these MVOCs was performed by test-related GC-MS analysis and approved these results. The MVOCs emissions were explored in the cultivation of mould mixtures on three different building materials. The IMS-results were interpreted chemo metrically by PCA. It was possible to find different emission patterns of cultivated moulds on building materials without an identification of the MVOCs inside the emission chamber. In 27 field trials of different indoor environments (rooms) the IMS was tested to detect MVOCs. In 59 % of the cases a positive correlation is determined between visible mould-infested rooms and the detected MVOCs by IMS. (orig.)

Experimental Investigation of transmission properties of all-optical label swapping of orthogonal IM/FSK labeled signals

DEFF Research Database (Denmark)

Holm-Nielsen, Pablo Villanueva; Chi, Nan; Zhang, Jianfeng

2003-01-01

Optically labeled IM/FSK signal saretran smitte dover 50km of SMF under different compensation schemes.All-opticallabel swapping based on MZ-SOA and EAM is presented. Transmission followed by label swapping shows a 2dB overall power penalty....

Combined effect of CO2 and light on the N2-fixing cyanobacterium Trichodesmium IMS101: Physiological responses 1[OA

Czech Academy of Sciences Publication Activity Database

Kranz, S. A.; Levitan, O.; Richter, K.-U.; Prášil, Ondřej; Berman-Frank, I.; Rost, B.

2010-01-01

Roč. 154, č. 1 (2010), s. 334-345 ISSN 0032-0889 R&D Projects: GA ČR GA206/08/1683 Institutional research plan: CEZ:AV0Z50200510 Keywords : Trichodesmium IMS101 * cyanobacterium * CO2 Subject RIV: EE - Microbiology, Virology Impact factor: 6.451, year: 2010

Instrumentale Spielformeln und Vokale Verzierungen im 16.Jahrhundert

Directory of Open Access Journals (Sweden)

Göllner, Theodor

2001-12-01

Full Text Available In the music of the 16th century, stereotype four-note formulas are found in the instrumental as well as in the vocal idiom. Although frequently identical in appearance, their functions are very different. While indispensable in the instrumental idiom, particularly in keyboard music, where they represent the very essence of instruction in 15th-century organ treatises and fundamenta, they appear in vocal music only as additions to finished compositions or existing practices. What amounts to an absolute necessity in one case is merely an ornamental supplement in the other. In vocal music it is treated as a matter of performance carried out by a qualified soloist and limited to the musical centers of Italy. The present article raises the question as to how the genuinely instrumental and widely spread keyboard practice made its impact on the vocal ornaments of the singer, whose primary concern is the musical communication of language.

[de] Die in der Musik des 16. Jahrhunderts im Instrumentalen wie im Vokalen vorkommenden, meist viertönigen, stereotypen Formeln sind zwar in beiden Bereichen weitgehend identisch, doch von höchst unterschiedlicher Funktion. Während sie im Instrumentalen, besonders in der Tastenmusik, unverzichtbar sind und schon im 15. Jahrhundert den Kern der Orgeltraktate und Fundamenta bilden, treten sie im Vokalen zu einer fertigen Komposition oder bestehenden Praxis hinzu. Was im einen Fall eine unbedingte Notwendigkeit ist, wird im anderen zu einem nachträglichen Ornament, das sich oft erst bei der Aufftührung einstellt, den qualifizierten Solosänger voraussetzt und auf die musikalischen Zentren Italiens konzentriert war. Der Artikel versucht zu klären, wie sich das genuin instrumentale, allgemein verbreitete Tastenspiel auf die spezielle Verzierungskunst des Sängers auswirkt, dessen primäre Aufgabe es ist, Sprache musikalisch zu vermitteln.

One Family's Struggles with Hepatitis B

Medline Plus

Full Text Available ... immunizations about immunizations current news Flu's Gonna Lose hepatitis a & b vaccines im/sq how to do kids ... cme Immunizations Hepatitis B One family's struggles with hepatitis B We provide this video in a variety of formats and lengths for use by ...

Seismic Calibration of Group 1 IMS Stations in Eastern Asia for Improved IDC Event Location

National Research Council Canada - National Science Library

Murphy, J. R; Rodi, W. L; Johnson, M; Sultanov, J. D; Bennett, T. J; Toksoz, M. N; Ovtchinnikov, V; Barker, B. W; Rosca, A. M; Shchukin, Y

2006-01-01

.... In order to establish a robust nuclear test monitoring capability, it is necessary to calibrate the IMS seismic stations used in monitoring, to account for systematic deviations from the nominal travel time curves...

A Management Tool for Improvement (Improving) IMS Stations Performance

International Nuclear Information System (INIS)

Mohammad, D.; Pantin, A.; Quintana, E.

2011-01-01

IMS-Maintenance is a software under development by the personnel of ARN-CTBT office, intended for the technical management of IMS stations under ARN's responsibility. This software integrates the whole control of the equipment in an IMS station, including the management of consumables used in daily or periodic operation. It permits an easy retrieval (access) of the technical features, suppliers, etc. of each item of the equipment, as well as its maintenance history and scheduled task. Although this project is still in a starting phase, a preliminary version of this software is being used in radionuclide station RN01 (Buenos Aires), having already demonstrated its usefulness and potential for the improvement of IMS station management. (authors)

Radiological information management system (RadIMS)

International Nuclear Information System (INIS)

Oesterling, R.G.; Marko, S.A.; Tschaeche, A.N.

1991-01-01

Westinghouse Idaho Nuclear Company, Inc. (WINCO) is developing and implementing an information management system, known as RadIMS, to track and record personnel exposure to ionizing radiation. RadIMS has been designed to fulfill all the requirements of US Department of Energy (USDOE) Order 5480.11, ''Radiation Protection for Occupational Workers.'' This Order requires the contractor to maintain detailed radiation exposure records on all individuals who work at the facility. These records must be retrievable for the entire working life of the individual and be available to other USDOE contractors on request. To meet these general needs, RadIMS provides for retrieval of detailed, comprehensive individual exposure histories as well as the usual online interactions to accomplish day-today radiation protection operations. These two extremes of functionality require different approaches in the WINCO computing environment. The exposure histories include database text, paper, microfilm, and electronic bitmaps

Radiological information management system (RadIMS)

Energy Technology Data Exchange (ETDEWEB)

Oesterling, R.G.; Marko, S.A.; Tschaeche, A.N.

1991-08-19

Westinghouse Idaho Nuclear Company, Inc. (WINCO) is developing and implementing an information management system, known as RadIMS, to track and record personnel exposure to ionizing radiation. RadIMS has been designed to fulfill all the requirements of US Department of Energy (USDOE) Order 5480.11, Radiation Protection for Occupational Workers.'' This Order requires the contractor to maintain detailed radiation exposure records on all individuals who work at the facility. These records must be retrievable for the entire working life of the individual and be available to other USDOE contractors on request. To meet these general needs, RadIMS provides for retrieval of detailed, comprehensive individual exposure histories as well as the usual online interactions to accomplish day-today radiation protection operations. These two extremes of functionality require different approaches in the WINCO computing environment. The exposure histories include database text, paper, microfilm, and electronic bitmaps.

Radiological information management system (RadIMS)

Energy Technology Data Exchange (ETDEWEB)

Oesterling, R.G.; Marko, S.A.; Tschaeche, A.N.

1991-08-19

Westinghouse Idaho Nuclear Company, Inc. (WINCO) is developing and implementing an information management system, known as RadIMS, to track and record personnel exposure to ionizing radiation. RadIMS has been designed to fulfill all the requirements of US Department of Energy (USDOE) Order 5480.11, ``Radiation Protection for Occupational Workers.`` This Order requires the contractor to maintain detailed radiation exposure records on all individuals who work at the facility. These records must be retrievable for the entire working life of the individual and be available to other USDOE contractors on request. To meet these general needs, RadIMS provides for retrieval of detailed, comprehensive individual exposure histories as well as the usual online interactions to accomplish day-today radiation protection operations. These two extremes of functionality require different approaches in the WINCO computing environment. The exposure histories include database text, paper, microfilm, and electronic bitmaps.

Thermal aging of melt-spun NdFeB magnetic powder in hydrogen

International Nuclear Information System (INIS)

Pinkerton, Frederick E.; Balogh, Michael P.; Ellison, Nicole; Foto, Aldo; Sechan, Martin; Tessema, Misle M.; Thompson, Margarita P.

2016-01-01

High energy product neodymium-iron-boron (NdFeB) magnets are the premier candidate for demanding electrified vehicle traction motor applications. Injection molded (IM) or compression molded (CM) magnets made using NdFeB powders are promising routes to improve motor efficiency, cost, and manufacturability. However, IM and CM NdFeB magnets are susceptible to substantial thermal aging losses at motor operating temperatures when exposed to the automatic transmission fluid (ATF) used as a lubricant and cooling medium. The intrinsic coercivity H ci of NdFeB IM and CM magnets degrades by as much as 18% when aged for 1000 h in ATF at 150 °C, compared to a 3% loss when aged in air. Here we report aging studies of rapidly quenched NdFeB powder in air, ATF, and H 2 gas. Expansion of the NdFeB crystal lattice in both ATF and H 2 identified hydrogen dissociated from the ATF during aging and diffused into the primary NdFeB phase as the probable cause of the coercivity loss of IM and CM magnets. - Highlights: • Injection molded NdFeB magnets age rapidly in automatic transmission fluid (ATF). • Coercivity loss is not due to direct chemical reaction between ATF and the powder. • Chemical reaction with the binder does not play a major role in aging. • Hydrogen dissociates from ATF and diffuses into Nd 2 Fe 14 B, reducing coercivity.

Thermal aging of melt-spun NdFeB magnetic powder in hydrogen

Energy Technology Data Exchange (ETDEWEB)

Pinkerton, Frederick E., E-mail: frederick.e.pinkerton@gm.com [Chemical and Materials Systems Laboratory, General Motors Research and Development Center, Warren, MI 48092 (United States); Balogh, Michael P.; Ellison, Nicole [Chemical and Materials Systems Laboratory, General Motors Research and Development Center, Warren, MI 48092 (United States); Foto, Aldo [Element Materials Technology Wixom, Inc (United States); Sechan, Martin; Tessema, Misle M.; Thompson, Margarita P. [Powertrain Materials/Fluids/AMPPD Engineering and Labs, GFL VE/PT Materials Engineering, General Motors LLC, Pontiac, MI 48340 (United States)

2016-11-01

High energy product neodymium-iron-boron (NdFeB) magnets are the premier candidate for demanding electrified vehicle traction motor applications. Injection molded (IM) or compression molded (CM) magnets made using NdFeB powders are promising routes to improve motor efficiency, cost, and manufacturability. However, IM and CM NdFeB magnets are susceptible to substantial thermal aging losses at motor operating temperatures when exposed to the automatic transmission fluid (ATF) used as a lubricant and cooling medium. The intrinsic coercivity H{sub ci} of NdFeB IM and CM magnets degrades by as much as 18% when aged for 1000 h in ATF at 150 °C, compared to a 3% loss when aged in air. Here we report aging studies of rapidly quenched NdFeB powder in air, ATF, and H{sub 2} gas. Expansion of the NdFeB crystal lattice in both ATF and H{sub 2} identified hydrogen dissociated from the ATF during aging and diffused into the primary NdFeB phase as the probable cause of the coercivity loss of IM and CM magnets. - Highlights: • Injection molded NdFeB magnets age rapidly in automatic transmission fluid (ATF). • Coercivity loss is not due to direct chemical reaction between ATF and the powder. • Chemical reaction with the binder does not play a major role in aging. • Hydrogen dissociates from ATF and diffuses into Nd{sub 2}Fe{sub 14}B, reducing coercivity.

Im Wind / Mari Vallisoo ; tõlk. Gisbert Jänicke

Index Scriptorium Estoniae

Vallisoo, Mari, 1950-2013

2003-01-01

Sisu: Im Wind = Tuulega ; Zwei Frauen = Kaks naist ; In Gedanken an Aleksander Levin = aleksander Levinile mõteldes ; Jetzt im Dunkel = Nüüd pimedas ; Fragen = Küsimused ; Der Zwillingsbruder = Kaksikvend

NJP VOLUME 40 No 1B

African Journals Online (AJOL)

Prof Ezechukwu

2012-05-26

May 26, 2012 ... lus found in the soil and gastrointestinal tract of man and ... diazepam, adequate nutrition and ensuring primary im- ... peripheral nervous systems as a result of abnormal con- ... to micronutrient deficiency including calcium.

Pharmacokinetic and tolerability of i.m. disodium clodronate 200 mg/lidocaine 1%, given twice monthly, in comparison with i.m. disodium clodronate 100 mg/lidocaine 1%, given weekly, in healthy postmenopausal female patients.

Science.gov (United States)

Radicioni, Milko; Cremonesi, Giovanni; Baraldi, Enrica; Leuratti, Chiara; Mariotti, Fabrizia

2013-04-01

Clodronate is a bisphosphonate effective in the prevention and treatment of osteoporosis in postmenopausal women. Non-adherence to bisphosphonates, however, is a major issue in clinical practice. Simplifying dose regimens may increase compliance. To assess bioequivalence between an intramuscular (i.m.) clodronate 200 mg/lidocaine 1% twice-a-month formulation and a clodronate 100 mg/lidocaine 1% weekly formulation in 32 postmenopausal women. In this double-blind, randomized, two-way crossover study, test and reference formulations were administered in single dose, with a 2-week wash-out between administrations. The primary endpoint was clodronic acid cumulative excretion in the first 24 hours after injection (Xu0-24h). Cumulative excretion in the 72 hours post-dose (Xu0-72h) and maximum excretion rate (Ratemax) were also evaluated. Bioequivalence was assumed if the 90% confidence intervals (CIs) of the geometric means ratios of the dose-normalized parameters were within the 80.00 - 125.00% range. Local tolerability was evaluated. Mean Xu0-24h values were 114.03 ±23.13 mg and 55.22 ±9.73 mg for clodronate 200 mg and 100 mg. The 90% CIs for dose-normalized Xu0-24h, Xu0-72h and Ratemax ere 95 -110%, 94 -107% and 95 - 113%. Local tolerability of both treatments was good. The differences in pain intensity between formulations were not sigificantly different at most assessment times. Headache was the only treatment-related adverse event. Bioequivalence of the two formulations was confirmed in terms of dose-normalized rate and amount of clodronic acid excretion. This result, together with the favorable tolerability of the novel 200 mg formulation, suggests the possibility of reducing the number of i.m. administrations from once-a-week to twice-a-month.

[Gunnar Meyer. "Besitzende Bürger" und "Elende Sieche". Lübecks Gesellschaft im Spiegel ihrer Testamente 1400-1449] / Dennis Hortmuth

Index Scriptorium Estoniae

Hormuth, Dennis

2012-01-01

Arvustus: Gunnar Meyer. "Besitzende Bürger" und "Elende Sieche". Lübecks Gesellschaft im Spiegel ihrer Testamente 1400-1449. (Verhöffentlichungen zur Geschichte der Hansestadt Lübeck. B. 48). (Lübeck, 2010)

NJP VOLUME 40 No 1B

African Journals Online (AJOL)

Prof Ezechukwu

2012-07-23

Jul 23, 2012 ... place and alsotheir antibiotic susceptibility and therefore knowledge of the ... the purpose of this study, acute bacterial meningitis was defined as the .... bacteria during the septicaemic process, and to low im- munological ...

Coherent ambient infrasound recorded by the global IMS network

Science.gov (United States)

Matoza, R. S.; Landes, M.; Le Pichon, A.; Ceranna, L.; Brown, D.

2011-12-01

The International Monitoring System (IMS) includes a global network of infrasound arrays, which is designed to detect atmospheric nuclear explosions anywhere on the planet. The infrasound network also has potential application in detection of natural hazards such as large volcanic explosions and severe weather. Ambient noise recorded by the network includes incoherent wind noise and coherent infrasound. We present a statistical analysis of coherent infrasound recorded by the IMS network. We have applied broadband (0.01 to 5 Hz) array processing systematically to the multi-year IMS historical dataset (2005-present) using an implementation of the Progressive Multi-Channel Correlation (PMCC) algorithm in log-frequency space. We show that IMS arrays consistently record coherent ambient infrasound across the broad frequency range from 0.01 to 5 Hz when wind-noise levels permit. Multi-year averaging of PMCC detection bulletins emphasizes continuous signals such as oceanic microbaroms, as well as persistent transient signals such as repetitive volcanic, surf, or anthropogenic activity (e.g., mining or industrial activity). While many of these continuous or repetitive signals are of interest in their own right, they may dominate IMS array detection bulletins and obscure or complicate detection of specific signals of interest. The new PMCC detection bulletins have numerous further applications, including in volcano and microbarom studies, and in IMS data quality assessment.

Gruppenbezogene Menschenfeindlichkeit im Sport in Sachsen-Anhalt

OpenAIRE

Delto, Hannes; Tzschoppe, Petra

2016-01-01

Mit der Querschnittsstudie „Wir und die Anderen – Gruppenbezogene Menschenfeindlichkeit im organisierten Sport in Sachsen-Anhalt“ wurde das Syndrom Gruppenbezogener Menschenfeindlichkeit im organisierten Sport untersucht. Das Konzept der Gruppenbezogenen Menschenfeindlichkeit – ausgehend von einer Ideologie der Ungleichwertigkeit – wurde von Prof. Wilhelm Heitmeyer (Universität Bielefeld) entwickelt. Die Ergebnisse ermöglichen explizite Aussagen über Ausmaß und Ursachen Gruppenbezogener Mensc...

Freie Lerninhalte im Internet mit Studierenden recherchieren, kommentieren und kompilieren. Zur Gestaltung der online-Selbstlernangebote im hr-Funkkolleg Philosophie

Directory of Open Access Journals (Sweden)

Jakob Krebs

2017-03-01

Full Text Available Wie lassen sich online frei verfügbare Bildungsinhalte mit Studierenden so zusammenstellen, dass sie als thematisch sortierte Selbstlernmaterialien unkompliziert gefunden werden können – sei es von anderen Studierenden, interessierten Laien oder auch von Lehrkräften in Bildungsinstitutionen? Der vorliegende Werkstattbericht rekonstruiert ein Lernszenario, in dem Studierende vorhandene Materialien im Internet recherchierten, kommentierten und kompilierten, um ein Online-Zusatzangebot zu den Radiosendungen im hr-Funkkolleg Philosophie 2014/15 zu erstellen. Die Rahmenbedingungen dieser ungewöhnlichen universitären Kooperation mit dem Rundfunk werden im ersten Abschnitt vorgestellt. Der zweite Abschnitt skizziert das didaktische Design zusammen mit dem Projektstrukturplan eines produktorientierten kollaborativen Lernsettings mit Wiki-Einsatz. Im dritten Abschnitt werden der Lernerfolg bei den Studierenden sowie einige Herausforderungen benannt, die u. a. in der Abschlussevaluierung zur Sprache kamen. Der vierte Abschnitt macht die Projekterfahrungen für reguläre Lehr- und Lern-Szenarien fruchtbar, in denen nicht nur Studierende mit didaktischen Interessen durch die gemeinsame Gestaltung von Internetangeboten fachlich und methodisch profitieren können. Mit dem Bericht wird somit u. a. veranschaulicht, wie sich Ansätze von Blended, Peer-Assisted und Service Learning produktiv kombinieren lassen.

Effectiveness of onsite wastewater reuse system in reducing bacterial contaminants measured with human-specific IMS/ATP and qPCR.

Science.gov (United States)

Agidi, Senyo; Vedachalam, Sridhar; Mancl, Karen; Lee, Jiyoung

2013-01-30

Water shortages and the drive to recycle is increasing interest in reuse of reclaimed wastewater. Timely and cost-effective ways to detect fecal pollutants prior to reuse increases confidence of residents and neighbors concerned about reuse of reclaimed wastewater. The on-site wastewater treatment and reuse systems (OWTRS) used in this study include a septic tank, peat bioreactor, ClO(2) disinfection and land spray irrigation system. Bacteroides fragilis, Escherichia coli and Enterococcus spp., were tested with immunomagnetic separation/ATP bioluminescence (IMS/ATP), qPCR and culture-based methods. The results displayed a 2-log reduction in fecal bacteria in the peat bioreactor and a 5-log reduction following chloride dioxide disinfection. The fecal bacteria levels measured by IMS/ATP correlated with qPCR results: HuBac 16S (R(2) = 0.903), Bf-group 16S (R(2) = 0.956), gyrB (R(2) = 0.673), and Ent 23S (R(2) = 0.724). This is the first study in which the newly developed human-specific IMS/ATP and previously developed IMS/ATP were applied for determining OWTRS efficiency. Results of the study revealed that IMS/ATP is a timely and cost-effective way to detect fecal contaminants, and results were validated with qPCR and culture based methods. The new IMS/ATP can also be applied broadly in the detection of human-originated fecal contamination. Copyright © 2012 Elsevier Ltd. All rights reserved.

Thermische Verletzungen im Kindesalter: Eine retrospektive Kohortenstudie von 212 Fällen

OpenAIRE

Sperling, Patrik Leonhart

2012-01-01

Anhand einer retrospektiven Datenanalyse sollen Verteilungsmuster von Verbrennungen und Verbrühungen bezogen auf Alter und Geschlecht untersucht werden. Erfasst wurden 212 Patienten im Alter von 0 bis 16 Jahren betrachtet, die im Zeitraum vom 01.01.2004 bis zum 31.12.2009 auf Grund einer thermischen Verletzung stationär im Universitätsklinikum Würzburg der Julius-Maximilians-Universität Würzburg behandelt wurden. Den größten Anteil thermischer Verletzungen im Kindesalter stellen Verbrühungen ...

Information Management System (Ims) For Gender Mainstreaming In ...

African Journals Online (AJOL)

Information Management System (IMS) is an essential tool in supporting the provision of information needed for planning and decision making in any organization. Proper IMS facilitates the smooth flow of information both vertical and horizontal. This paper presents the findings of a survey on information needs of the Gender ...

Light-weight internet protocol multimedia subsystem (IMS) client: development for smart mobile devices

CSIR Research Space (South Africa)

Masonta, M

2010-11-01

Full Text Available : IP multimedia Services Identity Module J2ME: Java 2 Micro-Edition JCP: Java Community Process JSR: Java Specification Request MAGNET: My personal Adaptive Global Network MGCF: Media Gateway Control Function MIDP: Mobile Information Device...) .................................................................. 30 Figure 2.15: IMS-Communicator Screenshot (PT Inova??o, 2007) .......................................... 31 Figure 2.16: UCT IMS Client Screenshot (Waiting & Good, 2007) ......................................... 32 Figure 3.1: Sun Java WTK 2...

Calibración de imágenes de radares meteorológicos

Directory of Open Access Journals (Sweden)

Virgilio Santander Socorras Quintero

2014-04-01

Full Text Available En este documento se ilustran las técnicas de fusión de imágenes para complementar y calibrar la información meteorológica presente en imágenes de radares terrestres con el uso de imágenes satelitales meteorológicas. Para realizar la calibración de las imágenes de radares terrestres se implementó un método de fusión de imágenes basado en la herramienta matemática transformada wavelet discreta. Ya que existe una familia de wavelets, es necesario determinar cuál wavelet ofrece el mejor resultado; para esto se determina la correlación existente entre los resultados de fusión de diferentes wavelets y las imágenes uti-lizadas en cada fusión. Se define una metodología para selección de umbral global de segmentación y una metodología para realizar la calibración de las imágenes de radares terrestres. Siguiendo la metodología de calibración de imágenes, se generan algunos resultados y se muestran sus ventajas.

Spontane Mobilisierung und der Wandel kollektiver Formationen im Internet. Eine Fallstudie zur PEGIDA-Bewegung

Directory of Open Access Journals (Sweden)

Sang-hui Nam

2016-11-01

Full Text Available Der vorliegende Beitrag beschäftigt sich mit der Frage, wie sich eine aus spontaner Mobilisierung entstandene soziale Bewegung als kollektive Formation im Internet entwickelt. Da spontane Bewegungen in aller Regel nur über eine schwache kollektive Identität verfügen, werden sie bislang überwiegend als Übergangsphänomen betrachtet. Viele Studien beschäftigten sich eher mit den Folgen spontaner Mobilisierung, insbesondere der Frage, wie daraus eine nachhaltige Bewegung entstehen kann. Die kollektive Formation selbst ist bis dato weitgehend eine Blackbox geblieben. In der vorliegenden Studie widme ich mich folgenden zentralen Forschungsfragen: 1. Wie werden kollektive Formationen aus spontanen ProtestteilnehmerInnen dargestellt und generiert? 2. Wie ändern sich diese im Verlauf der Mobilisierung? Im Mittelpunkt der empirischen Analyse stehen Online-Kommentare, die eine zunehmend wichtige Rolle für soziale Bewegungen und spontane Mobilisierungsprozesse spielen. Am Beispiel von PEGIDA wird die Konstruktion einer kollektiven Formation über Live-Kommentare zu Live-Übertragungen von PEGIDA-Demonstrationen sowie deren Wandel in drei Phasen untersucht. Im ersten Schritt werden die soziotechnischen Grundlagen kollektiven Handelns im Internet erläutert. Der zweite Schritt befasst sich mit der methodischen Vorgehensweise. Im dritten Schritt werden ausgewählte Textpassagen von Online-Kommentaren analysiert. Anschließend wird der Wandel kollektiver Formationen nachgezeichnet. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs170138

Choosing the Right Free IM Providers and Clients for Your Library

Science.gov (United States)

Izenstark, Amanda K.

2009-01-01

With virtual library services increasing, public services librarians may find themselves with questions such as: What instant messaging services (IM) are available? Which IM service would best suit my patrons' needs? Which IM service best suits my library's technology profile? This column describes the features and functionality of major instant…

World-wide developments in motor vehicle inspection/maintenance (I/M) programs

Energy Technology Data Exchange (ETDEWEB)

Klausmeier, R. [Consulting Inc., Austin, TX (United States); Kishan, S. [Radian Corporation, Austin, TX (United States)

1995-12-31

Motor vehicles contribute much to urban air pollution. As a result, most governments have enacted emission standards that significantly lower pollutant emission levels from new motor vehicles. For example, vehicles built in the United States emit 95 % fewer pollutants than uncontrolled vehicles when they are new. However, studies indicate that proper maintenance is needed to obtain the full benefit of vehicle emission controls. Furthermore, there is evidence that a significant percentage of the vehicle fleet is not properly maintained. This has led to the creation of motor vehicle Inspection/Maintenance (I/M) Programs. I/M programs inspect vehicles for indications that they are emitting excessive quantities of pollutants. Vehicles that fail the inspection must be repaired in order to comply with program requirements. The first I/M programs were implemented in the United States in the early 1970s. With substantial urging from the federal government, most of the U.S. states with severe air pollution problems have implemented I/M programs. Recently, with the passage of the U.S. Clean Air Act Amendments of 1990, many states have been required to significantly upgrade the performance and coverage of their I/M programs. I/M programs also have been implemented in Europe and recently in Asia. This presentation reviews developments in I/M programs for light-duty gasoline powered vehicles. Developments in I/M programs for diesel powered vehicles are briefly described. (author)

World-wide developments in motor vehicle inspection/maintenance (I/M) programs

Energy Technology Data Exchange (ETDEWEB)

Klausmeier, R [Consulting Inc., Austin, TX (United States); Kishan, S [Radian Corporation, Austin, TX (United States)

1996-12-31

Motor vehicles contribute much to urban air pollution. As a result, most governments have enacted emission standards that significantly lower pollutant emission levels from new motor vehicles. For example, vehicles built in the United States emit 95 % fewer pollutants than uncontrolled vehicles when they are new. However, studies indicate that proper maintenance is needed to obtain the full benefit of vehicle emission controls. Furthermore, there is evidence that a significant percentage of the vehicle fleet is not properly maintained. This has led to the creation of motor vehicle Inspection/Maintenance (I/M) Programs. I/M programs inspect vehicles for indications that they are emitting excessive quantities of pollutants. Vehicles that fail the inspection must be repaired in order to comply with program requirements. The first I/M programs were implemented in the United States in the early 1970s. With substantial urging from the federal government, most of the U.S. states with severe air pollution problems have implemented I/M programs. Recently, with the passage of the U.S. Clean Air Act Amendments of 1990, many states have been required to significantly upgrade the performance and coverage of their I/M programs. I/M programs also have been implemented in Europe and recently in Asia. This presentation reviews developments in I/M programs for light-duty gasoline powered vehicles. Developments in I/M programs for diesel powered vehicles are briefly described. (author)

Respuestas faciales ante imágenes de advertencia de tabaco

Directory of Open Access Journals (Sweden)

M. A. Muñoz

Full Text Available Resumen En 2003, la Comisión Europea propuso una serie de advertencias visuales para ser incluidas en los embalajes de tabaco, con el objetivo de motivar a los fumadores a dejar de fumar y promover actitudes negativas hacia el tabaco. El objetivo de este estudio fue evaluar el impacto de las advertencias sanitarias mediante autoinformes y medidas psicofisiológicas. Cincuenta sujetos sanos (19-23 años visionaron un conjunto de treinta y seis imágenes de diferente contenido emocional y veinticuatro del banco de imágenes preventivas propuestas por la Comisión Europea. Se registró la actividad eléctrica de los músculos cigomático mayor y corrugador mientras los sujetos visionaban estas imágenes. A continuación, los participantes evaluaban las imágenes en las dimensiones de agradabilidad y activación. Los resultados muestran una mayor actividad eléctrica del musculo corrugador ante la presentación de imágenes desagradables comparadas con advertencias desagradables incluidas en los paquetes de tabaco. Estos resultados sugieren que la campaña preventiva podría beneficiarse de imágenes preventivas más impactantes, promoviendo así la activación del sistema motivacional evitativo/defensivo.

1 λ × 1.44 Tb/s free-space IM-DD transmission employing OAM multiplexing and PDM.

Science.gov (United States)

Zhu, Yixiao; Zou, Kaiheng; Zheng, Zhennan; Zhang, Fan

2016-02-22

We report the experimental demonstration of single wavelength terabit free-space intensity modulation direct detection (IM-DD) system employing both orbital angular momentum (OAM) multiplexing and polarization division multiplexing (PDM). In our experiment, 12 OAM modes with two orthogonal polarization states are used to generate 24 channels for transmission. Each channel carries 30 Gbaud Nyquist PAM-4 signal. Therefore an aggregate gross capacity record of 1.44 Tb/s (12 × 2 × 30 × 2 Gb/s) is acheived with a modulation efficiency of 48 bits/symbol. After 0.8m free-space transmission, the bit error rates (BERs) of all the channels are below the 20% hard-decision forward error correction (HD-FEC) threshold of 1.5 × 10(-2). After applying the decision directed recursive least square (DD-RLS) based filter and post filter, the BERs of two polarizations can be reduced from 5.3 × 10(-3) and 7.3 × 10(-3) to 2.2 × 10(-3) and 3.4 × 10(-3), respectively.

Programmable Oligomers Targeting 5′-GGGG-3′ in the Minor Groove of DNA and NF-κB Binding Inhibition

Science.gov (United States)

Chenoweth, David M.; Poposki, Julie A.; Marques, Michael A.; Dervan, Peter B.

2009-01-01

A series of hairpin oligomers containing benzimidazole (Bi) and imidazopyridine (Ip) rings were synthesized and screened to target 5′-WGGGGW-3′, a core sequence in the DNA binding site of NF-κB, a prolific transcription factor important in biology and disease. Five Bi and Ip containing oligomers bound to the 5′-WGGGGW-3′ site with high affinity. One of the oligomers (Im-Im-Im-Im-γ-PyBi-PyBi-β-Dp) was able to inhibit DNA binding by the transcription factor NF-κB. PMID:17095230

Foxp1 controls mature B cell survival and the development of follicular and B-1 B cells

Science.gov (United States)

Patzelt, Thomas; Keppler, Selina J.; Gorka, Oliver; Thoene, Silvia; Wartewig, Tim; Reth, Michael; Förster, Irmgard; Lang, Roland; Buchner, Maike; Ruland, Jürgen

2018-01-01

The transcription factor Foxp1 is critical for early B cell development. Despite frequent deregulation of Foxp1 in B cell lymphoma, the physiological functions of Foxp1 in mature B cells remain unknown. Here, we used conditional gene targeting in the B cell lineage and report that Foxp1 disruption in developing and mature B cells results in reduced numbers and frequencies of follicular and B-1 B cells and in impaired antibody production upon T cell-independent immunization in vivo. Moreover, Foxp1-deficient B cells are impaired in survival even though they exhibit an increased capacity to proliferate. Transcriptional analysis identified defective expression of the prosurvival Bcl-2 family gene Bcl2l1 encoding Bcl-xl in Foxp1-deficient B cells, and we identified Foxp1 binding in the regulatory region of Bcl2l1. Transgenic overexpression of Bcl2 rescued the survival defect in Foxp1-deficient mature B cells in vivo and restored peripheral B cell numbers. Thus, our results identify Foxp1 as a physiological regulator of mature B cell survival mediated in part via the control of Bcl-xl expression and imply that this pathway might contribute to the pathogenic function of aberrant Foxp1 expression in lymphoma. PMID:29507226

Jung und Alt im Dialog

Directory of Open Access Journals (Sweden)

Caroline Baetge

2012-04-01

Full Text Available Rezension zu: Kupser, Thomas, und Ida Pöttinger, Hrsg. 2011. Mediale Brücken: Generationen im Dialog durch aktive Medienarbeit. Gesellschaft - Altern - Medien 3. München: kopaed.

Developing an effective IM/IT strategy.

Science.gov (United States)

Kramer, Sarah; Walker, Joanne; Falk, Will

2009-01-01

Healthcare organizations and systems around the world lag far behind banking, manufacturing, travel and other industries in their use of information management/information technology (IM/IT) to deliver high-quality products and services. Across Canada, healthcare organizations, as well as governments, understand that information and information technology are needed to deliver quality care and to sustain our publicly funded health system. However, insufficient funding, few experienced resources, lack of strong leadership and absence of clear business/clinical rationale have restricted innovation and advancement in the use of IM/IT to improve healthcare delivery and patient outcomes.

PENERAPAN SYARI’AH DI NEGARA MODERN (Analisis Ijtihad Pemikiran Abdullahi Ahmed An-Na’im

Directory of Open Access Journals (Sweden)

Ahmad Bahrur Rozi

2016-02-01

Full Text Available Islam is a holistic religion. It means that Islam is a religion which does not only focus on the vertical relation between humans and God but also contains rules of horizontal relation between man and man. Laws with social characteristic lead to the existence of a power as the doer, such as the application of all the punishments and public rewards (al-hudûd wa al-'uqûbât. This article analyzes the thought of Abdullahi Ahmed An--Na’im about syari’ah reformation which is relevant to the constitutionalism standard, criminal law, international law and modern human right, a vision of “syariat modern” which is suitable with the nation state concept which beyond  the offering of the Nation of fundamentalist syariah and the offering of Modern Islamic Nation. The method used by Abdullahi Ahmed An--Na’im is the renewal method which is said as legalized evolution with hermeneutic as the main tool to reach the purpose and normative implication of the text as al-Qur’an. According to Abdullahi Ahmed An--Na’im, the failure of syari’ah application in modern country caused by the crisis on the traditional syari’ah methodology which became its base. Therefore, new syari’ah formulation is needed to be built on the new base. Naskh concept which is initiated by An-Na’im is for answering this crisis.Copyright (c 2016 by Al-Ihkam. All right reservedDOI: 10.19105/al-ihkam.v10i2.734

Real-time resource availability signalling in IMS-based networks

NARCIS (Netherlands)

Ozcelebi, T.; Radovanovic, I.; Lukkien, J.J.

2007-01-01

The emerging converged IP multimedia subsystem (IMS) allows the use of unlicensed, nondedicated and nondeterministic computer access networks for delivering IP multimedia services. To provide end-to-end quality-of-service (QoS) over such networks combined with the IMS core network, for resource

Gerbstoffe aus Potentilla officinalis wirken entzündungshemmend im UV-Erythem-Test und bei Anwendung auf atopischer Haut.

Science.gov (United States)

Hoffmann, Julia; Wölfle, Ute; Schempp, Christoph M; Casetti, Federica

2016-09-01

Das Rhizom von Potentilla officinalis (PO) ist reich an Gerbstoffen und wird traditionell zur äußerlichen Behandlung von Entzündungen der Haut und der Schleimhäute verwendet. Ziel der vorliegenden Arbeit war die Bestätigung der antiinflammatorischen Eigenschaften von PO mittels eines UV-Erythem-Tests und einer klinischen Anwendungsstudie bei atopischer Haut. Die antiinflammatorische Wirkung eines PO-Extrakts (standardisiert auf 2 % Trockensubstanz) wurde in einer prospektiven, randomisierten, placebokontrollierten Doppelblindstudie mit 40 gesunden Erwachsenen im UV-Erythem-Test im Vergleich zu 1 % Hydrocortisonacetat untersucht. Im Rahmen einer prospektiven nicht kontrollierten Studie wurde die Wirkung und Verträglichkeit der 2 % PO-Creme an zwölf Erwachsenen und zwölf Kindern mit atopischer Haut nach Anwendung über zwei Wochen in einem definierten Testareal anhand eines Teil-SCORAD untersucht. Zusätzlich wurde die Beeinflussung der Hautrötung im Testareal photometrisch gemessen. Im UV-Erythem-Test zeigte die PO-Creme eine signifikante Reduktion des Erythemindex im Vergleich zum Vehikel. Die antiinflammatorische Wirkung des Verums entsprach der der 1 % Hydrocortisonacetat-Creme. Die klinische Studie bei Atopikern zeigte eine signifikante Abnahme des Teil-SCORAD und des Erythems im Testareal. Es wurden keine Unverträglichkeitsreaktionen beobachtet. PO als 2%ige Zubereitung besitzt entzündungshemmende Eigenschaften und ist wirksam und gut verträglich auf atopischer Haut. © 2016 Deutsche Dermatologische Gesellschaft (DDG). Published by John Wiley & Sons Ltd.

Medida Interpessoal de Psicopatia (IM-P: estudo preliminar no contexto brasileiro Interpersonal Measure of Psychopathy (IM-P: preliminary study in the Brazilian context

Directory of Open Access Journals (Sweden)

Tárcia Rita Davoglio

2011-01-01

Full Text Available INTRODUÇÃO: A observação direta do comportamento interpessoal é um recurso importante na descrição e diagnóstico da personalidade psicopática. A Medida Interpessoal de Psicopatia (Interpersonal Measure of Psychopathy, IM-P é um instrumento psicométrico composto por 21 itens, desenvolvido para ser utilizado em associação com outras escalas de avaliação da psicopatia. Foca-se, especificamente, nos comportamentos interpessoais e aspectos não verbais evidentes na interação do entrevistador com indivíduos que apresentam características psicopáticas. OBJETIVO: Descrever resultados preliminares sobre a investigação de aspectos interpessoais da psicopatia mediante a utilização da IM-P, incluindo as etapas de tradução/adaptação e avaliação de confiabilidade interavaliadores da IM-P, em uma amostra de adolescentes brasileiros. MÉTODO: Trata-se de estudo transversal, descritivo e correlacional realizado com 20 adolescentes masculinos cumprindo medida socioeducativa com privação de liberdade na Região Metropolitana de Porto Alegre (RS. Após os procedimentos de tradução da escala, treinamento dos pesquisadores e teste piloto por meio de uma entrevista semiestruturada, a IM-P foi pontuada por três juízes independentes. RESULTADOS: Os resultados estatísticos, obtidos através do coeficiente de concordância de Kendall, revelaram grau de concordância interavaliadores elevado e satisfatório para os escores totais da IM-P (W = 0,84; p INTRODUCTION: The direct observation of interpersonal behaviors is an important resource in the description and diagnosis of the psychopathic personality. The Interpersonal Measure of Psychopathy (IM-P is a psychometric instrument comprised of 21 items, designed to be applied in association with other instruments that also evaluate psychopaths. It focuses specifically on interpersonal and non-verbal behaviors that become evident during the interaction between the interviewer and individuals

Dark Energy Survey Year 1 Results: The Impact of Galaxy Neighbours on Weak Lensing Cosmology with im3shape

Energy Technology Data Exchange (ETDEWEB)

Samuroff, S.; et al.

2017-08-04

We use a suite of simulated images based on Year 1 of the Dark Energy Survey to explore the impact of galaxy neighbours on shape measurement and shear cosmology. The hoopoe image simulations include realistic blending, galaxy positions, and spatial variations in depth and PSF properties. Using the im3shape maximum-likelihood shape measurement code, we identify four mechanisms by which neighbours can have a non-negligible influence on shear estimation. These effects, if ignored, would contribute a net multiplicative bias of $m \\sim 0.03 - 0.09$ in the DES Y1 im3shape catalogue, though the precise impact will be dependent on both the measurement code and the selection cuts applied. This can be reduced to percentage level or less by removing objects with close neighbours, at a cost to the effective number density of galaxies $n_\\mathrm{eff}$ of 30%. We use the cosmological inference pipeline of DES Y1 to explore the cosmological implications of neighbour bias and show that omitting blending from the calibration simulation for DES Y1 would bias the inferred clustering amplitude $S_8\\equiv \\sigma_8 (\\Omega _\\mathrm{m} /0.3)^{0.5}$ by $2 \\sigma$ towards low values. Finally, we use the hoopoe simulations to test the effect of neighbour-induced spatial correlations in the multiplicative bias. We find the impact on the recovered $S_8$ of ignoring such correlations to be subdominant to statistical error at the current level of precision.

Address Translation Problems in IMS Based Next Generation Networks

Directory of Open Access Journals (Sweden)

Balazs Godor

2006-01-01

Full Text Available The development of packed based multimedia networks reached a turning point when the ITU-T and the ETSIhave incorporated the IMS to the NGN. With the fast development of mobile communication more and more services andcontent are available. In contrast with fix network telephony both the services and the devices are personalized in the “mobileworld”. Services, known from the Internet - like e-mail, chat, browsing, presence, etc. – are already available via mobiledevices as well. The IMS originally wanted to exploit both the benefits of mobile networks and the fancy services of theInternet. But today it is already more than that. IMS is the core of the next generation telecommunication networks and abasis for fix-mobile convergent services. The fact however that IMS was originally a “mobile” standard, where IPv6 was notoddity generated some problems for the fix networks, where IPv4 is used. In this article I give an overview of these problemsand mention some solutions as well.

Odontojen enfeksiyon ile karışan kemik içi yerleşimli mandibuler hemanjiom

OpenAIRE

Zeytinoğlu, Mert; Ünal, Taha; Efeoğlu, Fatma Bahar Sezer Candan

2011-01-01

Kemik içi yerleşimli mandibuler hemanjiom oral kavitede nadir görϋlϋr. En sık etkilenen yüz kemikleri mandibula, maksilla ve burun kemikleridir. Marjinal periodontitisli bir alt bϋyϋk azı dişinin komşuluğunda izlenen ve kemik içi yerleşimli bir mandibuler hemanjiom olgusu sunulmaktadır. İlgili diş ve lezyon lokal anestezi altında eksize edilmiştir. Histopatolojik tetkikte hϋcresel atipi veya mitotik aktivite saptanmamıştır. Bu olgunun yanıltıcı hikâyesi ve klinik bulguları radyografik görϋnϋm...

Rezension zu: Torsten Linke: Sexualität und Familie. Möglichkeiten sexueller Bildung im Rahmen erzieherischer Hilfen. Gießen: Psychosozial Verlag 2015.

OpenAIRE

Marie Springborn

2015-01-01

Im ersten Band der Reihe „Angewandte Sexualwissenschaft“ führt Torsten Linke in theoretische Grundlagen und Termini der sexuellen Bildung in der Sozialen Arbeit ein, analysiert Ergebnisse der Studie „PARTNER 4 - Jugendsexualität 2013“ und liefert Ansätze für die praktische Arbeit im Bereich der sexuellen Bildung und Beratung. Der analytische Fokus liegt dabei auf der Sozialisationsinstanz Familie, die in der psychosexuellen Entwicklung von Kindern und Jugendlichen westlicher Gesellschaften, b...

Gesundheit und Pflege im Alter

OpenAIRE

Pfaff, Martin

1989-01-01

Gesundheit und Pflege im Alter : d. Gesundheitsreformgesetz (GRG) ; Möglichkeiten, Grenzen u. weitere Vorschläge / Martin Pfaff ; Klaus Deimer. - In: Expertengespräch "Pflege in der Familie". - Augsburg, 1989. - Getr. Zählung

Federal Workforce: Attrition Rates at Ex-Im Bank and Similar Agencies

National Research Council Canada - National Science Library

Hess, James

1997-01-01

.... Financing and protection provided by Ex-Im Bank includes (1) loans to foreign buyers of U.S. exports, (2) loan guarantees to commercial lenders providing repayment protection for loans to foreign buyers...

Digitalisierung im Verteilnetz: Evolution oder Revolution anhand konkreter Beispiele

Science.gov (United States)

Krone, Oliver; Bachmann, Maurus

Durch die Integration der neuen erneuerbaren Energien steht das Stromnetz vor großen Herausforderungen. Das Energiesystem als Gesamtes und die Verteilnetze im Speziellen werden smart. Anhand konkreter Beispiele wird aufgezeigt, wie die Digitalisierung im Elektrizitätsnetz voranschreitet. Diese Entwicklung ist eine Evolution, nicht aber eine Revolution.

Incidência de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em produtos de milho Occurrence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in corn products

Directory of Open Access Journals (Sweden)

Luciane Mie Kawashima

2006-09-01

Full Text Available Levantamentos de ocorrência de micotoxinas em alimentos foram realizados nas últimas duas décadas nas regiões Sudeste e Sul do Brasil. Levantamentos em alimentos comercializados em outras regiões têm-se limitado a aflatoxinas em amendoim e castanhas do Brasil. O presente trabalho pesquisou a presença de fumonisina B1, aflatoxinas B1, B2, G1 e G2, ocratoxina A e zearalenona em 74 amostras de produtos a base de milho adquiridas no comércio da cidade de Recife, PE, durante o período de 1999 a 2001. Fumonisina B1 foi determinada por cromatografia líquida de alta eficiência com detecção por fluorescência e as demais toxinas foram determinadas por cromatografia em camada delgada. Fumonisina B1 foi encontrada em 94,6% das amostras em concentrações variando de 20 a 8600 µg/kg. Apenas 5 amostras continham aflatoxina B1 e o teor máximo encontrado foi 20 µg/kg. Duas amostras ultrapassaram o limite de 20 µg/kg para a somatória das aflatoxinas B1, B2, G1 e G2 (farinha de milho pré-cozida com 21,5 µg/kg e quirera (xerém com 23,3 µg/kg. As aflatoxinas G1 e G2, ocratoxina A e zearalenona não foram detectadas em nenhuma das amostras. Todas as amostras contaminadas com aflatoxinas também apresentaram fumonisina B1.Research concerning the presence of mycotoxin in food has been conducted in the Southwest and South regions of Brazil over the last two decades. Research in other regions has been limited to aflatoxin in peanuts and Brazil nuts. The aim of this work is to study the presence of fumonisin B1, aflatoxins B1, B2, G1, and G2, ochratoxin A and zearalenone in 74 samples of corn products acquired in shops and food markets in the city of Recife (PE from 1999 to 2001. Fumonisin B1 was determined by high performance liquid chromatography and fluorescence was detected. The other toxins were determined by thin layer chromatography. Fumonisin B1 was found in 94.6% of the samples in levels from 20 to 8600 µg/kg. Only 5 samples contained

Collaborative Research: Calibration for IMS Stations in Eastern Asia

Science.gov (United States)

2007-07-01

Atomnaya Energia , Vol.87, Issue 3, 1989 (in Russian). 142 BondAr, I. Combining 1-D models for regional calibration, in Proceedings of a Workshop on IMS...Zelentsov and V.N. Mikhailov, Characteristics of 96 underground nuclear explosions at the Semipalatinsk Test Site, Atomaya Energia , (in Russian), Vol. 67

THOR Ion Mass Spectrometer instrument - IMS

Science.gov (United States)

Retinò, Alessandro; Kucharek, Harald; Saito, Yoshifumi; Fraenz, Markus; Verdeil, Christophe; Leblanc, Frederic; Techer, Jean-Denis; Jeandet, Alexis; Macri, John; Gaidos, John; Granoff, Mark; Yokota, Shoichiro; Fontaine, Dominique; Berthomier, Matthieu; Delcourt, Dominique; Kistler, Lynn; Galvin, Antoniette; Kasahara, Satoshi; Kronberg, Elena

2016-04-01

Turbulence Heating ObserveR (THOR) is the first mission ever flown in space dedicated to plasma turbulence. Specifically, THOR will study how turbulent fluctuations at kinetic scales heat and accelerate particles in different turbulent environments within the near-Earth space. To achieve this goal, THOR payload is being designed to measure electromagnetic fields and particle distribution functions with unprecedented resolution and accuracy. Here we present the Ion Mass Spectrometer (IMS) instrument that will measure the full three-dimensional distribution functions of near-Earth main ion species (H+, He+, He++ and O+) at high time resolution (~ 150 ms for H+ , ~ 300 ms for He++) with energy resolution down to ~ 10% in the range 10 eV/q to 30 keV/q and angular resolution ~ 10°. Such high time resolution is achieved by mounting multiple sensors around the spacecraft body, in similar fashion to the MMS/FPI instrument. Each sensor combines a top-hat electrostatic analyzer with deflectors at the entrance together with a time-of-flight section to perform mass selection. IMS electronics includes a fast sweeping high voltage board that is required to make measurements at high cadence. Ion detection includes Micro Channel Plates (MCP) combined with Application-Specific Integrated Circuits (ASICs) for charge amplification, discrimination and time-to-digital conversion (TDC). IMS is being designed to address many of THOR science requirements, in particular ion heating and acceleration by turbulent fluctuations in foreshock, shock and magnetosheath regions. The IMS instrument is being designed and will be built by an international consortium of scientific institutes with main hardware contributions from France, USA, Japan and Germany.

Die Rule of Law im Völker- und im Europarecht – aktuelle Probleme. Gegenwärtige Herausforderungen und Chancen für die EU als eine "Union des Rechts"

Directory of Open Access Journals (Sweden)

Andreas J. Kumin

2015-10-01

Full Text Available Bei diesem für die Schriftfassung geringfügig adaptierten Artikel handelt es sich um die am 5. März 2015 in Graz gehaltene Antrittsvorlesung eines Praxisprofessors, der im Hauptberuf Leiter der Abteilung für Europarecht im Völkerrechtsbüro des österreichischen Außenministeriums ist. Im Anschluss an den Beitrag von Helmut Tichy (in ALJ 1/2015, 176–185, der sich auf das Völkerrecht und die internationalen Beziehungen konzentriert, setzt sich der vorliegende Artikel mit aktuellen Herausforderungen und Chancen der EU als „Union des Rechts“ auseinander. Dabei wird auf die Stärkung der Wahrung der Grundwerte und Rechtsstaatlichkeit in den EU-Mitgliedstaaten, den EU-Beitritt zur Europäischen Menschenrechtskonvention, die Sicherung einer wirksamen und leistungsfähigen EU-Gerichtsbarkeit sowie die Gewährleistung einer angemessenen demokratischen Mitbestimmung auf allen Stufen der Rechtsetzung eingegangen.

Experimental demonstration of polar coded IM/DD optical OFDM for short reach system

Science.gov (United States)

Fang, Jiafei; Xiao, Shilin; Liu, Ling; Bi, Meihua; Zhang, Lu; Zhang, Yunhao; Hu, Weisheng

2017-11-01

In this paper, we propose a novel polar coded intensity modulation direct detection (IM/DD) optical orthogonal frequency division multiplexing (OFDM) system for short reach system. A method of evaluating the channel signal noise ratio (SNR) is proposed for soft-demodulation. The experimental results demonstrate that, compared to the conventional case, ∼9.5 dB net coding gain (NCG) at the bit error rate (BER) of 1E-3 can be achieved after 40-km standard single mode fiber (SSMF) transmission. Based on the experimental result, (512,256) polar code with low complexity and satisfactory BER performance meets the requirement of low latency in short reach system, which is a promising candidate for latency-stringent short reach optical system.

Aggregation und Management von Metadaten im Kontext von Europeana

Directory of Open Access Journals (Sweden)

Gerda Koch

2017-09-01

Full Text Available Mit dem In-Beziehung-Setzen und Verlinken von Daten im Internet wird der Weg zur Umsetzung des semantischen Webs geebnet. Erst die semantische Verbindung von heterogenen Datenbeständen ermöglicht übergreifende Suchvorgänge und späteres „Machine Learning“. Im Artikel werden die Aktivitäten der Europäischen Digitalen Bibliothek im Bereich des Metadatenmanagements und der semantischen Verlinkung von Daten skizziert. Dabei wird einerseits ein kurzer Überblick zu aktuellen Forschungsschwerpunkten und Umsetzungsstrategien gegeben, und darüber hinaus werden einzelne Projekte und maßgeschneiderte Serviceangebote für naturhistorische Daten, regionale Kultureinrichtungen und Audiosammlungen beschrieben.

Der Tatort im studienbegleitenden Deutschunterricht ab B2. Potenziale für heterogene Studierendengruppen im nichtdeutschsprachigen Raum

Directory of Open Access Journals (Sweden)

Michael Seyfarth

2016-04-01

Full Text Available Aktuelle Diskussionen zum studienbegleitenden Deutschunterricht verdeutlichen die Notwendigkeit danach, sich bei curricularen Überlegungen sowohl an institutionellen Rahmenbedingungen als auch an spezifischen Bedürfnissen der Studierenden zu orientieren. Da Lehrwerke den damit einhergehenden Anforderungen nach Offenheit und Adaptierbarkeit nicht gerecht werden können, sind mittelfristig alternative Konzepte gefragt, die es ermöglichen, im Zuge curricularer Überlegungen die notwendige Kohärenz zwischen einzelnen Unterrichtseinheiten herzustellen und dennoch eine flexible Anpassung an konkrete Lernkontexte zu erlauben. Der vorliegende Beitrag stellt ein solches Konzept vor. Ausgehend von der Arbeit am Tatort werden drei Lernbereiche vorgestellt, die neben der Arbeit am Film auch die Arbeit an angrenzenden Themen und Texten sowie darauf aufbauend die Entwicklung studienbegleitender kommunikativer Handlungskompetenz vorsehen.  Current discussions on teaching German alongside the core subjects at university show the necessity to consider both institutional requirements and the students' individual goals when establishing teaching objectives. Existing text books, however, suffer from an overly tight structure that doesn’t allow the instructor to use additional material in order to focus on the specific needs of the students in a suitable way. Flexible concepts are needed which serve as a framework and which can be realized with texts and tasks focusing on what is required by a specific learning context. This paper presents such an approach, using the German feature film Tatort. Besides ideas for working with the audiovisual material we will present opportunities that come along with the various texts and discussions in media and social networks arising around the film as well as ways for combining these aspects with developing language skills for the academic context.

Representing adaptive and adaptable Units of Learning. How to model personalized eLearning in IMS Learning Design

NARCIS (Netherlands)

Burgos, Daniel; Tattersall, Colin; Koper, Rob

2006-01-01

Burgos, D., Tattersall, C., & Koper, E. J. R. (2007). Representing adaptive and adaptable Units of Learning. How to model personalized eLearning in IMS Learning Design. In B. Fernández Manjon, J. M. Sanchez Perez, J. A. Gómez Pulido, M. A. Vega Rodriguez & J. Bravo (Eds.), Computers and Education:

Exemplary subsurface geothermal projects in the western part of Germany; Beispiele zur Nutzung oberflaechennaher Geothermie im Westen Deutschlands

Energy Technology Data Exchange (ETDEWEB)

Sanner, B.; Mands, E. [UbeG GbR, Wetzlar (Germany); Kohlsch, O. [EWS Erdwaerme-Systemtechnik GmbH, Delbrueck (Germany)

2004-12-01

During the past few years, several projects involving ground source heat pumps were carried out in western Germany, especially in the Rhine-Main and Rhine-Ruhr-Sieg region including the cities of Frankfurt and Cologne. Some of the project partners are big names in industry, e.g. an office building of PhilipsSparte APD at Wetzlar and the museum building of chocolate producer Ritter Sport. Other projects are sited in rural regions, from the Black Forest to the Weserbergland hills. The contribution presents several interesting projects, e.g. the police headquarters building at Bonn (right bank, groundwater use) and the office building of the Federal Office of Environmental protection, also at Bonn (left bank, geothermal probles), and three school buildings in the Frankfurt/Main region at Glashuetten, Bad Homburg-Oberstedten and Usingen-Eschbach. (orig.) [German] In den letzten Jahren wurden im Westen Deutschlands eine ganze Reihe groesserer Projekte mit erdgekoppelten Waermepumpen verwirklicht, besonders im Rhein-Main-Gebiet und im Rhein-Ruhr-Sieg-Gebiet einschliesslich der Grossstaedte Frankfurt und Koeln. Zu den Bauherren zaehlen inzwischen auch bekannte Namen der deutschen Industrie. So wird in Wetzlar ein Buerogbaeude der PhilipsSparte APD mit Erdwaermesonden ausgeruestet, und das Museum des Schokoladenherstellers Ritter Sport wird auf Energiepfaehlen stehen. Abe auch im laendlichen Raum sind interessante Anlagen entstanden, vom Schwarzwald bis ins Weserbergland. Im Folgenden werden einige interessante Beispiele vorgestellt. Dabei sind Projekte in der Ausfuehrungsphase wie z.B. das Polizeipraesidium in Bonn (rechts des Rheins mit Grundwassernutzung), oder das Bundesamt fuer Naturschutz in Bonn, diesmal auf der linken Rheinseite und mit Erdwaermesonden. In Ausfuehrungn bzw. fertiggestellt sind auch Erdwaermesonden fuer 3 Schulen im Raum Frankfurt:/Main, in Glashuetten, Bad Homburg-Oberstedten und Usingen-Eschbach. (orig.)

Sexting im Schulumfeld

Directory of Open Access Journals (Sweden)

Barbara Buchegger

2015-03-01

Full Text Available Wir wollten es einfach wissen. Wie steht es nun mit diesem "Sexting" – also der Übermittlung von Nacktaufnahmen, die Jugendliche untereinander teilen? Stimmt unser Eindruck aus den Workshops in Schulen, dass es bereits ein "übliches Verhalten" der Jugendlichen geworden ist? Saferinternet.at hat im November/Dezember 2014 eine Studie durch das Institut für Jugendkulturforschung rund um das Thema "Sexting" in Auftrag gegeben.

A two-stage extraction procedure for insensitive munition (IM) explosive compounds in soils.

Science.gov (United States)

Felt, Deborah; Gurtowski, Luke; Nestler, Catherine C; Johnson, Jared; Larson, Steven

2016-12-01

The Department of Defense (DoD) is developing a new category of insensitive munitions (IMs) that are more resistant to detonation or promulgation from external stimuli than traditional munition formulations. The new explosive constituent compounds are 2,4-dinitroanisole (DNAN), nitroguanidine (NQ), and nitrotriazolone (NTO). The production and use of IM formulations may result in interaction of IM component compounds with soil. The chemical properties of these IM compounds present unique challenges for extraction from environmental matrices such as soil. A two-stage extraction procedure was developed and tested using several soil types amended with known concentrations of IM compounds. This procedure incorporates both an acidified phase and an organic phase to account for the chemical properties of the IM compounds. The method detection limits (MDLs) for all IM compounds in all soil types were regulatory risk-based Regional Screening Level (RSL) criteria for soil proposed by the U.S. Army Public Health Center. At defined environmentally relevant concentrations, the average recovery of each IM compound in each soil type was consistent and greater than 85%. The two-stage extraction method decreased the influence of soil composition on IM compound recovery. UV analysis of NTO established an isosbestic point based on varied pH at a detection wavelength of 341 nm. The two-stage soil extraction method is equally effective for traditional munition compounds, a potentially important point when examining soils exposed to both traditional and insensitive munitions. Copyright © 2016 Elsevier Ltd. All rights reserved.

Construction of three metal-organic frameworks based on multifunctional T-shaped tripodal ligands, H3PyImDC

KAUST Repository

Jing, Xuemin

2010-08-04

Three novel metal-organic frameworks (MOFs), |(C3H 7NO)2(H2O)|[Zn3(C10H 5N3O4)3(C3H 7NO)2] (1), |(H2O)5(H 3O)(NO3)|[Nd2(C10H5N 3O4)3(H2O)4] (2), and |(H2O)2|[Nd3(C10H5N 3O4)3(C10H4N 3O4)] (3), based on the T-shaped tripodal ligands 2-(pyridine-4-yl)-1H-4,5-imidazoledicarboxylic acid and 2-(pyridine-3-yl)-1H-4, 5-imidazoledicarboxylic acid (H3PyImDC), have been constructed under solvo-/hydrothermal conditions. The diverse coordination modes of H 3PyImDC ligands have afforded the assembly of three novel compounds. In compound 1, two oxygen atoms and three nitrogen atoms of the H 3PyImDC ligand, a T-shaped linker, coordinate to two zinc centers to form a novel bbm net with two distinct channels along the [100] and [001] directions. In compound 2, H3PyImDC ligands coordinate to neodymium centers to form a ladder-like chain which then interacts with a water molecules chain via hydrogen-bondings to construct a 3D supermolecular structure. In compound 3, H3PyImDC ligands, a T-shaped linker, coordinate to neodymium centers to form a (3,6)-connected net with an ant topology. In compounds 1-3, the two H3PyImDC ligands exhibit different coordination modes with zinc and neodymium centers, which afforded the expected structural diversity. Additionally, all three compounds exhibit strong fluorescence emissions in the solid state at room temperature. © 2010 American Chemical Society.

Medienpädagogische Aufgabenfelder hinsichtlich der Visualität im digitalen Zeitalter. Desiderate im Umgang mit visuellen Medienkulturen

Directory of Open Access Journals (Sweden)

Petra Missomelius

2017-04-01

Full Text Available Die bildungskulturell leitende Funktion des Buches diffundiert im digitalen Zeitalter mobiler und transversaler Systeme von Netzwerkmedien. Zudem sind soziokulturelle Lebenswelten wie Bildungsinstitutionen, Familie und Peers durch Heterogenität gekennzeichnet. Indem auch diese Teil des Geflechts medienkultureller Architekturen werden, geraten ehemals gültige Unterscheidungsparameter wie explizites und implizites, formelles und informelles Wissen ins Wanken. Grenzziehungen und konkurrierende Auffassungen gegenüber diesen, vormals als der Bildung entgegengesetzt wahrgenommenen, Bereichen erweisen sich nunmehr als problematisch. So spielt Visualität im Kontext multimodal zusammengesetzter Bildungsmaterialien eine zunehmende Rolle und wird als Möglichkeit des Umgangs mit Komplexität eingesetzt. Wenngleich somit die Zurückhaltung gegenüber (Bewegt-Bildmedien in der pädagogischen Praxis schwindet, so haben sich mit der Digitalisierung medienkulturell bedeutsame Felder eröffnet, welche erziehungswissenschaftlicher Beachtung bedürfen. Eine sich der Komplexität digitaler Medienkulturen stellende Medienpädagogik bringt mit sich, dass auch Funktion und Gebrauch visueller Medien im Kontext von Bildungsprozessen reflektiert stattfinden. Medienpädagogisch informiertes Agieren in visuellen Medienkulturen ist darüber hinaus heute gerade deshalb essentiell, da es sich bei digital generierter Visualität um eine neue Qualität im Unterschied zu traditionellen Bildmedien handelt, welche der Logik der Repräsentation entsprachen. Der Beitrag thematisiert Desiderate, die sich hinsichtlich des Visuellen datenbasierter Medien für die Medienpädagogik ergeben, und geht dabei auf kommunikative Bildlichkeit, auf paradigmatische mediale Formen und auf datengestützte Wissensgenerierung ein.

Synthesis of Cyclic Py-Im Polyamide Libraries

OpenAIRE

Li, Benjamin C.; Montgomery, David C.; Puckett, James W.; Dervan, Peter B.

2013-01-01

Cyclic Py-Im polyamides containing two GABA turn units exhibit enhanced DNA binding affinity, but extensive studies of their biological properties have been hindered due to synthetic inaccessibility. A facile modular approach toward cyclic polyamides has been developed via microwave-assisted solid-phase synthesis of hairpin amino acid oligomer intermediates followed by macrocyclization. A focused library of cyclic polyamides 1–7 targeted to the androgen response element (ARE) and the estrogen...

IMS Intra- and Inter Domain End-to-End Resilience Analysis

DEFF Research Database (Denmark)

Kamyod, Chayapol; Nielsen, Rasmus Hjorth; Prasad, Neeli R.

2013-01-01

This paper evaluated resilience of the reference IMS based network topology in operation through the keys reliability parameters via OPNET. The reliability behaviors of communication within similar and across registered home IMS domains were simulated and compared. Besides, the reliability effects...

EFEKTIVITAS MEDIA PEMBELAJARAN IM3 DITINJAU DARI MOTIVASI BELAJAR

Directory of Open Access Journals (Sweden)

J. Handhika

2012-10-01

Full Text Available Penelitian ini bertujuan untuk mengetahui perbedaan penggunaan media pembelajaran IM3 berbasis flash dan media MS. Power Point terhadap prestasi belajar IPA-Fisika. Hasil penelitian  menunjukkan bahwa siswa yang diajar menggunakan media IM3 berbasis flash memberikan rata-rata prestasi lebih baik dibandingkan dengan siswa yang diajar menggunakan power point. Siswa dengan motivasi belajar tinggi menghasilkan rata-rata prestasi lebih baik daripada siswa dengan motivasi belajar rendah, serta terdapat interaksi motivasi belajar dengan media pembelajaran terhadap prestasi belajar IPA-Fisika.   This study aims to determine differences in the use of flash-based IM3 learning media and MS media. Power Point to IPA-Physics learning achievement. Results showed that students who were taught using flash-based media IM3 gives an average performance better than students who were taught using the power point. Students with high motivation to learn the average yield better performance than students with low learning motivation, and there is interaction with the medium of learning motivation toward science learning achievement-Physics.

Ausländische Direktinvestitionen und Technologietransfer im angolanischen Energiesektor

Directory of Open Access Journals (Sweden)

2016-04-01

Full Text Available Dem Zusammenhang von ausländischen Direktinvestionen (Foreign Direct Investment, FDI und Technologietransfer wird sowohl in der Forschung als auch in der politischen Analyse große Bedeutung zugeschrieben. Zahlreiche Veröffentlichungen belegen, dass FDI den Transfer von und/oder den Zugang zu Technologien erleichtert. Allerdings gibt es zu wenige empirische Studien, die diesen Zusammenhang in Bezug auf die Wirtschaft afrikanischer Staaten untersuchen. Der Autor will diese Lücke zu einem kleinen Teil schließen, indem er die Bedeutung des Technologietransfers durch den Zufluss von FDI im Energiesektor Angolas ermittelt. Seine Analyse basiert auf qualitativer Forschung in Angola im Jahr 2014. Er zeigt auf, dass sich die Erzeugung von Energie(trägern und die Verteilungsinfrastruktur - maschinelle Ausrüstung und Qualifizierung - durch den Zufluss von FDI erheblich entwickeln konnte. Allerdings gebe es keinen Beleg dafür, dass dieser Zufluss die endogenen wissenschaftlichen und technologischen Forschungspotenziale im angolanischen Energiesektor gefördert hat. Der Autor empfiehlt politische Maßnahmen zur Förderung dieser Fähigkeiten, insbesondere im Bereich der Produktion.

Zugkraftbedarf, Arbeitsgeschwindigkeit, Flächenleistung und Energieverbrauch moderner Pferde gezogener Mähtechnik im Ökologischen Landbau

OpenAIRE

Herold, Peter; Heß, Jürgen

2011-01-01

Der Einsatz moderner Pferde gezogener Geräte stellt eine nachhaltige Alternative zum Schleppereinsatz dar, besonders im Ökologischen Landbau. Feldversuche zu den Leistungsdaten eines Vorderwagens in Kombination mit drei verschiedenen Doppelmesser-Mähwerken (Arbeitsbreiten 1,65 m, 1,90 m, 2,40 m) wurden durchgeführt. Bodenantrieb im Vergleich zum Motorantrieb der Zapfwelle führte zu einem mehr als doppelt so hohen Zugkraftbedarf und überstieg die Dauerzugleistungfähigkeit der 850 kg schweren A...

Dark Energy Survey Year 1 results: the impact of galaxy neighbours on weak lensing cosmology with IM3SHAPE

Science.gov (United States)

Samuroff, S.; Bridle, S. L.; Zuntz, J.; Troxel, M. A.; Gruen, D.; Rollins, R. P.; Bernstein, G. M.; Eifler, T. F.; Huff, E. M.; Kacprzak, T.; Krause, E.; MacCrann, N.; Abdalla, F. B.; Allam, S.; Annis, J.; Bechtol, K.; Benoit-Lévy, A.; Bertin, E.; Brooks, D.; Buckley-Geer, E.; Carnero Rosell, A.; Carrasco Kind, M.; Carretero, J.; Crocce, M.; D'Andrea, C. B.; da Costa, L. N.; Davis, C.; Desai, S.; Doel, P.; Fausti Neto, A.; Flaugher, B.; Fosalba, P.; Frieman, J.; García-Bellido, J.; Gerdes, D. W.; Gruendl, R. A.; Gschwend, J.; Gutierrez, G.; Honscheid, K.; James, D. J.; Jarvis, M.; Jeltema, T.; Kirk, D.; Kuehn, K.; Kuhlmann, S.; Li, T. S.; Lima, M.; Maia, M. A. G.; March, M.; Marshall, J. L.; Martini, P.; Melchior, P.; Menanteau, F.; Miquel, R.; Nord, B.; Ogando, R. L. C.; Plazas, A. A.; Roodman, A.; Sanchez, E.; Scarpine, V.; Schindler, R.; Schubnell, M.; Sevilla-Noarbe, I.; Sheldon, E.; Smith, M.; Soares-Santos, M.; Sobreira, F.; Suchyta, E.; Tarle, G.; Thomas, D.; Tucker, D. L.; DES Collaboration

2018-04-01

We use a suite of simulated images based on Year 1 of the Dark Energy Survey to explore the impact of galaxy neighbours on shape measurement and shear cosmology. The HOOPOE image simulations include realistic blending, galaxy positions, and spatial variations in depth and point spread function properties. Using the IM3SHAPE maximum-likelihood shape measurement code, we identify four mechanisms by which neighbours can have a non-negligible influence on shear estimation. These effects, if ignored, would contribute a net multiplicative bias of m ˜ 0.03-0.09 in the Year One of the Dark Energy Survey (DES Y1) IM3SHAPE catalogue, though the precise impact will be dependent on both the measurement code and the selection cuts applied. This can be reduced to percentage level or less by removing objects with close neighbours, at a cost to the effective number density of galaxies neff of 30 per cent. We use the cosmological inference pipeline of DES Y1 to explore the cosmological implications of neighbour bias and show that omitting blending from the calibration simulation for DES Y1 would bias the inferred clustering amplitude S8 ≡ σ8(Ωm/0.3)0.5 by 2σ towards low values. Finally, we use the HOOPOE simulations to test the effect of neighbour-induced spatial correlations in the multiplicative bias. We find the impact on the recovered S8 of ignoring such correlations to be subdominant to statistical error at the current level of precision.

Images and society (or Images, Society and its Decoding Las imágenes y la sociedad (o las imágenes, la sociedad y su desciframiento

Directory of Open Access Journals (Sweden)

Juan Soto Ramírez

2012-11-01

Full Text Available

Common sense, the thinking of the people par excellence, asserts that: a picture is worth a thousand words. This is a big mistake. The images are not carriers of meanings. The images always go through three basic processes are: production, circulation and reception. These processes are always determined in the time and social space. They are always the result of multiple relationships (social, ideological, political, moral, religious, etc., established with them. Always there are so many elements beyond the image, which determines its meaning. The meaning of an image always depends on the relationships established with it in a historical time and space, socially and culturally determined. The images are never alone. To decrypt their meanings, you must first know the symbolic life of the societies in which they appear. Images do not have a single meaning because it depends on the historical and cultural geography which presents. The images always have a close relationship with the society they were born. The Muhammad cartoons not offend everyone equally.

El sentido común, que es el pensamiento de las colectividades por excelencia, afirma que: una imagen dice más que mil palabras. Lo cual es un grave error. Las imágenes no son portadoras de significados. Las imágenes siempre atraviesan por tres procesos básicos que son: su producción, su circulación y su recepción. Estos procesos siempre están determinados en el tiempo y en el espacio sociales. Su significado siempre es el resultado de múltiples relaciones (sociales, ideológicas, políticas, morales, religiosas, etc., que se establecen con las mismas. Es decir, siempre existen elementos que están más allá de la imagen, que determinan su significado. La manera en cómo se significa una imagen, siempre depende de las relaciones que se establecen con ella en un tiempo histórico y en un espacio, social y culturalmente determinado. Las imágenes nunca están solas. Para

Measuring cognitive change with ImPACT: the aggregate baseline approach.

Science.gov (United States)

Bruce, Jared M; Echemendia, Ruben J; Meeuwisse, Willem; Hutchison, Michael G; Aubry, Mark; Comper, Paul

2017-11-01

The Immediate Post-Concussion Assessment and Cognitive Test (ImPACT) is commonly used to assess baseline and post-injury cognition among athletes in North America. Despite this, several studies have questioned the reliability of ImPACT when given at intervals employed in clinical practice. Poor test-retest reliability reduces test sensitivity to cognitive decline, increasing the likelihood that concussed athletes will be returned to play prematurely. We recently showed that the reliability of ImPACT can be increased when using a new composite structure and the aggregate of two baselines to predict subsequent performance. The purpose of the present study was to confirm our previous findings and determine whether the addition of a third baseline would further increase the test-retest reliability of ImPACT. Data from 97 English speaking professional hockey players who had received at least 4 ImPACT baseline evaluations were extracted from a National Hockey League Concussion Program database. Linear regression was used to determine whether each of the first three testing sessions accounted for unique variance in the fourth testing session. Results confirmed that the aggregate baseline approach improves the psychometric properties of ImPACT, with most indices demonstrating adequate or better test-retest reliability for clinical use. The aggregate baseline approach provides a modest clinical benefit when recent baselines are available - and a more substantial benefit when compared to approaches that obtain baseline measures only once during the course of a multi-year playing career. Pending confirmation in diverse samples, neuropsychologists are encouraged to use the aggregate baseline approach to best quantify cognitive change following sports concussion.

ImSET: Impact of Sector Energy Technologies

Energy Technology Data Exchange (ETDEWEB)

Roop, Joseph M.; Scott, Michael J.; Schultz, Robert W.

2005-07-19

This version of the Impact of Sector Energy Technologies (ImSET) model represents the ''next generation'' of the previously developed Visual Basic model (ImBUILD 2.0) that was developed in 2003 to estimate the macroeconomic impacts of energy-efficient technology in buildings. More specifically, a special-purpose version of the 1997 benchmark national Input-Output (I-O) model was designed specifically to estimate the national employment and income effects of the deployment of Office of Energy Efficiency and Renewable Energy (EERE) -developed energy-saving technologies. In comparison with the previous versions of the model, this version allows for more complete and automated analysis of the essential features of energy efficiency investments in buildings, industry, transportation, and the electric power sectors. This version also incorporates improvements in the treatment of operations and maintenance costs, and improves the treatment of financing of investment options. ImSET is also easier to use than extant macroeconomic simulation models and incorporates information developed by each of the EERE offices as part of the requirements of the Government Performance and Results Act.

Solvation of UCl{sub 6}{sup 2-} anionic complex by MeBu{sub 3}N{sup +}, BuMe{sub 2}Im{sup +} and BuMeIm{sup +} cations

Energy Technology Data Exchange (ETDEWEB)

Bosse, Emilie; Den Auwer, Christophe; Berthon, Claude; Guilbaud, Philippe; Moisy, Philippe [CEA Marcoule, DRCP/SCPS, BP 17171, 30207 Bagnols sur Ceze Cedex (France); Grigoriev, Mikhail S. [A.N. Frumkin Institute of Physical Chemistry and Electrochemistry, RAS, Leninskii Prosp. 31, 119991 Moscow (Russian Federation); Nikitenko, Serguei [CNAB, UMR 5084, CNRS - Universite de Bordeaux 1, BP 120 Le Haut Vigneau, 33175 Gradignan Cedex (France); Le Naour, Claire; Cannes, Celine [IPN, UMR 8608, CNRS, Universite Paris-Sud, 91406 Orsay (France)

2008-07-01

The complexes [MeBu{sub 3}N]{sub 2}[UCl{sub 6}] and [BuMe{sub 2}Im]{sub 2}[UCl{sub 6}] were characterized in the solid state and in solution of [MeBu{sub 3}N][Tf{sub 2}N], [BuMe{sub 2}Im][Tf{sub 2}N] and [BuMeIm][Tf{sub 2}N] room temperature ionic liquids using single-crystal XRD, EXAFS, electrochemistry, UV-visible absorption spectroscopy and NMR. In the solid and in solution, the existence of hydrogen bonding between the anionic UCl{sub 6}{sup 2-} complex and the ionic liquid cations were revealed by these techniques. The MeBu{sub 3}N{sup +} cation interacts with UCl{sub 6}{sup 2-} via the protons on the alpha carbon atoms of nitrogen. The protons of the imidazolium ring account for the interaction between the BuMe{sub 2}Im+ cation and the UCl{sub 6}{sup 2-} anion. For the BuMeIm{sup +} cation the major interaction was confirmed between the most acidic proton on C(2) and UCl{sub 6}{sup 2-}. The experimental results also show that the intensity of the interaction between the UCl{sub 6}{sup 2-} anion and the cation varies with the ionic liquid cation in the following order: MeBu{sub 3}N{sup +} {approx} BuMe{sub 2}Im{sup +} << BuMeIm{sup +}. (authors)

Transport of sediments in Himalaya-Karakorum and its influence on hydropower plants; Sedimenttransportprozesse im Himalaya-Karakorum und ihre Bedeutung fuer Wasserkraftanlagen

Energy Technology Data Exchange (ETDEWEB)

Palt, S.M.

2001-07-01

of a cascade of staircase local falls. Their distance in-between the falls as well as their height difference at the steps is strongly depending on the river slope. (orig.) [German] Die vorliegende Arbeit beschaeftigt sich mit den Sedimenttransportprozessen in alpinen Gebirgsregionen und deren Auswirkungen auf Wasserkraftanlagen. Ziel der Arbeit ist es, zum Verstaendnis des natuerlichen Sedimenttransportes mit der fuer Gebirgsregionen typischen Charakteristik von 'High Magnitude-Low Frequency - Prozessen' beizutragen, um eine den Transportverhaeltnissen geeignete Auslegung von geplanten Wasserkraftanlagen zu finden. Am Beispiel der Gebirgsregion des Himalaya-Karakorums werden die komplexen Transportvorgaenge im grossraeumigen Raum des Makromassstabes erlaeutert. Dabei wird auf die Massentransporte eingegangen, die durch Naturgefahren wie Erdbeben, Felsgleitungen, Erdrutsche, Muren, Gletscherbrueche und Hochwaesser ausgeloest werden. Der Schwerpunkt der Arbeit liegt in der Durchfuehrung von umfangreichen Naturmessungen im untergeordneten Raum des Mesomassstabes im Bereich von einzelnen Flussabschnitten. Die Naturmessungen umfassen morphologische und topographische Aufnahmen, Abfliessmessungen, Geschiebe- sowie Schwebstoffmessungen an 16 Gebirgsfluessen eines insgesamt 80000 km{sup 2} grossen Projektgebietes im Himalaya-Karakorum. Aufgrund der extremen Verhaeltnisse der Gebirgsfluesse der Region hinsichtlich vorhandener Korngroesse des Bettmaterials sowie die Groessenordnung der Fliessgeschwindigkeiten wurde fuer die Untersuchungen eigens der mobile Geschiebesammler B-69 entwickelt, gebaut und auf seine hydraulische und sedimentologische Effizienz hin geprueft. Der Einsatz des B-69 hat sich im Feld bewaehrt und ist fuer weitere Anwendungen bei Hochwasserereignissen in kiesfuehrenden Fluessen geeignet. Als massgebender Parameter zur Beschreibung der Morphologie, der Stroemung, der Sohlenstabilitaet und des Geschiebetransportes von Gebirgsfluessen im

Handover Based IMS Registration Scheme for Next Generation Mobile Networks

Directory of Open Access Journals (Sweden)

Shireen Tahira

2017-01-01

Full Text Available Next generation mobile networks aim to provide faster speed and more capacity along with energy efficiency to support video streaming and massive data sharing in social and communication networks. In these networks, user equipment has to register with IP Multimedia Subsystem (IMS which promises quality of service to the mobile users that frequently move across different access networks. After each handover caused due to mobility, IMS provides IPSec Security Association establishment and authentication phases. The main issue is that unnecessary reregistration after every handover results in latency and communication overhead. To tackle these issues, this paper presents a lightweight Fast IMS Mobility (FIM registration scheme that avoids unnecessary conventional registration phases such as security associations, authentication, and authorization. FIM maintains a flag to avoid deregistration and sends a subsequent message to provide necessary parameters to IMS servers after mobility. It also handles the change of IP address for user equipment and transferring the security associations from old to new servers. We have validated the performance of FIM by developing a testbed consisting of IMS servers and user equipment. The experimental results demonstrate the performance supremacy of FIM. It reduces media disruption time, number of messages, and packet loss up to 67%, 100%, and 61%, respectively, as compared to preliminaries.

Regelungen im Verkehr mit Lebensmitteln und Bedarfsgegenständen in Deutschland

Science.gov (United States)

Thomas, Gundula; Freund, Astrid; Gründig, Friedrich

Im Zuge der Globalisierung von Produktion und Handel ändert sich auch der Charakter der Vorschriften im Lebensmittelrecht. Zunehmend treten internationale Rechtsbestimmungen, Abkommen, Standards und andere Normen an die Stelle nationaler Regelungen.

Volatile-Compound Fingerprinting by Headspace-Gas-Chromatography Ion-Mobility Spectrometry (HS-GC-IMS) as a Benchtop Alternative to 1H NMR Profiling for Assessment of the Authenticity of Honey.

Science.gov (United States)

Gerhardt, Natalie; Birkenmeier, Markus; Schwolow, Sebastian; Rohn, Sascha; Weller, Philipp

2018-02-06

This work describes a simple approach for the untargeted profiling of volatile compounds for the authentication of the botanical origins of honey based on resolution-optimized HS-GC-IMS combined with optimized chemometric techniques, namely PCA, LDA, and kNN. A direct comparison of the PCA-LDA models between the HS-GC-IMS and 1 H NMR data demonstrated that HS-GC-IMS profiling could be used as a complementary tool to NMR-based profiling of honey samples. Whereas NMR profiling still requires comparatively precise sample preparation, pH adjustment in particular, HS-GC-IMS fingerprinting may be considered an alternative approach for a truly fully automatable, cost-efficient, and in particular highly sensitive method. It was demonstrated that all tested honey samples could be distinguished on the basis of their botanical origins. Loading plots revealed the volatile compounds responsible for the differences among the monofloral honeys. The HS-GC-IMS-based PCA-LDA model was composed of two linear functions of discrimination and 10 selected PCs that discriminated canola, acacia, and honeydew honeys with a predictive accuracy of 98.6%. Application of the LDA model to an external test set of 10 authentic honeys clearly proved the high predictive ability of the model by correctly classifying them into three variety groups with 100% correct classifications. The constructed model presents a simple and efficient method of analysis and may serve as a basis for the authentication of other food types.

Robust stator resistance identification of an IM drive using model reference adaptive system

International Nuclear Information System (INIS)

Madadi Kojabadi, Hossein; Abarzadeh, Mostafa; Aghaei Farouji, Said

2013-01-01

Highlights: ► We estimate the stator resistance and rotor speed of the IM. ► We proposed a new quantity to estimate the speed and stator resistance of IM. ► The proposed algorithm is robust to rotor resistance variations. ► We estimate the IM speed and stator resistance simultaneously to avoid speed error. - Abstract: Model reference adaptive system (MRAS) based robust stator resistance estimator for sensorless induction motor (IM) drive is proposed. The MRAS is formed with a semi-active power quantity. The proposed identification method can be achieved with on-line tuning of the stator resistance with robustness against rotor resistance variations. Stable and efficient estimation of IM speed at low region will be guaranteed by simultaneous identification of IM speed and stator resistance. The stability of proposed stator resistance estimator is checked through Popov’s hyperstability theorem. Simulation and experimental results are given to highlight the feasibility, the simplicity, and the robustness of the proposed method.

Evaluation of the indenter modulus (IM) method in the international round robin test about the cable condition monitoring

International Nuclear Information System (INIS)

Kajimura, Yuusaku

2016-01-01

In order to ensure the reliability and safety of nuclear power plants, the diagnosis of cable aging is important. The Institute of Nuclear Safety System (INSS) has been developing the indenter modulus (IM) method for more than a dozen years. Its usefulness was demonstrated in the research project 'Assessment of cable aging for nuclear power plant' by the Japan Nuclear Energy Safety Organization in 2009. Furthermore, INSS participated in the IAEA Coordinated Research Project in 2013 to 2015, measuring and acquiring data of insulation materials of cables and cable jackets with insulation which had been never measured before by INSS. The main results are as follows. (1) The IM method is useful for new materials (for example, crosslinked polyolefins) which had never been measured before by INSS. (2) The IM method is also applicable to evaluation of cable jackets with insulation made of such materials as chlorosulfonated polyethylene. Therefore, the IM method is evaluated to be useful and applicable for most cable materials except those which have a high IM value initially and which have a small change in IM value during aging. (author)

Thermal Degradation Study of IM7/DMBZ-15 High Temperature Composite by TGA/FTIR

National Research Council Canada - National Science Library

Nadler, Melvin

2003-01-01

(U) High temperature graphite composites such as IM7/8552 epoxy, IM7/5250 BMI, and IM7/DMBZ-15 polyimide show blistering and/or "catastrophic" delamination when rapidly heated to temperatures above...

Harnessing water power in the larger Hannover area. Study commissioned by the local administration union larger Hannover area; Nutzung der Wasserkraft im Grossraum Hannover. Eine Studie im Auftrag des Zweckverbandes Grossraum Hannover

Energy Technology Data Exchange (ETDEWEB)

Sahling, U [comp.

1993-12-31

Within the framework of an inventory of possible sites for hydroelectric power plants in the larger Hannover area, 60 sites in the rural district of Hannover were more closely investigated. 57 of these were former water mills and 3 were hydraulic structures that have nothing to do with former water mills. 29 water mills are to be considered as dismantled in hydraulic engineering terms, 8 are in operation, and 20 are decommissioned. Furthermore, 2 weirs and 1 barrage were included in the investigation.- In the area of the city of Hannover, there are four more sites of hydroelectric power plants, of which one is dismantled, two are decommissioned and one is in operation.- In order to complement the inventory, object expertises of different depths were prepared for eight selected sites. They permit a qualified assessment of the chances of reactivation of each site, taking the respective specific conditions into account. At the same time, they represent a first step towards detailed advice for a prospective operator (orig.). [Deutsch] Im Rahmen der Studie zur Bestandserhebung von moeglichen Standorten fuer Wasserkraftanlagen im Grossraum Hannover wurden 60 Standorte im Landkreis Hannover naeher untersucht. Es handelt sich um 57 ehemalige Wassermuehlen und 3 wasserbauliche Anlagen, die nichts mit ehemaligen Wassermuehlen zu tun haben. 29 Wassermuehlen sind im wasserbaulichen Sinn als beseitigt anzusehen, 8 sind in Betrieb, 20 liegen still. Darueberhinaus wurden 2 Wehre und 1 Stauanlage in die Untersuchungen einbezogen. Im Gebiet der Stadt Hannover befinden sich 4 weitere Wassrkraftstandorte, von denen einer als beseitigt anzusehen ist, zwei stilliegen und einer in Betrieb ist. Ergaenzend zu der Bestandserhebung wurden fuer acht ausgewaehlte Standorte Objektgutachten unterschiedlicher Bearbeitungstiefe erstellt. Sie ermoeglichen eine qualifizierte Beurteilung der Reaktivierungschancen unter Beruecksichtigung der jeweiligen standortspezifischen Besonderheiten

[Variation im heutigen Deutsch...] / Laura Tidrike

Index Scriptorium Estoniae

Tidrike, Laura

2008-01-01

Arvustus: Variation im heutigen Deutsch : Perspektiven für den Sprachunterricht / hrsg. v. Eva Neuland. Frankfurt am Main : Lang, 2006. (Sprache - Kommunikation - Kultur. Soziolinguistische Beiträge ; Vol. 4)

Global R&D through the Intelligent Manufacturing Systems (IMS) program

Science.gov (United States)

Huray, Paul G.

1997-01-01

The industry-led, international intelligent manufacturing systems (IMS) program provides a special vehicle for joint research and development between government, industry and academia in the United States, Canada, Japan, Australia, and Europe. Since its beginning in 1989, the IMS program has progressed through a feasibility phase which demonstrated that international legal barriers, trade issues, and intellectual property problems could be overcome. The program is constructed to provide higher quality design, customized products, shorter delivery cycles and lower costs. Interactions between partner companies have led to new business opportunities for mutual profit and some claim to have learned strategic information about their international competitors. The IMS program is growing through the participation of hundreds of corporate and university partners who share responsibilities in specific projects and jointly reap benefits for their manufacturing products and processes. The logic for choosing or not choosing the IMS mechanisms will be discussed and R and D projects will be identified.

Estudios por imágenes en reumatismo

Directory of Open Access Journals (Sweden)

Muñoz Ch. Sara, Dra.

2012-07-01

Los grandes avances tecnológicos de la última década han mejorado la calidad y cantidad de información que las distintas técnicas aportan, especialmente la RM; esto hace vislumbrar un cambio significativo en el diagnóstico por imágenes, ya que en el futuro no solo estará basado en los cambios morfológicos en órganos y tejidos; las imágenes obtenidas aportarán información bioquímica, molecular y fisiológica de los procesos patológicos facilitando su diagnóstico aun más precoz.

Using IMS VDEX in Agrega

Directory of Open Access Journals (Sweden)

Jose Manuel Canabal

2009-03-01

Full Text Available An essential element in a learning object repository is the meta-information associated with the resources housed by the repository, as this is what enables the objects to be retrieved. In many cases, the meta-information which is described consists of the classification of a resource in relation to a taxonomy or thesaurus. Agrega is a network of learning object repositories in which an LOM profile, called LOM-ES, has been used to label the objects. Part of the meta-information described corresponds to the classification of the object with respect to a group of taxonomies and a thesaurus, which have had to be described using the ims vdex standard to enable them to be managed from the federation nodes. This article describes the way in which ims vdex has been used in order to create this description and how these metadata instances are managed.

Vitamin B1

Science.gov (United States)

... Prize Alfred Nobel's Life and Work Teachers' Questionnaire Vitamin B1 - About The Chicken Farm educational game and ... the game window. Reading: "Christian Eijkman, Beriberi and Vitamin B1" - Who was Eijkman and why did he ...

Representing adaptive and adaptable Units of Learning. How to model personalized eLearning in IMS Learning Design

OpenAIRE

Burgos, Daniel; Tattersall, Colin; Koper, Rob

2006-01-01

Burgos, D., Tattersall, C., & Koper, E. J. R. (2007). Representing adaptive and adaptable Units of Learning. How to model personalized eLearning in IMS Learning Design. In B. Fernández Manjon, J. M. Sanchez Perez, J. A. Gómez Pulido, M. A. Vega Rodriguez & J. Bravo (Eds.), Computers and Education: E-learning - from theory to practice. Germany: Kluwer.

Development of a human-specific B. thetaiotaomicron IMS/ATP assay for measuring viable human contamination in surface waters in Baja California, Mexico

Science.gov (United States)

Immunomagnetic separation/adenosine triphosphate (IMS/ATP) assays utilize paramagnetic beads and target-specific antibodies to isolate target organisms. Following isolation, adenosine tri-phosphate (ATP) is extracted from the target population and quantified. An inversely-couple...

One Family's Struggles with Hepatitis B

Medline Plus

Full Text Available ... spray flu caccine CDC surveillance flu FAQ flu vaccine does not cause flu no such thing as ... current news Flu's Gonna Lose hepatitis a & b vaccines im/sq how to do kids infect kids ...

Ein Ausblick auf Supply-Chain-Management im Jahr 2016

DEFF Research Database (Denmark)

Wieland, Andreas

2016-01-01

Wie sieht Supply-Chain-Management im Jahr 2016 aus? Was erwartet uns? Vieles deutet darauf hin, dass SCM in Zukunft sogar noch mehr auf den Kunden gerichtet sein könnte als bisher.......Wie sieht Supply-Chain-Management im Jahr 2016 aus? Was erwartet uns? Vieles deutet darauf hin, dass SCM in Zukunft sogar noch mehr auf den Kunden gerichtet sein könnte als bisher....

A SURVEY ON INDIAN EXPERIENCE ON INTEGRATED MANAGEMENT STANDARDS (IMS

Directory of Open Access Journals (Sweden)

H. Khanna

2009-09-01

Full Text Available Adoption of management systems standards is a key issue in manufacturing industry in India. Following the global trend quality and environmental issues are gaining importance. However the number of ISO 14001 certified companies are much less in India as compared to ISO 9001. The integration of ISO 14001 with ISO 9001 may help companies to sustain competitive advantage and overcome disappointments with quality standards and in turn encourage companies to adopt good environmental practices. The aim of this research is to study the implementation of integrated management standards (IMS by the manufacturing organizations in India. The different aspects of integration and benefits of IMS implementation are analyzed. This r esearch is based on empirical study carried out in Indian manufacturing firms, involving the application of a questionnaire. This questionnaire was tested on 50 manufacturing companies in India. The study reveals that focus on stakeholders; top management commitment and training are critical success factors for implementation of IMS. The main benefits of integration are discussed. The small sample size is one of the major limitations of this study. The paper informs the managers in manufacturing organizations and practitioners of management system standards especially in developing countries about IMS and will enable them to adopt IMS in future so that those organizations may not implement multiple and overlapping MSS(Management System Standards.

Environmental trace analysis by means of supersensitive GC-IMS

International Nuclear Information System (INIS)

Leonhardt, J.W.

1997-01-01

The effective control of pollutants in ambient air requires their fast in situ identification and concentration determination of chemical compounds in the range of micrograms per m 3 . There are attempts to use conventional analytical techniques as portable GC and GC-MS. These systems are relatively expensive. A new supersensitive ion Mobility Sensor (IMS) was developed and checked by IUT Ltd, which meets the new demands. The use of tritium sources is an advantage in comparison with other IMS being equipped by nickel-63, the application of which is rather critical in respect of the radiation protection. On the other hand an integrated separation column allows to reduce interferences by matrix effects. The technical parameters of the IUT GC- IMS and some of its most important applications are briefly presented

26 CFR 1.267(b)-1 - Relationships.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Relationships. 1.267(b)-1 Section 1.267(b)-1...) INCOME TAXES Items Not Deductible § 1.267(b)-1 Relationships. (a) In general. (1) The persons referred to... partnership separately. Therefore, if the other person and a partner are within any one of the relationships...

An Integrated Management System (IMS) for JM-1 SLOWPOKE-2 research reactor in Jamaica: experiences in documentation

International Nuclear Information System (INIS)

Warner, T.

2014-01-01

Since the first criticality in March 1984, the Jamaica SLOWPOKE-2 research reactor at the University of the West Indies, Mona located in the department of the International Centre for Environmental and Nuclear Sciences (ICENS) has operated for approximately 52% of the lifetime of the existing core configuration. The 20kW pool type research reactor has been primarily used for neutron activation analysis in environmental, agricultural, geochemical, health-related studies and mineral exploration in Jamaica. The involvement of the JM-1 reactor for research and teaching activities has segued into commercial applications which, coupled with the current core conversion programme from HEU to LEU, has demanded the implementation of management systems to satisfy regulatory requirements and assure compliance with internationally defined quality standards. At ICENS, documentation related to the Quality Management System aspect of an Integrated Management System (IMS) is well underway. The quality system will incorporate operational and nuclear safety, training, maintenance, design, utilization, occupational health and safety, quality service, and environmental management for its Nuclear Analytical Laboratory, NAL. The IMS is being designed to meet the requirements of the IAEA GS-R-3 with additional controls from international standards including: ISO/IEC 17025:2005, ISO 9001:2008, ISO 14001:2004 and OHSAS 18001:2007. This paper reports on the experiences of the documentation process in a low power reactor facility characterized by limited human resource, where innovative mechanisms of system automation and modeling are included to increase productivity and efficiency. (author)

An Integrated Management System (IMS) for JM-1 SLOWPOKE-2 research reactor in Jamaica: experiences in documentation

Energy Technology Data Exchange (ETDEWEB)

Warner, T., E-mail: traceyann.warner02@uwimona.edu.jm [Univ. of West Indies, Mona (Jamaica)

2014-07-01

Since the first criticality in March 1984, the Jamaica SLOWPOKE-2 research reactor at the University of the West Indies, Mona located in the department of the International Centre for Environmental and Nuclear Sciences (ICENS) has operated for approximately 52% of the lifetime of the existing core configuration. The 20kW pool type research reactor has been primarily used for neutron activation analysis in environmental, agricultural, geochemical, health-related studies and mineral exploration in Jamaica. The involvement of the JM-1 reactor for research and teaching activities has segued into commercial applications which, coupled with the current core conversion programme from HEU to LEU, has demanded the implementation of management systems to satisfy regulatory requirements and assure compliance with internationally defined quality standards. At ICENS, documentation related to the Quality Management System aspect of an Integrated Management System (IMS) is well underway. The quality system will incorporate operational and nuclear safety, training, maintenance, design, utilization, occupational health and safety, quality service, and environmental management for its Nuclear Analytical Laboratory, NAL. The IMS is being designed to meet the requirements of the IAEA GS-R-3 with additional controls from international standards including: ISO/IEC 17025:2005, ISO 9001:2008, ISO 14001:2004 and OHSAS 18001:2007. This paper reports on the experiences of the documentation process in a low power reactor facility characterized by limited human resource, where innovative mechanisms of system automation and modeling are included to increase productivity and efficiency. (author)

[Die baltischen Lande im Zeitalter der Reformation und Konfessionalisierung : Livland, Estland, Ösel, Ingermanland, Kurland und Lettgallen. Stadt, Land und Konfession 1500-1721. Teil 1.] / Jürgen Beyer

Index Scriptorium Estoniae

Beyer, Jürgen, 1965-

2010-01-01

Arvustus: Die baltischen Lande im Zeitalter der Reformation und Konfessionalisierung. Livland, Estland, Ösel, Ingermanland, Kurland und Lettgallen. Stadt, Land und Konfession 1500-1721. Teil 1. (Münster : Aschendorff, 2009)

Digital Medien im Naturwissenschaftlichen Unterricht

CERN Document Server

Meßinger-Koppelt, Jenny

2014-01-01

„Morgens, 8 Uhr: Kurz vor der Schultür werden noch die neuesten Posts auf Facebook geliked, ein Selfie in die Whats-App-Gruppe hochgeladen oder auf YouTube noch ein #LOL-Video gestreamed. Dann klingelt es und die Digital Natives greifen wieder zu Stift, Papier und werden frontal mit Fakten gefüttert“ (A. Spang). Für Schüler sind Internet, Smartphone und Tablet-PC heute selbstverständlicher Teil ihrer Lernwelt. Und auch die Alltags- und Berufswelt ist ohne Informationstechnologien nicht mehr vorstellbar. Doch was bedeutet das für den Schulunterricht, insbesondere für die techniknahen Naturwissenschaften? Wie gelingt im Schulalltag die Balance zwischen Kreidezeit und interaktivem Whiteboard nach mittlerweile 30 Jahren Erfahrung mit Schulcomputern? Der vorliegende Sammelband präsentiert zahlreiche Praxisbeispiele aus dem Schulalltag zum sinnvollen Einsatz digitaler Medien im Biologie-, Chemie- und Physik-Unterricht sowie den aktuellen Stand der fachdidaktischen Forschung. Zu Wort kommen Hochschullehr...

CORPORATIVE MOTIVES ON IMPLEMENTATION OF INTEGRATED MANAGEMENT SYSTEM (IMS

Directory of Open Access Journals (Sweden)

Dragan Rajkovic

2009-09-01

Full Text Available Integration of management systems for quality, environment, health and risk management as well as corporative social responsibilities is workable corporative approach to reduce costs, effective use of resources, higher motivation of employees and better fulfillment of requirements of social engagements and stakeholders. This paper presents contents of literature and review of a company motives on integrated management system (IMS implementation, namely factors affecting the IMS implementation.

Polycyclic phloroglucinols as PTP1B inhibitors from Hypericum longistylum: Structures, PTP1B inhibitory activities, and interactions with PTP1B.

Science.gov (United States)

Cao, Xiangrong; Yang, Xueyuan; Wang, Peixia; Liang, Yue; Liu, Feng; Tuerhong, Muhetaer; Jin, Da-Qing; Xu, Jing; Lee, Dongho; Ohizumi, Yasushi; Guo, Yuanqiang

2017-12-01

Protein tyrosine phosphatase 1B (PTP1B) has been regarded asa target for the research and development of new drugs to treat type II diabetes and PTP1B inhibitors are potential lead compounds for this type of new drugs. A phytochemical investigation to obtain new PTP1B inhibitors resulted in the isolation of four new phloroglucinols, longistyliones A-D (1-4) from the aerial parts of Hypericum longistylum. The structures of 1-4 were elucidated on the basis of extensive 1D and 2D NMR spectroscopic data analysis, and the absolute configurations of these compounds were established by comparing their experimental electronic circular dichroism (ECD) spectra with those calculated by the time-dependent density functional theory method. Compounds 1-4 possess a rare polycyclic phloroglucinol skeleton. The following biological evaluation revealed that all of the compounds showed PTP1B inhibitory effects. The further molecular docking studies indicated the strong interactions between these bioactive compounds with the PTP1B protein, which revealed the possible mechanism of PTP1B inhibition of bioactive compounds. All of the results implied that these compounds are potentially useful for the treatment of type II diabetes. Copyright © 2017 Elsevier Inc. All rights reserved.

Compresión de imágenes médicas

Directory of Open Access Journals (Sweden)

Tatiana Noreña

2013-03-01

Full Text Available La medicina moderna es una actividad cada vez más compleja, basada en la información proveniente de múltiples fuentes: historias clínicas, dictáfonos e imágenes y vídeos provenientes de múltiples dispositivos. Las imágenes médicas constituyen una de las fuentes de mayor importancia, por cuanto ofrecen un apoyo integral del acto médico: el diagnóstico y el seguimiento. Sin embargo, la cantidad de información generada por los dispositivos de adquisición de imágenes sobrepasa rápidamente la disponibilidad de almacenamiento que tienen los servicios de radiología, lo cual genera costos adicionales en equipos de cómputo con mayor capacidad de almacenamiento. Además, la tendencia actual de desarrollo de aplicaciones en la “nube de cómputo”, tiene limitaciones por cuanto, aunque el almacenamiento es virtual y está disponible desde cualquier sitio, la conexión se hace a través de internet. En estos dos casos, el uso óptimo de la información requiere necesariamente de algoritmos de compresión potentes y adaptados a las necesidades de la actividad médica. En este artículo se presenta una revisión de las técnicas de compresión más utilizadas para el almacenamiento de imágenes, así como un análisis crítico de éstas desde el punto de vista de su uso en ambientes clínicos.   doi: http://dx.doi.org/10.7705/biomedica.v33i1.804

Detección automática de NEOs en imágenes CCD utilizando la transformada de Hough

Science.gov (United States)

Ruétalo, M.; Tancredi, G.

El interés y la dedicación por los objetos que se acercan a la órbita de la Tierra (NEOs) ha aumentado considerablemente en los últimos años, tanto que se han iniciado varias campañas de búsqueda sistemática para aumentar la población identificada de éstos. El uso de placas fotográficas e identificación visual está siendo sustituído, progresivamente, por el uso de cámaras CCD y paquetes de detección automática de los objetos en las imágenes digitales. Una parte muy importante para la implementación exitosa de un programa automatizado de detección de este tipo es el desarrollo de algoritmos capaces de identificar objetos de baja relación señal-ruido y con requerimientos computacionales no elevados. En el presente trabajo proponemos la utilización de la transformada de Hough (utilizada en algunas áreas de visión artificial) para detectar automáticamente trazas, aproximadamente rectilíneas y de baja relación señal-ruido, en imágenes CCD. Desarrollamos una primera implementación de un algoritmo basado en ésta y lo probamos con una serie de imágenes reales conteniendo trazas con picos de señales de entre ~1 σ y ~3 σ por encima del nivel del ruido de fondo. El algoritmo detecta, sin inconvenientes, la mayoría de los casos y en tiempos razonablemente adecuados.

[Photoionization ion mobility spectrometry (UV-IMS) for the isomeric volatile organic compounds].

Science.gov (United States)

Li, Hu; Niu, Wen-qi; Wang, Hong-mei; Huang, Chao-qun; Jiang, Hai-he; Chu, Yan-nan

2012-01-01

The construction and performance study is reported for a newly developed ultraviolet photoionization ion mobility spectrometry (UV-IMS). In the present paper, an UV-IMS technique was firstly developed to detect eleven isomeric volatile organic compounds including the differences in the structure of carbon chain, the style of function group and the position of function group. Their reduced mobility values were determined and increased in this order: linears alcohols homemade UV-IMS was around ppb-ppm.

[Einheit und Vielfalt in der Rechtsgeschichte im Ostseeraum] / Marelle Leppik

Index Scriptorium Estoniae

Leppik, Marelle

2013-01-01

Arvustus: Einheit und Vielfalt in der Rechtsgeschichte im Ostseeraum. Unity and plurality in the legal history of the Baltic Sea area Sechster Rechtshistorikertag im Ostseeraum, 3.-5. Juni 2010 Tartu (Estland) / Riga (Lettland9. Hrsg. von Marju Luts-Sootak, Sanita Osipova und Frank L. Schäfer. (Rechtshistorische Reihe, Bd. 428.) Land. Frankfurt am Main u. a. 2012

Frauen im Netz weltweit – ausgegrenzt und mittendrin

Directory of Open Access Journals (Sweden)

Sigrid Peuker

2003-03-01

Full Text Available Mit dem Global Center for Women’s Studies and Politics (GLOW ist das Feministische Institut der Heinrich-Böll-Stiftung 1998 online gegangen. Mit diesem Schritt wurden Fragen nach den Möglichkeiten und Grenzen sowie nach den Gestaltungsräumen virtueller Kommunikation für Frauen zentral. Mit feminist_spaces. Frauen im Netz. Diskurse – Communities – Visionen, legt die Heinrich-Böll-Stiftung zusammen mit dem Feministischen Institut Antworten aus internationaler Perspektive vor. Das Buch geht auf die gleichnamige zweitätige Konferenz in Berlin im November 2001 zurück.

Non-invasive bioluminescence imaging to monitor the immunological control of a plasmablastic lymphoma-like B cell neoplasia after hematopoietic cell transplantation.

Directory of Open Access Journals (Sweden)

Martin Chopra

Full Text Available To promote cancer research and to develop innovative therapies, refined pre-clinical mouse tumor models that mimic the actual disease in humans are of dire need. A number of neoplasms along the B cell lineage are commonly initiated by a translocation recombining c-myc with the immunoglobulin heavy-chain gene locus. The translocation is modeled in the C.129S1-Igha(tm1(MycJanz/J mouse which has been previously engineered to express c-myc under the control of the endogenous IgH promoter. This transgenic mouse exhibits B cell hyperplasia and develops diverse B cell tumors. We have isolated tumor cells from the spleen of a C.129S1-Igha(tm1(MycJanz/J mouse that spontaneously developed a plasmablastic lymphoma-like disease. These cells were cultured, transduced to express eGFP and firefly luciferase, and gave rise to a highly aggressive, transplantable B cell lymphoma cell line, termed IM380. This model bears several advantages over other models as it is genetically induced and mimics the translocation that is detectable in a number of human B cell lymphomas. The growth of the tumor cells, their dissemination, and response to treatment within immunocompetent hosts can be imaged non-invasively in vivo due to their expression of firefly luciferase. IM380 cells are radioresistant in vivo and mice with established tumors can be allogeneically transplanted to analyze graft-versus-tumor effects of transplanted T cells. Allogeneic hematopoietic stem cell transplantation of tumor-bearing mice results in prolonged survival. These traits make the IM380 model very valuable for the study of B cell lymphoma pathophysiology and for the development of innovative cancer therapies.

26 CFR 1.367(b)-1 - Other transfers.

Science.gov (United States)

2010-04-01

... its successor in interest) that the shareholder is making the election described in § 1.367(b)-3(c)(3... paragraph (c)(2)— (i) A shareholder described in § 1.367(b)-3(b)(1) that realizes income in a transaction described in § 1.367(b)-3(a); (ii) A shareholder that makes the election described in § 1.367(b)-3(c)(3...

Defining the Nation: National Identity in South Sudanese Media Discourse Eine Nation definieren: Die nationale Identität im südsudanesischen Mediendiskurs

Directory of Open Access Journals (Sweden)

Ole Frahm

2012-01-01

Full Text Available This article examines debates about national identity in the media landscape of post-referendum and post-independence South Sudan. Having never existed as a sovereign state and with its citizens being a minority group in Sudan, collective action among South Sudanese has historically been shaped in response to external pressures: in particular, the aggressive nation-building pursued by successive Khartoum governments that sought to Arabize and Islamize the South. Today, in the absence of a clear-cut enemy, it is a major challenge for South Sudan to devise a common identity that unites the putative nation beyond competing loyalties to ethnicity, tribe and family. Analysing opinion pieces from South Sudanese online media and placing them in the context of contemporary African nationalism, this article gives an initial overview of the issues that dominate the public debate on national identity: fear of tribalism and regionalism, commemoration of the liberation struggle, language politics, and the role of Christianity.Dieser Artikel widmet sich den Debatten, die in südsudanesischen Medien von der Nachreferendumszeit bis einige Monate nach der Unabhängigkeit über die nationale Identität geführt wurden. Der Südsudan hatte nie als souveräner Staat existiert und innerhalb des Sudan hatten die Südsudanesen eine Minderheit gebildet. In der Geschichte war gemeinschaftliches Handeln der Südsudanesen in erster Linie als Reaktion auf Druck von außen in Erscheinung getreten, insbesondere im Zusammenhang mit Arabisierungs- und Islamisierungsbestrebungen von Regierungen in Khartum. Heute fehlt ein eindeutiges Feindbild. Daher ist der Entwurf einer gemeinsamen Identität, die das Land über konkurrierende Loyalitäten zu Stamm, Ethnie oder Familie hinweg zu einen vermag, eine große Herausforderung für den Südsudan. Auf der Grundlage von Meinungsäußerungen in südsudanesischen Online-Zeitungen, die er zum „neuen“ afrikanischen

Wir und die Anderen: Gruppenbezogene Menschenfeindlichkeit im Sport in Sachsen

OpenAIRE

Delto, Hannes; Tzschoppe, Petra

2015-01-01

Mit der Querschnittsstudie "Wir und die Anderen – Gruppenbezogene Menschenfeindlichkeit im organisierten Sport in Sachsen" wurde erstmals das Syndrom Gruppenbezogener Menschenfeindlichkeit im organisierten Sport untersucht. Das Konzept der Gruppenbezogenen Menschenfeindlichkeit – ausgehend von einer Ideologie der Ungleichwertigkeit – wurde von Prof. Wilhelm Heitmeyer (Universität Bielefeld) entwickelt. Die Ergebnisse ermöglichen explizite Aussagen über Ausmaß und Ursachen Gruppenbezogener Men...

Cross-sectional environmental study comparing two highly polluted areas in Germany (Bitterfeld and Hettstedt) with a control region; Umweltmedizinische Untersuchungen im Raum Bitterfeld, im Raum Hettstedt und einem Vergleichsgebiet 1992-2000. Bd. 1: Textband. Bd. 2: Publikationen. Bd. 3: Untersuchungsdokumente und Frageboegen. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Heinrich, J.; Frye, C.; Hoelscher, B.; Meyer, I.; Pitz, M.; Cyrys, J.; Schneller, H.; Wjst, M.; Wichmann, H.E.

2001-10-01

-Zerbst zu ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)

Cross-sectional environmental study comparing two highly polluted areas in Germany (Bitterfeld and Hettstedt) with a control region; Umweltmedizinische Untersuchungen im Raum Bitterfeld, im Raum Hettstedt und einem Vergleichsgebiet 1992-2000. Bd. 1: Textband. Bd. 2: Publikationen. Bd. 3: Untersuchungsdokumente und Frageboegen. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Heinrich, J; Frye, C; Hoelscher, B; Meyer, I; Pitz, M; Cyrys, J; Schneller, H; Wjst, M; Wichmann, H E

2001-10-01

ermitteln. Darueber hinaus wurden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber den Zeitraum von 6 Jahren erfasst. Das Studiendesign bestand aus 3 wiederholten regionalen Querschnittsuntersuchungen in den Jahren 1992/93, 1995/96 und 1998/99. Insgesamt lagen Informationen von 7611 Frageboegen zur Auswertung vor (Beteiligungsrate: 89%, 75% bzw. 75%). Fuer die Belastungsregion Hettstedt waren deutlich hoehere Risiken fuer nicht allergische respiratorische Erkrankungen und Symptome im Vergleich zu Kindern des Kontrollgebietes Anhalt-Zerbst nachweisbar. Waehrend des Untersuchungszeitraumes 1992-1999 zeigte sich eine deutlich statistisch signifikante Abnahme der Praevalenz dieser gesundheitlichen Einschraenkungen, Kinder ohne Exposition mit Innenraumschadstoffen im haeuslichen Bereich profitieren von der Verbesserung der Aussenluftbelastung am meisten. Fuer die Verbesserung der Atemwegsgesundheit sprachen auch bessere Lungenfunktionswerte (FVC, FEV{sub 1}) im Laufe des Beobachtungszeitraumes 1992-1999. Kinder aus den beiden Belastungsregionen hatten haeufiger Allergien (Arztdiagnose, Symptome, allergenspezifischer Antikoerper-Nachweis). Die Haeufigkeit des Asthmas, der bronchialen Hyperreaktivitaet und der Neurodermitis nahm zu; die Praevalenz des Heuschnupfens und der allergischen Sensibilisierung nicht. Die korporale Belastung mit Blei und Cadmium war bei Kindern in den belasteten Regionen erhoeht, nahm aber im Verlauf des Beobachtungszeitraumes ab. Allerdings folgten gestiegenen Bleigehalten im Sedimentationsstaub in Hettstedt im Jahre 1997 leicht gestiegene Blutbleikonzentrationen. (orig.)

B-Identifikation im Level 2 Trigger des ATLAS Experiments

CERN Document Server

AUTHOR|(CDS)2072780

Zur Zeit wird am europäischen Forschungszentrum für Teilchenphysik CERN der neue Proton-Proton-Speicherring LHC und die zugehörigen vier Experimente gebaut. Ziele der Experimente sind unter anderem der Nachweis des Higgs-Bosons sowie detaillierte Studien des top-Quarks. Um möglichst reine Datensätze zu erhalten wäre es hilfreich, diese Ereignisse bereits während der Datennahme möglichst effizient zu selektieren. Dabei würde es helfen, wenn b-Quark-Jets auf Trigger-Niveau erkannt werden könnten. Ziel der Arbeit war die Entwicklung eines Algorithmus zur Identifikation von b-Quark-Jets, welcher die Anforderungen des Level 2 Triggers erfüllt. Das erste Kapitel der Arbeit gibt einen Einblick in die wesentlichen Bestandteile des Standardmodells der Teilchenphysik. In den folgenden zwei Kapiteln wird der Beschleuniger und der ATLAS Detektor sowie das ATLAS-Triggersystem beschrieben. Kapitel vier beschreibt die Möglichkeiten der B-Jet-Identifikation sowie einen Vertexalgorithmus auf Basis der Perigee-Pa...

Grand Prix Eurovision: Eine Fankultur im Medienzeitalter

Directory of Open Access Journals (Sweden)

Heinz Moser

2017-06-01

Full Text Available Der Grand Prix Eurovision ist seit Jahrzehnten eine der bekanntesten Unterhaltungssendungen im europäischen Raum. Dennoch erregte es Verwunderung, wenn der Schreibende Bekannten darüber berichtete, daß dies ein Forschungsgegenstand sei. Wurde von Interviews mit Grand Prix-Fans erzählt, so fielen schnell Aussagen wie: „Wie kann man sich nur für so etwas Abseitiges und Triviales wie den Grand Prix interessieren“. Dennoch bin ich der Meinung, daß Fankulturen für die entstehende Mediengesellschaft ein nicht unwichtiges Forschungsthema darstellen. Zwar geht es nicht um eine medienpädagogische Fragestellung im engeren Sinne; die Fans des Grand Prix Eurovision sind dem Jugendalter längst entwachsen. Dennoch handelt es sich bei Fangemeinschaften um Phänomene, die im Rahmen von Jugend- und Kinderkulturen von besonderer Relevanz sind. So meint Winter (1997, daß jugendliche Fanwelten eine bedeutende Rolle als Kristallisationspunkte kultureller Differenzierung spielen: ,Die Zugehörigkeit zu einer Fan weit ist Teil der jugendlichen Lebensbewältigung in der Postmoderne, denn in der Gemeinschaft der Fans können Jugendliche emotionale Allianzen eingehen, außeralltäglichen Beschäftigungen nachgehen, expressive Identitätsmuster gemeinschaftlich realisieren und sich mit ihrer Lebenssituation als Heranwachsende auseinandersetzen“ (Winter 1997, S. 51f..

Report of the Results of an IMS LEarning Design Expert Workshop

NARCIS (Netherlands)

Neumann, Susanne; Klebl, Michael; Griffiths, David; Hernández-Leo, Davinia; De la Fuente-Valentin, Luis; Hummel, Hans; Brouns, Francis; Derntl, Michael; Oberhuemer, Petra

2009-01-01

Neumann, S., Klebl, M., Griffiths, D., Hernández-Leo, D., de la Fuente Valentín, L., Hummel, H., Brouns, F., Derntl, M., & Oberhuemer, P. (2010). Report of the Results of an IMS Learning Design Expert Workshop. International Journal Of Emerging Technologies In Learning (IJET), 5(1), pp.

Association of Neuropeptide Y (NPY), Interleukin-1B (IL1B) Genetic Variants and Correlation of IL1B Transcript Levels with Vitiligo Susceptibility

Science.gov (United States)

Laddha, Naresh C.; Dwivedi, Mitesh; Mansuri, Mohmmad Shoab; Singh, Mala; Patel, Hetanshi H.; Agarwal, Nishtha; Shah, Anish M.; Begum, Rasheedunnisa

2014-01-01

Background Vitiligo is a depigmenting disorder resulting from loss of functional melanocytes in the skin. NPY plays an important role in induction of immune response by acting on a variety of immune cells. NPY synthesis and release is governed by IL1B. Moreover, genetic variability in IL1B is reported to be associated with elevated NPY levels. Objectives Aim of the present study was to explore NPY promoter −399T/C (rs16147) and exon2 +1128T/C (rs16139) polymorphisms as well as IL1B promoter −511C/T (rs16944) polymorphism and to correlate IL1B transcript levels with vitiligo. Methods PCR-RFLP method was used to genotype NPY -399T/C SNP in 454 patients and 1226 controls; +1128T/C SNP in 575 patients and 1279 controls and IL1B −511C/T SNP in 448 patients and 785 controls from Gujarat. IL1B transcript levels in blood were also assessed in 105 controls and 95 patients using real-time PCR. Results Genotype and allele frequencies for NPY −399T/C, +1128T/C and IL1B −511C/T SNPs differed significantly (pvitiligo by 2.3 fold (pvitiligo (p = 0.015), also in female patients than male patients (p = 0.026). Genotype-phenotype correlation showed moderate association of IL1B -511C/T polymorphism with higher IL1B transcript levels. Trend analysis revealed significant difference between patients and controls for IL1B transcript levels with respect to different genotypes. Conclusion Our results suggest that NPY −399T/C, +1128T/C and IL1B −511C/T polymorphisms are associated with vitiligo and IL1B −511C/T SNP influences its transcript levels leading to increased risk for vitiligo in Gujarat population. Up-regulation of IL1B transcript in patients advocates its possible role in autoimmune pathogenesis of vitiligo. PMID:25221996

Die Musik der Wiener Klassiker im öffentlichen Bewusstsein und im Blick der Wissenschaft: ein gegenseitiges Missverständnis?

Directory of Open Access Journals (Sweden)

Manfred Hermann Schmid

2013-12-01

Full Text Available Bildung setzt ein Geschichtsverständnis voraus. Kein Sprachunterricht ohne Spuren von Geschichte, auch kein Religionsunterricht und kein Musikunterricht. Doch Ge­schichte ist entgegen dem schönen Wort von Leopold von Ranke nichts Objektives, schon gar nicht, wenn es um Urteile geht. Sie ist bekanntlich ein intellektuelles Konstrukt. An der Schaf­fung dieses Konstrukts und auch an der Weitergabe, der „trasmissione del sapere musi­cale“, sind ganz verschiedene Instanzen beteiligt – keineswegs nur die Wissenschaft. Im Fall der Musikgeschichte müssen wir mit drei unterschiedlichen Instanzen rechnen: (a der musikalischen Zunft und ihrer Mündlichkeit; (b der Wissenschaft in ihren Publikationen und ihrem akademischen Unterricht; (c der Öffentlichkeit, gesteuert von den Medien.Zwischen (b und (c gibt es noch die Schule. Sie leitet sich in ihrem Selbstverständnis von der Wissenschaft her, ist aber in ungleich höherem Maße als diese mit der öffent­lichen Meinung konfrontiert. Die Geschichtsbilder differieren, wie zu erwarten, und sie differieren auch zu ver­schiedenen Zeiten, wenn ich das punktuell mit den Wiener Klassikern an einem Parade­fall von Kanonbildung und teleologischer Geschichtsschreibung überprüfe.

A critical analysis of Sorrell v. IMS Health, Inc.: Pandora's box at best.

Science.gov (United States)

Bibet-Kalinyak, Isabelle

2012-01-01

Sorrell v. IMS Health, Inc. ("IMS Health"), a remarkable health care case with resounding First Amendment and economic repercussions, features the clashing interests of the State of Vermont and aggressive free market players from the pharmaceutical and data mining industries in a constitutional battle over Free Speech. In 2007, Vermont enacted Act 80, The Confidentiality of Prescription Information Act, prohibiting the sale, disclosure, and use of pharmacy records. Together with two other data miners and PhRMA, an association of brand-name drug manufacturers, IMS Health successfully challenged the constitutionality of Act 80 on First Amendment grounds. This article examines the legal arguments of IMS Health and Act 80 and analyzes why IMS Health stands out for potentially challenging the traditional doctrine of commercial speech and the resulting legal implications. After reviewing the Supreme Court's reasoning, the article concludes that, although the Supreme Court reached the appropriate outcome, it did so by unjustifiably departing from the established legal doctrine of commercial speech and the American tradition of consumer protection. At best, IMS Health's reasoning opens a legal Pandora's Box potentially leading to an onset of new commercial speech challenges; at worst, it manufactured a Trojan Horse aimed at eroding the traditional regulatory safeguards that maintain a balance between the needs of consumers and corporations alike.

Innovative Techniken und Algorithmen im Bereich Computational-Finance und Risikomanagement

OpenAIRE

Liang, Qian

2012-01-01

Diese Dissertation besteht aus zwei aktuellen Themen im Bereich Finanzmathematik, die voneinander unabhängig sind. Beim ersten Thema, "Flexible Algorithmen zur Bewertung komplexer Optionen mit mehreren Eigenschaften mittels der funktionalen Programmiersprache Haskell", handelt es sich um ein interdisziplinäres Projekt, in dem eine wissenschaftliche Brücke zwischen der Optionsbewertung und der funktionalen Programmierung geschlagen wurde. Im diesem Projekt wurde eine funktionale Biblio...

Die Raumdarstellung im erzählenden Werk um 1900

OpenAIRE

Lu, Xiaoli

2011-01-01

In der Literatur existiert eine eigene Welt, die mit Raum und Zeit verbunden ist. Im 19. Jahrhundert gewinnen beide, Raum und Zeit, an Bedeutung als bewusst eingesetzte Gestaltungselemente. Es bilden sich zwei Grundrichtungen heraus, eine mit dem Erzählgeschehen verknüpfte Semantisierung in der Klassik und in der Romantik und eine betonte Fixierung des Geschehens in der realen Welt durch genaue Zeit- und Ortsangaben im Realismus. Die Semantisierung von Raum und Zeit führt zu einer Bedeutungss...

Impaired Epstein-Barr Virus-Specific Neutralizing Antibody Response during Acute Infectious Mononucleosis Is Coincident with Global B-Cell Dysfunction.

Science.gov (United States)

Panikkar, Archana; Smith, Corey; Hislop, Andrew; Tellam, Nick; Dasari, Vijayendra; Hogquist, Kristin A; Wykes, Michelle; Moss, Denis J; Rickinson, Alan; Balfour, Henry H; Khanna, Rajiv

2015-09-01

Here we present evidence for previously unappreciated B-cell immune dysregulation during acute Epstein-Barr virus (EBV)-associated infectious mononucleosis (IM). Longitudinal analyses revealed that patients with acute IM have undetectable EBV-specific neutralizing antibodies and gp350-specific B-cell responses, which were associated with a significant reduction in memory B cells and no evidence of circulating antibody-secreting cells. These observations correlate with dysregulation of tumor necrosis factor family members BAFF and APRIL and increased expression of FAS on circulating B cells. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

[Das Bild und die Wahrnehmung der Stadt und der städtischen Gesellschaft im Hanseraum im Mittelalter und in der frühen Neuzeit] / Juhan Kreem

Index Scriptorium Estoniae

Kreem, Juhan

2009-01-01

Arvustus: Das Bild und die Wahrnehmung der Stadt und der städtischen Gesellschaft im Hanseraum im Mittelalter und in der frühen Neuzeit. hrsg. v. Roman Czaja. Torun, 2004. Torunis 2002. aastal toimunud konverentsi materjalid. Projekti "Pilt ja linn" raames ilmunud publikatsioonide loendit saab näha aadressil http://www.historiaurbium.org/english/attivita_images_en.html.

Baixa resposta da vacinação intradérmica contra hepatite B em pacientes incidentes em hemodiálise

Directory of Open Access Journals (Sweden)

Regina H. Medeiros

2011-03-01

Full Text Available INTRODUÇÃO: A hepatite B pode evoluir para cirrose e hepatocarcinoma. Sua prevalência estimada é de 3,2% em pacientes em hemodiálise (HD. A vacina para hepatite B (HB, quando aplicada por via intramuscular (IM em pacientes com insuficiência renal crônica fase V, frequentemente não induz produção adequada de anticorpos. A injeção intradérmica (ID foi sugerida como sendo o método de inoculação mais eficiente. OBJETIVO: Comparar a resposta imune à injeção IM ou ID da vacina em indivíduos em HD. PACIENTES E MÉTODOS: Trinta e um pacientes incidentes em HD foram randomizados alternativamente para vacinação contra HB via IM ou ID. Dezesseis foram designados aleatoriamente para receber vacina IM (40 mg/dose e 15 ID (4mg /dose. Os níveis de anticorpos de superfície do vírus da hepatite B, parâmetros hematimétricos, ureia sérica, e Kt/V foram avaliados mensalmente. Proteína-C reativa, paratormônio, ferritina, aminotransferases e albumina foram avaliados antes da inoculação inicial e seis meses após a mesma. RESULTADOS: Os níveis de uréia foram maiores no grupo ID (P(1 = 0,031; os níveis de ferritina foram mais elevados no IM (P(2 = 0,037. Houve tendência a aumento nos níveis de proteína C reativa no grupo ID. A avaliação do Comitê de Monitoramento de Segurança dos indivíduos expostos recomendou a suspensão do estudo já que a inoculação por via IM converteu 62,5% e a ID converteu apenas 13,3% dos pacientes expostos. CONCLUSÃO: Com a metodologia utilizada, os resultados da vacina contra HB aplicada por via ID foi inferior à inoculação IM. Tais resultados podem ser decorrentes das doses inoculadas ou de outros fatores, como inflamação.

IMS Mitigation Target Areas - 2010 [ds673

Data.gov (United States)

California Natural Resource Agency — Mitigation Target Areas (MTA) were developed by the California Department of Fish and Game for the Interim Mitigation Strategy (IMS). The MTAs are an identification...

Association of neuropeptide Y (NPY, interleukin-1B (IL1B genetic variants and correlation of IL1B transcript levels with vitiligo susceptibility.

Directory of Open Access Journals (Sweden)

Naresh C Laddha

Full Text Available BACKGROUND: Vitiligo is a depigmenting disorder resulting from loss of functional melanocytes in the skin. NPY plays an important role in induction of immune response by acting on a variety of immune cells. NPY synthesis and release is governed by IL1B. Moreover, genetic variability in IL1B is reported to be associated with elevated NPY levels. OBJECTIVES: Aim of the present study was to explore NPY promoter -399T/C (rs16147 and exon2 +1128T/C (rs16139 polymorphisms as well as IL1B promoter -511C/T (rs16944 polymorphism and to correlate IL1B transcript levels with vitiligo. METHODS: PCR-RFLP method was used to genotype NPY -399T/C SNP in 454 patients and 1226 controls; +1128T/C SNP in 575 patients and 1279 controls and IL1B -511C/T SNP in 448 patients and 785 controls from Gujarat. IL1B transcript levels in blood were also assessed in 105 controls and 95 patients using real-time PCR. RESULTS: Genotype and allele frequencies for NPY -399T/C, +1128T/C and IL1B -511C/T SNPs differed significantly (p<0.0001, p<0.0001; p = 0.0161, p = 0.0035 and p<0.0001, p<0.0001 between patients and controls. 'TC' haplotype containing minor alleles of NPY polymorphisms was significantly higher in patients and increased the risk of vitiligo by 2.3 fold (p<0.0001. Transcript levels of IL1B were significantly higher, in patients compared to controls (p = 0.0029, in patients with active than stable vitiligo (p = 0.015, also in female patients than male patients (p = 0.026. Genotype-phenotype correlation showed moderate association of IL1B -511C/T polymorphism with higher IL1B transcript levels. Trend analysis revealed significant difference between patients and controls for IL1B transcript levels with respect to different genotypes. CONCLUSION: Our results suggest that NPY -399T/C, +1128T/C and IL1B -511C/T polymorphisms are associated with vitiligo and IL1B -511C/T SNP influences its transcript levels leading to increased risk for vitiligo in

Measurement of peripheral plasma using double probe in TRIAM-IM

International Nuclear Information System (INIS)

Yamagami, Masahiro; Kawasaki; Shoji; Jyotaki, Eriko; Fujita, Takaaki; Sakamoto, Mizuki; Nakamura, Kazuo; Nakamura, Yukio; Ito, Satoshi

1994-01-01

Behind the poloidal limiter of the TRIAM-IM, the change with time lapse of the electron temperature and the plasma density at the time of OH discharge was examined by using a double probe. Scrape-off plasma parameters, namely the correlations of electron temperature, plasma density and ion flux with main plasma parameters were obtained. It was found that scrape-off density is almost proportional to square of beam average electron density. Further, it was determined by calculation that the density on the outermost shell magnetic surface is about 1.5 x 10 15 /m 2 . In the TRIAM-IM, it is expected that accompanying the increase of plasma current at the time of OH discharge, the effects of thermal load and particle load given to the limiter and the first wall increase, and the increase of the metallic impurities due to sputtering becomes a serious problem. The merits of double probe method are explained. The objective of this experiment is to examine the temperature and density of the plasma that comes in contact with the limiter and the wall by determining the basic parameters of peripheral plasma at the time of OH discharge. In order to heighten the reliability of data, the examination was carried out from both aspects of hardware and software. The TRIAM-IM, double probe measuring system and its theory, applied voltage sweeping part, signal processing system, data processing system, and the experimental results of scrape-off layer parameters are described. (K.I.)

Hinderniserkennung und -verfolgung mit einer PMD-kamera im automobil

Science.gov (United States)

Schamm, Thomas; Vacek, Stefan; Natroshvilli, Koba; Marius Zöllner, J.; Dillmann, Rüdiger

Die Detektion von Hindernissen vor dem Automobil ist eine Hauptanforderung an moderne Fahrerassistenzsysteme (FAS). In dieser Arbeit wird ein System vorgestellt, das mit Hilfe einer PMDKamera (Photomischdetektor) Hindernisse auf der Fahrspur erkennt und deren relevante Parameter bestimmt. Durch die PMD-Kamera werden zunächst 3D-Tiefenbilder der Fahrzeugumwelt generiert. Nach einem initialen Filterprozess werden im Tiefenbild mit Hilfe eines Bereichswachstumsverfahrens Hindernisse gesucht. Zur Stabilisierung des Verfahrens und zur Parameterberechnung wird ein Kaiman Filter eingesetzt. Das Ergebnis ist eine Liste aller Hindernisse im Fahrbereich des Automobils.

Measurement of the $\\chi_b(3P)$ mass and of the relative rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ production

CERN Document Server

Aaij, Roel; Adinolfi, Marco; Affolder, Anthony; Ajaltouni, Ziad; Akar, Simon; Albrecht, Johannes; Alessio, Federico; Alexander, Michael; Ali, Suvayu; Alkhazov, Georgy; Alvarez Cartelle, Paula; Alves Jr, Antonio Augusto; Amato, Sandra; Amerio, Silvia; Amhis, Yasmine; An, Liupan; Anderlini, Lucio; Anderson, Jonathan; Andreassen, Rolf; Andreotti, Mirco; Andrews, Jason; Appleby, Robert; Aquines Gutierrez, Osvaldo; Archilli, Flavio; Artamonov, Alexander; Artuso, Marina; Aslanides, Elie; Auriemma, Giulio; Baalouch, Marouen; Bachmann, Sebastian; Back, John; Badalov, Alexey; Baesso, Clarissa; Baldini, Wander; Barlow, Roger; Barschel, Colin; Barsuk, Sergey; Barter, William; Batozskaya, Varvara; Battista, Vincenzo; Bay, Aurelio; Beaucourt, Leo; Beddow, John; Bedeschi, Franco; Bediaga, Ignacio; Belogurov, Sergey; Belous, Konstantin; Belyaev, Ivan; Ben-Haim, Eli; Bencivenni, Giovanni; Benson, Sean; Benton, Jack; Berezhnoy, Alexander; Bernet, Roland; Bettler, Marc-Olivier; van Beuzekom, Martinus; Bien, Alexander; Bifani, Simone; Bird, Thomas; Bizzeti, Andrea; Bjørnstad, Pål Marius; Blake, Thomas; Blanc, Frédéric; Blouw, Johan; Blusk, Steven; Bocci, Valerio; Bondar, Alexander; Bondar, Nikolay; Bonivento, Walter; Borghi, Silvia; Borgia, Alessandra; Borsato, Martino; Bowcock, Themistocles; Bowen, Espen Eie; Bozzi, Concezio; Brambach, Tobias; van den Brand, Johannes; Bressieux, Joël; Brett, David; Britsch, Markward; Britton, Thomas; Brodzicka, Jolanta; Brook, Nicholas; Brown, Henry; Bursche, Albert; Busetto, Giovanni; Buytaert, Jan; Cadeddu, Sandro; Calabrese, Roberto; Calvi, Marta; Calvo Gomez, Miriam; Campana, Pierluigi; Campora Perez, Daniel; Carbone, Angelo; Carboni, Giovanni; Cardinale, Roberta; Cardini, Alessandro; Carson, Laurence; Carvalho Akiba, Kazuyoshi; Casse, Gianluigi; Cassina, Lorenzo; Castillo Garcia, Lucia; Cattaneo, Marco; Cauet, Christophe; Cenci, Riccardo; Charles, Matthew; Charpentier, Philippe; Chefdeville, Maximilien; Chen, Shanzhen; Cheung, Shu-Faye; Chiapolini, Nicola; Chrzaszcz, Marcin; Ciba, Krzystof; Cid Vidal, Xabier; Ciezarek, Gregory; Clarke, Peter; Clemencic, Marco; Cliff, Harry; Closier, Joel; Coco, Victor; Cogan, Julien; Cogneras, Eric; Cojocariu, Lucian; Collins, Paula; Comerma-Montells, Albert; Contu, Andrea; Cook, Andrew; Coombes, Matthew; Coquereau, Samuel; Corti, Gloria; Corvo, Marco; Counts, Ian; Couturier, Benjamin; Cowan, Greig; Craik, Daniel Charles; Cruz Torres, Melissa Maria; Cunliffe, Samuel; Currie, Robert; D'Ambrosio, Carmelo; Dalseno, Jeremy; David, Pascal; David, Pieter; Davis, Adam; De Bruyn, Kristof; De Capua, Stefano; De Cian, Michel; De Miranda, Jussara; De Paula, Leandro; De Silva, Weeraddana; De Simone, Patrizia; Decamp, Daniel; Deckenhoff, Mirko; Del Buono, Luigi; Déléage, Nicolas; Derkach, Denis; Deschamps, Olivier; Dettori, Francesco; Di Canto, Angelo; Dijkstra, Hans; Donleavy, Stephanie; Dordei, Francesca; Dorigo, Mirco; Dosil Suárez, Alvaro; Dossett, David; Dovbnya, Anatoliy; Dreimanis, Karlis; Dujany, Giulio; Dupertuis, Frederic; Durante, Paolo; Dzhelyadin, Rustem; Dziurda, Agnieszka; Dzyuba, Alexey; Easo, Sajan; Egede, Ulrik; Egorychev, Victor; Eidelman, Semen; Eisenhardt, Stephan; Eitschberger, Ulrich; Ekelhof, Robert; Eklund, Lars; El Rifai, Ibrahim; Elsasser, Christian; Ely, Scott; Esen, Sevda; Evans, Hannah Mary; Evans, Timothy; Falabella, Antonio; Färber, Christian; Farinelli, Chiara; Farley, Nathanael; Farry, Stephen; Fay, Robert; Ferguson, Dianne; Fernandez Albor, Victor; Ferreira Rodrigues, Fernando; Ferro-Luzzi, Massimiliano; Filippov, Sergey; Fiore, Marco; Fiorini, Massimiliano; Firlej, Miroslaw; Fitzpatrick, Conor; Fiutowski, Tomasz; Fontana, Marianna; Fontanelli, Flavio; Forty, Roger; Francisco, Oscar; Frank, Markus; Frei, Christoph; Frosini, Maddalena; Fu, Jinlin; Furfaro, Emiliano; Gallas Torreira, Abraham; Galli, Domenico; Gallorini, Stefano; Gambetta, Silvia; Gandelman, Miriam; Gandini, Paolo; Gao, Yuanning; García Pardiñas, Julián; Garofoli, Justin; Garra Tico, Jordi; Garrido, Lluis; Gaspar, Clara; Gauld, Rhorry; Gavardi, Laura; Gavrilov, Gennadii; Geraci, Angelo; Gersabeck, Evelina; Gersabeck, Marco; Gershon, Timothy; Ghez, Philippe; Gianelle, Alessio; Gianì, Sebastiana; Gibson, Valerie; Giubega, Lavinia-Helena; Gligorov, V.V.; Göbel, Carla; Golubkov, Dmitry; Golutvin, Andrey; Gomes, Alvaro; Gotti, Claudio; Grabalosa Gándara, Marc; Graciani Diaz, Ricardo; Granado Cardoso, Luis Alberto; Graugés, Eugeni; Graziani, Giacomo; Grecu, Alexandru; Greening, Edward; Gregson, Sam; Griffith, Peter; Grillo, Lucia; Grünberg, Oliver; Gui, Bin; Gushchin, Evgeny; Guz, Yury; Gys, Thierry; Hadjivasiliou, Christos; Haefeli, Guido; Haen, Christophe; Haines, Susan; Hall, Samuel; Hamilton, Brian; Hampson, Thomas; Han, Xiaoxue; Hansmann-Menzemer, Stephanie; Harnew, Neville; Harnew, Samuel; Harrison, Jonathan; He, Jibo; Head, Timothy; Heijne, Veerle; Hennessy, Karol; Henrard, Pierre; Henry, Louis; Hernando Morata, Jose Angel; van Herwijnen, Eric; Heß, Miriam; Hicheur, Adlène; Hill, Donal; Hoballah, Mostafa; Hombach, Christoph; Hulsbergen, Wouter; Hunt, Philip; Hussain, Nazim; Hutchcroft, David; Hynds, Daniel; Idzik, Marek; Ilten, Philip; Jacobsson, Richard; Jaeger, Andreas; Jalocha, Pawel; Jans, Eddy; Jaton, Pierre; Jawahery, Abolhassan; Jing, Fanfan; John, Malcolm; Johnson, Daniel; Jones, Christopher; Joram, Christian; Jost, Beat; Jurik, Nathan; Kandybei, Sergii; Kanso, Walaa; Karacson, Matthias; Karbach, Moritz; Karodia, Sarah; Kelsey, Matthew; Kenyon, Ian; Ketel, Tjeerd; Khanji, Basem; Khurewathanakul, Chitsanu; Klaver, Suzanne; Klimaszewski, Konrad; Kochebina, Olga; Kolpin, Michael; Komarov, Ilya; Koopman, Rose; Koppenburg, Patrick; Korolev, Mikhail; Kozlinskiy, Alexandr; Kravchuk, Leonid; Kreplin, Katharina; Kreps, Michal; Krocker, Georg; Krokovny, Pavel; Kruse, Florian; Kucewicz, Wojciech; Kucharczyk, Marcin; Kudryavtsev, Vasily; Kurek, Krzysztof; Kvaratskheliya, Tengiz; La Thi, Viet Nga; Lacarrere, Daniel; Lafferty, George; Lai, Adriano; Lambert, Dean; Lambert, Robert W; Lanfranchi, Gaia; Langenbruch, Christoph; Langhans, Benedikt; Latham, Thomas; Lazzeroni, Cristina; Le Gac, Renaud; van Leerdam, Jeroen; Lees, Jean-Pierre; Lefèvre, Regis; Leflat, Alexander; Lefrançois, Jacques; Leo, Sabato; Leroy, Olivier; Lesiak, Tadeusz; Lespinasse, Mickael; Leverington, Blake; Li, Yiming; Likhomanenko, Tatiana; Liles, Myfanwy; Lindner, Rolf; Linn, Christian; Lionetto, Federica; Liu, Bo; Lohn, Stefan; Longstaff, Iain; Lopes, Jose; Lopez-March, Neus; Lowdon, Peter; Lu, Haiting; Lucchesi, Donatella; Luo, Haofei; Lupato, Anna; Luppi, Eleonora; Lupton, Oliver; Machefert, Frederic; Machikhiliyan, Irina V; Maciuc, Florin; Maev, Oleg; Malde, Sneha; Malinin, Alexander; Manca, Giulia; Mancinelli, Giampiero; Mapelli, Alessandro; Maratas, Jan; Marchand, Jean François; Marconi, Umberto; Marin Benito, Carla; Marino, Pietro; Märki, Raphael; Marks, Jörg; Martellotti, Giuseppe; Martens, Aurelien; Martín Sánchez, Alexandra; Martinelli, Maurizio; Martinez Santos, Diego; Martinez Vidal, Fernando; Martins Tostes, Danielle; Massafferri, André; Matev, Rosen; Mathe, Zoltan; Matteuzzi, Clara; Mazurov, Alexander; McCann, Michael; McCarthy, James; McNab, Andrew; McNulty, Ronan; McSkelly, Ben; Meadows, Brian; Meier, Frank; Meissner, Marco; Merk, Marcel; Milanes, Diego Alejandro; Minard, Marie-Noelle; Moggi, Niccolò; Molina Rodriguez, Josue; Monteil, Stephane; Morandin, Mauro; Morawski, Piotr; Mordà, Alessandro; Morello, Michael Joseph; Moron, Jakub; Morris, Adam Benjamin; Mountain, Raymond; Muheim, Franz; Müller, Katharina; Mussini, Manuel; Muster, Bastien; Naik, Paras; Nakada, Tatsuya; Nandakumar, Raja; Nasteva, Irina; Needham, Matthew; Neri, Nicola; Neubert, Sebastian; Neufeld, Niko; Neuner, Max; Nguyen, Anh Duc; Nguyen, Thi-Dung; Nguyen-Mau, Chung; Nicol, Michelle; Niess, Valentin; Niet, Ramon; Nikitin, Nikolay; Nikodem, Thomas; Novoselov, Alexey; O'Hanlon, Daniel Patrick; Oblakowska-Mucha, Agnieszka; Obraztsov, Vladimir; Oggero, Serena; Ogilvy, Stephen; Okhrimenko, Oleksandr; Oldeman, Rudolf; Onderwater, Gerco; Orlandea, Marius; Otalora Goicochea, Juan Martin; Owen, Patrick; Oyanguren, Maria Arantza; Pal, Bilas Kanti; Palano, Antimo; Palombo, Fernando; Palutan, Matteo; Panman, Jacob; Papanestis, Antonios; Pappagallo, Marco; Pappalardo, Luciano; Parkes, Christopher; Parkinson, Christopher John; Passaleva, Giovanni; Patel, Girish; Patel, Mitesh; Patrignani, Claudia; Pearce, Alex; Pellegrino, Antonio; Pepe Altarelli, Monica; Perazzini, Stefano; Perret, Pascal; Perrin-Terrin, Mathieu; Pescatore, Luca; Pesen, Erhan; Petridis, Konstantin; Petrolini, Alessandro; Picatoste Olloqui, Eduardo; Pietrzyk, Boleslaw; Pilař, Tomas; Pinci, Davide; Pistone, Alessandro; Playfer, Stephen; Plo Casasus, Maximo; Polci, Francesco; Poluektov, Anton; Polycarpo, Erica; Popov, Alexander; Popov, Dmitry; Popovici, Bogdan; Potterat, Cédric; Price, Eugenia; Prisciandaro, Jessica; Pritchard, Adrian; Prouve, Claire; Pugatch, Valery; Puig Navarro, Albert; Punzi, Giovanni; Qian, Wenbin; Rachwal, Bartolomiej; Rademacker, Jonas; Rakotomiaramanana, Barinjaka; Rama, Matteo; Rangel, Murilo; Raniuk, Iurii; Rauschmayr, Nathalie; Raven, Gerhard; Reichert, Stefanie; Reid, Matthew; dos Reis, Alberto; Ricciardi, Stefania; Richards, Sophie; Rihl, Mariana; Rinnert, Kurt; Rives Molina, Vincente; Roa Romero, Diego; Robbe, Patrick; Rodrigues, Ana Barbara; Rodrigues, Eduardo; Rodriguez Perez, Pablo; Roiser, Stefan; Romanovsky, Vladimir; Romero Vidal, Antonio; Rotondo, Marcello; Rouvinet, Julien; Ruf, Thomas; Ruiz, Hugo; Ruiz Valls, Pablo; Saborido Silva, Juan Jose; Sagidova, Naylya; Sail, Paul; Saitta, Biagio; Salustino Guimaraes, Valdir; Sanchez Mayordomo, Carlos; Sanmartin Sedes, Brais; Santacesaria, Roberta; Santamarina Rios, Cibran; Santovetti, Emanuele; Sarti, Alessio; Satriano, Celestina; Satta, Alessia; Saunders, Daniel Martin; Savrina, Darya; Schiller, Manuel; Schindler, Heinrich; Schlupp, Maximilian; Schmelling, Michael; Schmidt, Burkhard; Schneider, Olivier; Schopper, Andreas; Schune, Marie Helene; Schwemmer, Rainer; Sciascia, Barbara; Sciubba, Adalberto; Semennikov, Alexander; Sepp, Indrek; Serra, Nicola; Serrano, Justine; Sestini, Lorenzo; Seyfert, Paul; Shapkin, Mikhail; Shapoval, Illya; Shcheglov, Yury; Shears, Tara; Shekhtman, Lev; Shevchenko, Vladimir; Shires, Alexander; Silva Coutinho, Rafael; Simi, Gabriele; Sirendi, Marek; Skidmore, Nicola; Skwarnicki, Tomasz; Smith, Anthony; Smith, Edmund; Smith, Eluned; Smith, Jackson; Smith, Mark; Snoek, Hella; Sokoloff, Michael; Soler, Paul; Soomro, Fatima; Souza, Daniel; Souza De Paula, Bruno; Spaan, Bernhard; Sparkes, Ailsa; Spradlin, Patrick; Sridharan, Srikanth; Stagni, Federico; Stahl, Marian; Stahl, Sascha; Steinkamp, Olaf; Stenyakin, Oleg; Stevenson, Scott; Stoica, Sabin; Stone, Sheldon; Storaci, Barbara; Stracka, Simone; Straticiuc, Mihai; Straumann, Ulrich; Stroili, Roberto; Subbiah, Vijay Kartik; Sun, Liang; Sutcliffe, William; Swientek, Krzysztof; Swientek, Stefan; Syropoulos, Vasileios; Szczekowski, Marek; Szczypka, Paul; Szumlak, Tomasz; T'Jampens, Stephane; Teklishyn, Maksym; Tellarini, Giulia; Teubert, Frederic; Thomas, Christopher; Thomas, Eric; van Tilburg, Jeroen; Tisserand, Vincent; Tobin, Mark; Tolk, Siim; Tomassetti, Luca; Tonelli, Diego; Topp-Joergensen, Stig; Torr, Nicholas; Tournefier, Edwige; Tourneur, Stephane; Tran, Minh Tâm; Tresch, Marco; Trisovic, Ana; Tsaregorodtsev, Andrei; Tsopelas, Panagiotis; Tuning, Niels; Ubeda Garcia, Mario; Ukleja, Artur; Ustyuzhanin, Andrey; Uwer, Ulrich; Vagnoni, Vincenzo; Valenti, Giovanni; Vallier, Alexis; Vazquez Gomez, Ricardo; Vazquez Regueiro, Pablo; Vázquez Sierra, Carlos; Vecchi, Stefania; Velthuis, Jaap; Veltri, Michele; Veneziano, Giovanni; Vesterinen, Mika; Viaud, Benoit; Vieira, Daniel; Vieites Diaz, Maria; Vilasis-Cardona, Xavier; Vollhardt, Achim; Volyanskyy, Dmytro; Voong, David; Vorobyev, Alexey; Vorobyev, Vitaly; Voß, Christian; de Vries, Jacco; Waldi, Roland; Wallace, Charlotte; Wallace, Ronan; Walsh, John; Wandernoth, Sebastian; Wang, Jianchun; Ward, David; Watson, Nigel; Websdale, David; Whitehead, Mark; Wicht, Jean; Wiedner, Dirk; Wilkinson, Guy; Williams, Matthew; Williams, Mike; Wilson, Fergus; Wimberley, Jack; Wishahi, Julian; Wislicki, Wojciech; Witek, Mariusz; Wormser, Guy; Wotton, Stephen; Wright, Simon; Wu, Suzhi; Wyllie, Kenneth; Xie, Yuehong; Xing, Zhou; Xu, Zhirui; Yang, Zhenwei; Yuan, Xuhao; Yushchenko, Oleg; Zangoli, Maria; Zavertyaev, Mikhail; Zhang, Liming; Zhang, Wen Chao; Zhang, Yanxi; Zhelezov, Alexey; Zhokhov, Anatoly; Zhong, Liang; Zvyagin, Alexander

2014-10-14

The production of $\\chi_b$ mesons in proton-proton collisions is studied using a data sample collected by the LHCb detector, at centre-of-mass energies of $\\sqrt{s}=7$ and $8$ TeV and corresponding to an integrated luminosity of 3.0 fb$^{-1}$. The $\\chi_b$ mesons are identified through their decays to $\\Upsilon(1S)\\gamma$ and $\\Upsilon(2S)\\gamma$ using photons that converted to $e^+e^-$ pairs in the detector. The $\\chi_b(3P)$ meson mass, and the relative prompt production rate of $\\chi_{b1}(1P)$ and $\\chi_{b2}(1P)$ mesons as a function of the $\\Upsilon(1S)$ transverse momentum in the $\\chi_b$ rapidity range 2.0< $y$<4.5, are measured. Assuming a mass splitting between the $\\chi_{b1}(3P)$ and the $\\chi_{b2}(3P)$ states of 10.5 MeV/$c^2$, the mass of the $\\chi_{b1}(3P)$ meson is \\begin{equation*} m(\\chi_{b1}(3P))= 10515.7^{+2.2}_{-3.9}(stat) ^{+1.5}_{-2.1}(syst) MeV/c^2. \\end{equation*}

From Negative to Positive Stability: How the Syrian Refugee Crisis Can Improve Jordan’s Outlook

Science.gov (United States)

2015-01-01

transit hub. Some Syrian refugees are working in the tourism industry in Aqaba, although the exact number of Syrians in the far south is unknown.6 5...2014; Alqadi and Kumar, 2014; and Greenwood, 2014. 26 See UNHCR, 2014b. 27 Altz-Stamm, 2012, and others point out that tourism also places significant...the same page, they also state that dark -skinned refugees reported more security inci- dents and greater fear of Jordanians than light-skinned

[Christian Westerhoff. Zwangsarbeit im Ersten Weltkrieg. Deutsche Arbeitskräftepolitik im besetzten Polen und Litauen 1914-1918, Tilman Plath.Zwischen Schonung und Menschenjagden. Die Arbeitseinsatzpolitik in den baltischen Generalbezirken des Reich

Index Scriptorium Estoniae

Hiio, Toomas, 1965-

2014-01-01

Arvustus: Westerhoff, Christian. Zwangsarbeit im Ersten Weltkrieg. Deutsche Arbeitskräftepolitik im besetzten Polen und Litauen 1914-1918 (Studien zur historischen Migrationsforschung, 25). Verlag Ferdinand Schöningh. Padeborn 2011

Lagrangian Stochastic Dispersion Model IMS Model Suite and its Validation against Experimental Data

International Nuclear Information System (INIS)

Bartok, J.

2010-01-01

The dissertation presents IMS Lagrangian Dispersion Model, which is a 'new generation' Slovak dispersion model of long-range transport, developed by MicroStep-MIS. It solves trajectory equation for a vast number of Lagrangian 'particles' and stochastic equation that simulates the effects of turbulence. Model contains simulation of radioactive decay (full decay chains of more than 300 nuclides), and dry and wet deposition. Model was integrated into IMS Model Suite, a system in which several models and modules can run and cooperate, e.g. LAM model WRF preparing fine resolution meteorological data for dispersion. The main theme of the work is validation of dispersion model against large scale international campaigns CAPTEX and ETEX, which are two of the largest tracer experiments. Validation addressed treatment of missing data, data interpolation into comparable temporal and spatial representation. The best model results were observed for ETEX I, standard results for CAPTEXes and worst results for ETEX II, known in modelling community for its meteorological conditions that can be hardly resolved by models. The IMS Lagrangian Dispersion Model was identified as capable long range dispersion model for slowly- or nonreacting chemicals and radioactive matter. Influence of input data on simulation quality is discussed within the work. Additional modules were prepared according to praxis requirement: a) Recalculation of concentrations of radioactive pollutant into effective doses form inhalation, immersion in the plume and deposition. b) Dispersion of mineral dust was added and tested in desert locality, where wind and soil moisture were firstly analysed and forecast by WRF. The result was qualitatively verified in case study against satellite observations. (author)

Seasonal behaviour of B0 and B1

International Nuclear Information System (INIS)

Mosert Gonzalez, M. de; Radicella, S.M.

1997-01-01

A preliminary analysis of the thickness parameter B0 and the shape parameter B1 is presented. Noon electron density profiles recorded at five ionospheric stations during different seasonal and solar activity conditions are used in the study. The results show that both parameters present a seasonal trend with minimum value for B0 during the local winter and maximum during the local summer. This behaviour is inverted for B1. Discrepancies with IRI-90 model are found. (author). 8 refs, 4 figs, 2 tabs

Induction of encephalitis in rhesus monkeys infused with lymphocryptovirus-infected B-cells presenting MOG(34-56 peptide.

Directory of Open Access Journals (Sweden)

Krista G Haanstra

Full Text Available The overlapping epidemiology of multiple sclerosis (MS and Epstein-Barr virus (EBV, the increased risk to develop MS after infectious mononucleosis (IM and the localization of EBV-infected B-cells within the MS brain suggest a causal link between EBV and MS. However, the underlying mechanism is unknown. We hypothesize that EBV-infected B-cells are capable of eliciting a central nervous system (CNS targeting autoimmune reaction. To test this hypothesis we have developed a novel experimental model in rhesus monkeys of IM-like disease induced by infusing autologous B-lymphoblastoid cells (B-LCL. Herpesvirus papio (HVP is a lymphocryptovirus related to EBV and was used to generate rhesus monkey B-LCL. Three groups of five animals were included; each group received three intravenous infusions of B-LCL that were either pulsed with the encephalitogenic self peptide MOG(34-56 (group A, a mimicry peptide (981-1003 of the major capsid protein of cytomegalovirus (CMVmcp(981-1003; group B or the citrullinated MOG(34-56 (cMOG(34-56; group C. Groups A and B received on day 98 a single immunization with MOG(34-56 in incomplete Freund's adjuvant (IFA. Group C monkeys were euthanized just prior to day 98 without booster immunization. We observed self-peptide-specific proliferation of T-cells, superimposed on similar strong proliferation of CD3(+CD8(+ T-cells against the B-LCL as observed in IM. The brains of several monkeys contained perivascular inflammatory lesions of variable size, comprising CD3(+ and CD68(+ cells. Moreover, clusters of CD3(+ and CD20(+ cells were detected in the meninges. The only evident clinical sign was substantial loss of bodyweight (>15%, a symptom observed both in early autoimmune encephalitis and IM. In conclusion, this model suggests that EBV-induced B-LCL can elicit a CNS targeting inflammatory (autoimmune reaction.

Toward an Intelligent Ion Mobility Spectrometer (IMS)

International Nuclear Information System (INIS)

McJunkin, Timothy R.; Scott, Jill R.; Miller, Carla J.

2003-01-01

The ultimate goal is to design and build a very smart ion mobility spectrometer (IMS) that can operate autonomously. To accomplish this, software capable of interpreting spectra so that it can be used in control loops for data interpretation as well as adjusting instrument parameters is being developed. Fuzzy logic and fuzzy numbers are used in this IMS spectra classification scheme. Fuzzy logic provides a straight forward method for developing a classification/detection system, whenever rules for classifying the spectra can be described linguistically. Instead of using 'max' and 'min' values, the product of the truth values is used to determine class membership. Using the product allows rule-bases that utilize the AND function to allow each condition to discount truth value in determining membership, while rule-bases with an OR function are allowed to accumulate membership. Fuzzy numbers allow encapsulation of the uncertainties due to ion mobility peak widths as well as measured instrumental parameters, such as pressure and temperature. Associating a peak with a value of uncertainty, in addition to making adjustments to the mobility calculation based on variations in measured parameters, enables unexpected shifts to be more reliably detected and accounted for; thereby, reducing the opportunity for 'false negative' results. The measure of uncertainty is anticipated to serve the additional purpose of diagnosing the operational conditions of the IMS instrument.

Die emotionale Dimension während der Sprechproduktion im Fremdsprachenlernprozess

Directory of Open Access Journals (Sweden)

Bahar İŞİGÜZEL

2017-12-01

Full Text Available Die Gefühle bzw. Emotionen der Lernenden beim Fremdsprachenlehr- und Lernprozess spielen eine wichtige Rolle. Mit der Verknüpfung der Emotion und Kognition beim Lernprozess, haben die positiven Gefühle eine große Bedeutung für den Lernerfolg. Als eine produktive Fertigkeit hat das Sprechen eine wesentlich intensive Beziehung mit den Emotionen, weil es in der realen Zeit fließend laufen muss. Der Lernende soll bei der Sprechproduktion spontan die richtigen Wörter auf die richtige Art und Weise anwenden und sie auch noch verständlich aussprechen. Leider erreicht die Sprechfertigkeit meistens eine niedrigere Niveaustufe als die anderen drei (Schreiben, Lesen und Hören Fertigkeiten im Fremdsprachenunterrichtprozess. Diese qualitative Untersuchung konzentriert sich auf die Daten (Tonaufnahme, die anhand eines Interviews während einer Sprechproduktionsübung im universitären Fremdsprachenunterricht gesammelt wurden. Um die emotionale Dimension der Lernenden während der Sprechproduktion zu identifizieren, wurden im Einzelinterview die Frage „Wie fühlst du dich während du eine Fremdsprache (Englisch sprichst?“ gestellt. Die Teilnehmer dieser Untersuchung waren 29 Studenten, die im WS 2016 - 2017 an Universität Nevşehir Hacı Bektaş Veli (Türkei immatrikuliert waren. Die Auswertung des Interviews folgte mit einer Transkription und einer Interpretation der Tonaufnahmen. Die Meinungen zu der emotionalen Dimension während der Sprechproduktion der Studenten wurden kategorisiert. Die Resultate dieser qualitativen Untersuchung zeigen, dass die emotionale Dimension der Lernenden im universitären Kontext sich in drei Kategorien (positiv, negativ und frühere Ausbildung verteilen.

Broad and potent immune responses to a low dose intradermal HIV-1 DNA boosted with HIV-1 recombinant MVA among healthy adults in Tanzania☆,☆☆

Science.gov (United States)

Bakari, Muhammad; Aboud, Said; Nilsson, Charlotta; Francis, Joel; Buma, Deus; Moshiro, Candida; Aris, Eric A.; Lyamuya, Eligius F.; Janabi, Mohamed; Godoy-Ramirez, Karina; Joachim, Agricola; Polonis, Victoria R.; Bråve, Andreas; Earl, Patricia; Robb, Merlin; Marovich, Mary; Wahren, Britta; Pallangyo, Kisali; Biberfeld, Gunnel; Mhalu, Fred; Sandström, Eric

2016-01-01

Background We conducted a phase I/II randomized placebo-controlled trial with the aim of exploring whether priming with a low intradermal dose of a multiclade, multigene HIV-1 DNA vaccine could improve the immunogenicity of the same vaccine given intramuscularly prior to boosting with a heterologous HIV-1 MVA among healthy adults in Dar es Salaam, Tanzania. Methods Sixty HIV-uninfected volunteers were randomized to receive DNA plasmid vaccine 1 mg intradermally (id), n = 20, or 3.8 mg intramuscularly (im), n = 20, or placebo, n = 20, using a needle-free injection device. DNA plasmids encoding HIV-1 genes gp160 subtype A, B, C; rev B; p17/p24 gag A, B and Rtmut B were given at weeks 0, 4 and 12. Recombinant MVA (108 pfu) expressing HIV-1 Env, Gag, Pol of CRF01_AE or placebo was administered im at month 9 and 21. Results The vaccines were well tolerated. Two weeks after the third HIV-DNA injection, 22/38 (58%) vaccinees had IFN-γ ELISpot responses to Gag. Two weeks after the first HIV-MVA boost all 35 (100%) vaccinees responded to Gag and 31 (89%) to Env. Two to four weeks after the second HIV-MVA boost, 28/29 (97%) vaccinees had IFN-γ ELISpot responses, 27 (93%) to Gag and 23 (79%) to Env. The id-primed recipients had significantly higher responses to Env than im recipients. Intracellular cytokine staining for Gag-specific IFN-γ/IL-2 production showed both CD8+ and CD4+ T cell responses. All vaccinees had HIV-specific lymphoproliferative responses. All vaccinees reacted in diagnostic HIV serological tests and 26/29 (90%) had antibodies against gp160 after the second HIV-MVA boost. Furthermore, while all of 29 vaccinee sera were negative for neutralizing antibodies against clade B, C and CRF01 AE pseudoviruses in the TZM-bl neutralization assay, in a PBMC assay, the response rate ranged from 31% to 83% positives, depending upon the clade B or CRF01_AE virus tested. This vaccine approach is safe and highly immunogenic. Low dose, id HIV-DNA priming elicited higher

The IMS Software Integration Platform

Science.gov (United States)

1993-04-12

products to incorporate all data shared by the IMS applications. Some entities (time-series, images, a algorithm -specific parameters) must be managed...dbwhoanii, dbcancel Transaction Management: dbcommit, dbrollback Key Counter Assignment: dbgetcounter String Handling: cstr ~to~pad, pad-to- cstr Error...increment *value; String Maniputation: int cstr topad (array, string, arraylength) char *array, *string; int arrayjlength; int pad tocstr (string

Biomechanisch-kinemetrische Bewegungsanalyse und Ansätze zur Bewegungssteuerung für ein Training im Wellenreiten

OpenAIRE

Matschkur, Tina

2008-01-01

Neben der biomechanisch-kinemetrischen Bewegungsanalyse einzelner ausgewählter Techniken im Wellenreiten beschäftigt sich diese Dissertation auch ansatzweise im Rahmen einer elektromyographischen Fallstudie mit der muskulären Koordination bei der Bewegungsausführung im Surfen, um daraus Schlussfolgerungen für das Training im Wellenreiten treffen zu können. Ein geschichtlicher und wissenschaftlicher Überblick über das Wellenreiten leitet das Thema ein und macht somit auf die besondere Ausgangs...

Quad-Polarization Transmission for High-Capacity IM/DD Links

DEFF Research Database (Denmark)

Estaran Tolosa, Jose Manuel; Castaneda, Mario A. Usuga; Porto da Silva, Edson

2014-01-01

We report the first experimental demonstration of IM/DD links usi ng four states of polarization. Fiber - Induced polarization rotation is compensated with a simple tracking algorithm operating on the Stokes space. The principle is prove n at 128 Gb/s over 2 - km SSMF......We report the first experimental demonstration of IM/DD links usi ng four states of polarization. Fiber - Induced polarization rotation is compensated with a simple tracking algorithm operating on the Stokes space. The principle is prove n at 128 Gb/s over 2 - km SSMF...

Climate protection by reducing the emissions of greenhouse gases in households and the tertiary sector through climate-conscious behaviour. Vol. 1; Klimaschutz durch Minderung von Treibhausgasemissionen im Bereich Haushalte und Kleinverbrauch durch klimagerechtes Verhalten. Bd. 1. Private Haushalte

Energy Technology Data Exchange (ETDEWEB)

Brohmann, B; Cames, M

2000-06-01

The aim of the project was to identify areas in households and the tertiary sector in which changes in behaviour could result in energy conservation and thus a reduction of greenhouse gas emissions, and to quantify the potentials for 1995, 2005 and 2020. A second focus was on the analysis and evaluation of programmes and instruments to realise the potentials. With literature evaluation, expert interviews, and a household servey potentials and further technical development have been identified. In sum, behavioural measures can contribute to the CO2 reduction by 64 million tons in 1995 in households and 27 in the commercial sector in which the potential decreases to 18 million tons in 2020 due to the autonomous technical development. Adequate promotion programmes can help to realise 20-30% of the potential by 2020. (orig.) [German] Ziel des Vorhabens war, im Sektor private Haushalte und Kleinverbrauch Bereiche zu identifizieren, in denen Verhaltensaenderungen zur Energieeinsparung fuehren koennen, und diese Potenziale fuer 1995, 2005 und 2020 zu quantifizieren. Darauf aufbauend waren Programme und Instrumente zur Umsetzung aufzuzeigen und zu bewerten. Gestuetzt auf Literaturrecherchen und Expertengespraeche wurden Einzelpotenziale, Rahmenbedingungen, Entwicklungstrends in der Technik und im Ausstattungsgrad ermittelt. Insgesamt koennten Verhaltensmassnahmen im Haushaltssektor die CO2-Emissionen im Basisjahr 1995 um 64 Mio, im Kleinverbrauch um 27 Mio t vermindern. Bis 2020 bleibt dieses Potenzial im Haushaltssektor in etwa gleich. Im Kleinverbrauch sinkt es infolge der autonomen Technikentwicklung auf 18 Mio t ab. Durch geeignete Programme koennen bis 2020 etwa 20-30% des Potenzials erreicht werden. (orig.)

Análisis espectral del Lago de Guadalupe, mediante imágenes de satélite y datos in situ

Directory of Open Access Journals (Sweden)

Raúl Aguirre Gómez

2014-01-01

Full Text Available El Lago de Guadalupe es un embalse localizado en los alrededores de la Ciudad de México, y recibe un volume considerable de aguas residuales. En este trabajo se presenta un análisis espectral del Lago de Guadalupe utilizando imágenes SPOT y datos colectados in situ. Las mediciones fueron realizadas en los meses de febrero y septiembre de 2006. Las variables medidas incluyen temperatura, pH, clorofila a, transparencia Secchi y datos satelitales, cuasisimultáneos, obtenidos de imágenes SPOT. Este cuerpo de agua es eutrófico, con valores básicos de pH (6.8 – 11.3 y altas concentraciones de clorofila-a (6.9-112.4 μg l-1 y valores bajos de transparencia Secchi. Térmicamente, el lago es cálido monomíctico. Los resultados indican un alto grado de eutrofización, debida principalmente a la presencia de fitoplancton, vegetación sumergida y flotante. La distribución de la vegetación es cuasi-homogénea en el embalse a excepción de un punto de muestreo.

Teilen, Sharing 1 und Sharing 2: die Sharing Economy im Licht theoretischer Zugänge

OpenAIRE

Haase, Michaela; Pick, Doreén

2016-01-01

Der Artikel geht theoretischen Zugängen zum Sharing-Begriff nach. Er erläutert den Beitrag, aber auch die Grenzen von Dienstleistungstheorie und Property-Rights-Theorie für das Verständnis der Sharing Economy. Gründe für die Unterscheidung zwischen kommerzieller und nichtkommerzieller Sharing Economy werden dargelegt sowie mögliche Impulse der Sharing Economy für Änderungen im Verständnis wirtschaftlichen Handels und seiner Organisationsformen erörtert. This article elaborates on theoretic...

Bendrieji rytų baltų kalbų gérti, gẽria, gė́rė– dzer̂t, dzer̦u, dzêru tipo veiksmažodžiai

Directory of Open Access Journals (Sweden)

Audronė Kaukienė

2011-12-01

Full Text Available DIE GEMEINSAMMEN OSTBALTISCHEN VERBEN DES TYPS gérti, gẽria, gė́rė – dzer̂t, dzer̦u, dzêru ZusammenfassungIn dem Artikel werden die Paare der Wurzelverben des Typs Cē̆r im Litauischen und Lettischen untersucht. Die gemeinsamen ostbaltischen Verben des Typs gérti werden von verschiedenen (semanti­schen, morphologischen, morphfonologischen u. a. Standpunkten besprochen. Die Daten der beiden baltischen Sprachen und die Entsprechungen anderer verwandten Sprachen werden verglichen, mit dem Ziel, Ähnlichkeiten und Unterschiede festzustellen. Gleichzeitig versucht man die Formation des struk­turellen Typs selbst, die Bedingungen und Zeit seiner Bildung zu klären.Die meisten zur Analyse stehenden Verben weisen alte Wurzeln, Äquivalente in anderen verwandten Sprachen auf. Im Preußischen hat das verbale Wurzeläquivalent nur die ostbaltische Wurzel *u̯ē̆r- „öffnen": pr. etwēre „(du öffnest“, etwerreis „öffne“. Andere Wörter haben Ableitungen in anderen verwandten Sprachen. Manche Wurzeln sind im Preußischen überhaupt nicht fixiert worden, z. B.: *bē̆r- / *bī̆r-“streuen, ausfallen“.Der Artikel besteht aus drei Teilen: in dem ersten wird die Semantik, in dem zweiten Morphfonologie (Vokalismus, Betonung, Konsonantismus und in dem dritten Morphologie (die verbalen Stämme des Präsens und Präteritums, Beziehungen zwischen Verben, die aus gleichen Wurzeln stammen, doch den anderen strukturellen Typ aufweisen; die baltischen Beispiele werden mit Entsprechungen anderer Sprachen verglichen besprochen.Die Untersuchung hat gezeigt, dass die analysierten Verben der gemeinsamen ostbaltischen lexi­kalischen Schicht angehören, weil sie strukturell identisch und semantisch sehr nah sind.Es sind zwei wichtigste semantische Merkmale der Verben deutlich geworden: für diese ist die Bedeutungsveränderung (und die damit verbundene Vieldeutigkeit charakteristisch, sie zeigen auch sehr große Ähnlichkeit zwischen

[Perceptions of Loss, Decline and Doom in the Baltic Sea - Untergangsvorstellungen im Ostseeraum] / David Feest

Index Scriptorium Estoniae

Feest, David, 1969-

2011-01-01

Arvustus : Perceptions of Loss, Decline and Doom in the Baltic Sea - Untergangsvorstellungen im Ostseeraum. Berlin : Berliner Wissenschafts-Verlag, 2004. (Die Ostseeregione: Nördliche Dimensionen - Europäische Perspektiven. 1)

Comparison of genetic variations of the SLCO1B1, SLCO1B3, and SLCO2B1 genes among five ethnic groups.

Science.gov (United States)

Namgoong, Suhg; Cheong, Hyun Sub; Kim, Ji On; Kim, Lyoung Hyo; Na, Han Sung; Koh, In Song; Chung, Myeon Woo; Shin, Hyoung Doo

2015-11-01

Organic anion-transporting polypeptide (OATP; gene symbol, SLCO) transporters are generally involved in the uptake of multiple drugs and their metabolites at most epithelial barriers. The pattern of single-nucleotide polymorphisms (SNPs) in these transporters may be determinants of interindividual variability in drug disposition and response. The objective of this study was to define the distribution of SNPs of three SLCO genes, SLCO1B1, SLCO1B3, and SLCO2B1, in a Korean population and other ethnic groups. The study was screened using the Illumina GoldenGate assay for genomic DNA from 450 interethnic subjects, including 11 pharmacogenetic core variants and 76 HapMap tagging SNPs. The genotype distribution of the Korean population was similar to East Asian populations, but significantly different from African American and European American cohorts. These interethnic differences will be useful information for prospective studies, including genetic association and pharmacogenetic studies of drug metabolism by SLCO families. Copyright © 2015 Elsevier B.V. All rights reserved.

Medida de similaridad entre imágenes de marcas de ganado mediante distribuciones de forma

Directory of Open Access Journals (Sweden)

Germán Sánchez Torres

2014-12-01

Full Text Available Este documento reporta los resultados de una investigación orientada hacia el diseño de un método de tratamiento de imágenes digitales para la automatización de los procesos de registro y control de marcas de ganado requeridas por las regulaciones del sector ganadero en Colombia. El método permite automatizar los procesos de búsqueda y de comparación necesarios para garantizar la unicidad de las marcas dentro de un sistema asistido por computadora. Se inicia con la generación de un histograma estimado de la geometría de la marca, lo que permite comparar y detectar similitudes entre las figuras previamente almacenadas, mediante una métrica de similitud basada en la distancia de Minkowski. Los resultados obtenidos indican que el método es adecuado para realizar un proceso de discriminación de dichas imágenes, reducir las ambigüedades y garantizar la unicidad de los registros. Los resultados obtenidos y un análisis de su aplicación son reportados.

Female teams im eSport: Re-Konstruktion der Kategorie Geschlecht

OpenAIRE

Streubel, Anett

2010-01-01

"Das Ziel dieses Papers ist es, die Herausbildung von "female Teams" im eSport zu untersuchen. Das Hauptaugenmerk liegt hierbei auf Rekonstruktionsmechanismen der Kategorie Geschlecht, welche durch Sprache und Diskurse gebildet, erlernt und fortgeführt werden. Der Anteil der Spielerinnen, die das Computerspielen als Sport betreiben, wächst stetig an - deshalb soll in dieser Studie der Profibereich des eSport näher betrachtet werden. In einem Tätigkeitsfeld, in dem nicht der Körper im Mittelpu...

[Glanz und Elend - Mythos und Wirklichkeit der Herrenhäuser im Baltikum] / Karsten Brüggemann

Index Scriptorium Estoniae

Brüggemann, Karsten, 1965-

2014-01-01

Arvustus: Glanz und Elend - Mythos und Wirklichkeit der Herrenhäuser im Baltikum. Hrsg. von Ilse von zur Mühlen im Auftrag der Carl-Schirren-Gesellschaft e.V. und des Ostpreußischen Landesmuseums Lüneburg. Kunstverlag Josef Fink. Lindenberg im Allgäu 2012

Jumonji/Arid1b (Jarid1b) protein modulates human esophageal cancer cell growth

Science.gov (United States)

KANO, YOSHIHIRO; KONNO, MASAMITSU; OHTA, KATSUYA; HARAGUCHI, NAOTSUGU; NISHIKAWA, SHIMPEI; KAGAWA, YOSHINORI; HAMABE, ATSUSHI; HASEGAWA, SHINICHIRO; OGAWA, HISATAKA; FUKUSUMI, TAKAHITO; NOGUCHI, YUKO; OZAKI, MIYUKI; KUDO, TOSHIHIRO; SAKAI, DAISUKE; SATOH, TAROH; ISHII, MASARU; MIZOHATA, EIICHI; INOUE, TAKESHI; MORI, MASAKI; DOKI, YUICHIRO; ISHII, HIDESHI

2013-01-01

Although esophageal cancer is highly heterogeneous and the involvement of epigenetic regulation of cancer stem cells is highly suspected, the biological significance of epigenetically modified molecules that regulate different subpopulations remains to be firmly established. Using esophageal cancer cells, we investigated the functional roles of the H3K4 demethylase Jumonji/Arid1b (Jarid1b) (Kdm5b/Plu-1/Rbp2-h1), an epigenetic factor that is required for continuous cell growth in melanoma. JARID1B knockdown resulted in the suppression of esophageal cancer cell growth, sphere formation and invasion ability and was associated with loss of epithelial marker expression. However, these inhibitory effects observed on tumor formation were reverted subsequent to subcutaneous inoculation of these cells into immune-deficient mice. These results indicated that JARID1B plays a role in maintaining cancer stem cells in the esophagus and justifies the rationale for studying the effects of continuous inhibition of this epigenetic factor in esophageal cancer. PMID:24649241

Finanzmärkte – Unternehmungen – Informationen: Ergebnisse des Projektes im Wintersemester 2016/2017

OpenAIRE

Geyer, Helmut; Grau, Svenja; Giersch, Peter; Eckardt, Maximilian; Eder, Josephin; Catholy, Victoria; Pisak, Anastasia; Löser, Matthias; Jehring, Maximilian; Zhang, Haoyang; Grabengießer, Anja; Gruschwitz, Karoline; Heinrich, Katharina; Patzer, Vivien; Päsler, Florian

2018-01-01

Der vorliegende Beitrag der Wirtschaftswissenschaftlichen Schriften ist ein Sammelband, der die Beiträge der Studierenden des 2. Fachsemesters im Masterstudiengang General Management aus dem Wintersemester 2016/2017 umfasst. Die Einzelbeiträge wurden in einer zwei Monate dauernden Projektarbeit im Herbst 2016 erarbeitet und im Januar 2017 präsentiert. Der Themenschwerpunkt für dieses Jahr lag auf dem Bereich "Immobilien/Wohnungspolitik". Innerhalb dieser Vorgabe wurde ein breites Spektrum bea...

Hepatitis B vaccination in prison with a 3-week schedule is more efficient than the standard 6-month schedule

DEFF Research Database (Denmark)

Christensen, Peer B; Fisker, Niels; Krarup, Henrik B

2004-01-01

A randomized study of injecting drug users in a Danish prison comparing vaccination at 0, 1 and 3 weeks with the 0, 1 and 6 months schedule (20microg Engerix B i.m.) was conducted. Due to a low participation rate, a second nonrandomized study was conducted in Estonia where all prisoners were vacc...

Datengeleitetes Lernen im studienbegleitenden Deutschunterricht am Beispiel des KoGloss-Ansatzes

OpenAIRE

Dubova, Agnese; Proveja, Egita

2016-01-01

Der vorliegende Aufsatz stellt den sprachdidaktischen Ansatz KoGloss vor und beschreibt die Möglichkeiten seines Einsatzes im studienbegleitenden Deutschunterricht. Als eine der Formen des datengeleiteten Lernens ermöglicht der KoGloss-Ansatz eine forschungsorientierte und lernerzentrierte Herangehensweise, die insbesondere im akademischen Sprachunterricht gefragt ist. Eine korpusbasierte Erschließung von (Fach-)Wörtern und komplexen sprachlichen Mustern, das learning by doing, die Kooperatio...

Data of evolutionary structure change: 1BT8B-1EN5B [Confc[Archive

Lifescience Database Archive (English)

Full Text Available e>KGLKK----GTTLQ >H ---- > ATOM ...bChain>B 1BT8B KNMAPKGSAPERPT cture>H ...DChain> LVLKG--DKLAV >EEEE -- EEEE...ence>LVWDPLGKRINT >EEEE EEEEe> AT...re> ATOM 2237 CA LYS B 80 12.251 15.102 18.409 1.00 11.94 C

A COMPARATIVE STUDY OF EFFICACY OF HYOSCINE BROMIDE (IV VERSUS TRAMADOL (IM VERSUS PARACETAMOL (IV ON CERVICAL DILATATION IN ACTIVE LABOUR

Directory of Open Access Journals (Sweden)

Sampathukumari S

2016-09-01

Full Text Available Labour is a natural process, which involves a series of regular and progressive uterine contractions causing effacement and dilatation of cervix leading to birth of the baby. In order to minimise the perinatal morbidity and mortality caused by the prolonged labour, several drugs have been tried to hasten the process of cervical dilatation and this study in one such exercise. AIM OF THE STUDY 1 To compare the efficacy of Hyoscine Bromide (IV vs. Tramadol (IM vs. Paracetamol (IV on cervical dilatation in active labour. 2 To compare the duration of active phase of labour. 150 full-term women with gestational age 37-42 weeks, primi and multi singleton pregnancy with cephalic presentation in active labour were included in the study. Cases were divided into 3 groups - Group A: 50 cases of labour accelerated by Hyoscine Bromide 20 mg (IV, Group B: 50 cases of labour accelerated by Tramadol 50 mg (IM and Group C: 50 cases of labour accelerated by Paracetamol 500 mg (IV. Mean duration of active phase of 1st stage of labour was 3 hrs. 8 mins. (primi and 2 hrs. 3 mins. (multi in Hyoscine Bromide group and 4 hrs. 8 mins. (primi and 3 hrs. 5 mins. (multi in Tramadol group and 4 hrs. 2 mins. (primi and 2 hrs. 5 mins. (multi in Paracetamol group. Mean rate of cervical dilatation was 1.5 cm/hr (primi and 2.6 cm/hr (multi in Hyoscine Bromide group, 1.2 cm/hr (primi and 1.6 cm/hr (multi in Tramadol group and 1.3 cm/hr (primi and 1.6 cm/hr (multi in the Paracetamol group. The difference between the groups A and B and A and C is significant (p=0.0001 and thus it is concluded that Hyoscine Bromide hastened the rate of cervical dilatation and reduced the duration of active phase of 1 st stage of labour. Divide the abstract into materials and methods, results and conclusion.

IMS IN SMES - REASONS, ADVANTAGES AND BARRIERS ON IMPLEMENTATION

Directory of Open Access Journals (Sweden)

Dragan Rajković

2008-09-01

Full Text Available Appearance of a number of management systems with various and sometimes divergent demands, demands for revise of optimal strategy on implementation of these standards in small and medium-sized enterprises (SMEs and the attempt on their integration into integrated management system are suggested even more. Firstly question on choice and reasons for implementation of standards is raised. Management and employees expect benefits on the implementation and they pass and minimize the implementation barriers. Basic concept on integrated management system (IMS into SMEs and analyse on reasons, advantages and barriers at IMS implementation are presented in this paper.

Reconocimiento de imágenes utilizando redes neuronales artificiales

OpenAIRE

García García, Pedro Pablo

2013-01-01

Este trabajo describe el proceso de extracción de patrones característicos de imágenes,mediante la ayuda de Redes Neuronales Artificiales. La información de la Red Neuronal junto con datos adicionales de las imágenes, serán almacenados en una base de datos y consumidos por un servicio web. Un teléfono móvil con sistema operativo Android consumirá la información almacenada en el servicio web. Posteriormente al realizar una captura de imagen con la cámara del teléfono, este procesará la imag...

ORGANIZATION OF THE nif GENES OF THE NONHETEROCYSTOUS CYANOBACTERIUM TRICHODESMIUM SP. IMS101.

Science.gov (United States)

Dominic, Benny; Zani, Sabino; Chen, Yi-Bu; Mellon, Mark T; Zehr, Jonathan P

2000-08-26

An approximately 16-kb fragment of the Trichodesmium sp. IMS101 (a nonheterocystous filamentous cyanobacterium) "conventional"nif gene cluster was cloned and sequenced. The gene organization of the Trichodesmium and Anabaena variabilis vegetative (nif 2) nitrogenase gene clusters spanning the region from nif B to nif W are similar except for the absence of two open reading frames (ORF3 and ORF1) in Trichodesmium. The Trichodesmium nif EN genes encode a fused Nif EN polypeptide that does not appear to be processed into individual Nif E and Nif N polypeptides. Fused nif EN genes were previously found in the A. variabilis nif 2 genes, but we have found that fused nif EN genes are widespread in the nonheterocystous cyanobacteria. Although the gene organization of the nonheterocystous filamentous Trichodesmium nif gene cluster is very similar to that of the A. variabilis vegetative nif 2 gene cluster, phylogenetic analysis of nif sequences do not support close relatedness of Trichodesmium and A. variabilis vegetative (nif 2) nitrogenase genes.

Novedosa técnica para la detección de imágenes pornográficas empleando modelos de color HSV y YCbCr

Directory of Open Access Journals (Sweden)

Jorge A. Marcial Basilio

2012-01-01

Full Text Available En este trabajo un novedoso método para la detección de imágenes con contenido explícito es propuesto usando la transformación del modelo de color RGB al modelo HSV ó YCbCr, el cual es el formato más común para imágenes que existen en Internet, además se propone el uso de un umbral para la detección de piel aplicando los modelos de color HSV y YCbCr. Aplicando el umbral propuesto la imagen es segmentada, una vez segmentada la imagen se calcula la cantidad de piel localizada en dicha imagen. Los resultados obtenidos usando el sistema propuesto son comparados con dos programas que cumplen con el mismo objetivo, el Forensic Toolkit 3.1 Explicit Image Detection (FTK 3.1 EID y el Paraben's Porn Detection Stick, los cuales son dos de las soluciones más empleadas para la detección de esta clase de imágenes. Los resultados reportados en este trabajo se obtuvieron utilizando tres conjuntos de imágenes, cada uno de los cuales consta de 800 imágenes elegidas aleatoriamente, de las cuales 400 son imágenes naturales y el resto son imágenes con contenido explícito, las cuales fueron ocupadas para probar el sistema propuesto y las dos herramientas comerciales . El sistema propuesto obtuvo un 78,75% de reconocimiento, 28% de falsos positivos y 14,50% de falsos negativos, el programa FTK 3.1 Explicit Image Detection logró un 72,12% de reconocimiento, 38,50% de falsos positivos y 17,25% de falsos negativos. Paraben's Porn Detection Stick obtuvo 74,25% de reconocimiento con 16% de falsos positivos y 35,50% de falsos negativos. Finalmente se pudo comprobar que el sistema propuesto logra detectar las imágenes bajo estudio mejor, que dos de las herramientas de software comerciales, más usadas por investigadores forenses, por lo que el método propuesto puede aplicarse para análisis forense informático o en detección de imágenes pornográficas almacenadas en dispositivos de almacenamiento masivo.

Variability in equatorial B0 and B1

International Nuclear Information System (INIS)

Adeniyi, J.O.; Radicella, S.M.

2002-01-01

Variability of ionospheric profile parameters B0 and B1, below the F2 peak is investigated for an equatorial station at two levels of solar activities. The whole 24 hours of the day and the four seasons of the year are covered. Absolute and relative variability indices were utilized in the study. Some evidences of correlations of variability index and profiles parameters were observed. Daytime values of relative variability in B1 at solar minimum were found to be greater than those of solar maximum. (author)

Professionalisierung und Doping im Sport

OpenAIRE

Wüterich, Christoph

2004-01-01

Der Beitrag untersucht Zusammenhänge zwischen der zunehmenden Professionalisierung des Sports und dem Anstieg von Dopingvergehen. Er zeigt, dass im historischen Vergleich beide Phänomene nicht neu sind, dass sich die Probleme aufgrund der steigenden Bedeutung des Leistungssports aber zugespitzt haben. Ausgehend von einer juristischen und sozioökonomischen Analyse der Anreize zu Doping werden Lösungsvorschläge entwickelt. The author analyzes the interdependencies between a growing commercia...

IM/DD vs. 4-PAM Using a 1550-nm VCSEL over Short-Range SMF/MMF Links for Optical Interconnects

DEFF Research Database (Denmark)

Karinou, Fotini; Rodes Lopez, Roberto; Prince, Kamau

2013-01-01

We experimentally compare the performance of 10.9-Gb/s IM/DD and 5-GBd 4-PAM modulation formats over 5-km SMF and 1-km MMF links, employing a commercially-available 1550-nm VCSEL as an enabling technology for use in optical interconnects.......We experimentally compare the performance of 10.9-Gb/s IM/DD and 5-GBd 4-PAM modulation formats over 5-km SMF and 1-km MMF links, employing a commercially-available 1550-nm VCSEL as an enabling technology for use in optical interconnects....

SAFIRA. Sub-project B 1.3: Development of coupled in-situ reactors and optimisation of the geochemical processes in the discharge of different in situ reactor sytems. Final report; SAFIRA. Teilprojekt B 1.3: Entwicklung von gekoppelten in situ-Reaktoren und Optimierung der geochemischen Prozesse im Abstrom von verschiedenen in situ-Reaktor-Systemen. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Dahmke, A.; Schaefer, D.; Koeber, R.; Plagentz, V.

2002-12-01

The Bitterfeld ground water is contaminated with many different pollutants over a large area. Long-term measures like reactive barriers for purification are required. However, groundwater contaminated with multiple contaminants cannot be purified by a single reactive material; for this reason, the effectivity of combinations of different reactive materials was investigated. Of the combinations investigated, reducing iron and activated carbon connected in series was the most effective: The iron will remove the reducible chlorinated hydrocarbons, while the rest of the contaminants are adsorbed to the activated carbon. Iron and ORC was another interesting option, but the combination of iron and activated carbon was found to be the most favourable option. Until a better method is available, it is recommended to connect iron and activated carbon in parallel for removing contaminant mixtures. Directly behind reactive iron barriers (also when combined with activated carbon), the limiting values of the Freshwater Ordinance for Fe(II) and pH are exceeded. Directly behind ORC reactors, the limiting values for Mg and pH are exceeded. Investigations in the outflow of these reactive materials showed that the high pH values are buffered by contact with the aquifer material to values typical of aquifers, which usually are below the limiting values of the Freshwater Ordinance. However, as the buffer capacity of the soil is exhausted, a zone with a higher pH starts to grow in the aquifer. The growth of this zone depends on the pH and on the aquifer material. Especially in soils as found at Bitterfeld, with a high concentration of organic matter, we find long-term desorption of pollutants from the aquifer materials which will burden the purified water leaving the water treatment system and prohibit its utilization. [German] Der Grundwasserleiter im Raum Bitterfeld ist grossraeumig mit vielen verschiedenen Substanzen kontaminiert. Aufgrund der grossraeumigen Erstreckung kommen nur

Polonium-210 and lead-210 in the Southern Polar Ocean: Naturally occurring tracers of biological and hydrographical processes in the surface waters of the Antarctic Circumpolar Current and the Weddell Sea; Polonium-210 und Blei-210 im Suedpolarmeer: Natuerliche Tracer fuer biologische und hydrographische Prozesse im Oberflaechenwasser des Antarktischen Zirkumpolarstroms und des Weddellmeeres

Energy Technology Data Exchange (ETDEWEB)

Friedrich, J.

1997-11-01

In this thesis the distribution of {sup 210}Po and {sup 210}Pb in the upper 600 m of the Antarctic Circumpolar Current and the Weddell Sea was investigated along north-south transects in austral spring and autumn. {sup 210}Po and {sup 210}Pb can serve as sensitive tracers for the special hydrographic conditions of the Antarctic Circumpolar Current and the Weddell Sea as well as for biological processes during phytoplankton blooms. The {sup 210}Po/{sup 210}Pb disequilibrium was used as a tracer for particle export. This tracer integrates export on a timescale of 276 days because of the 138 day half-life of {sup 210}Po and complements the {sup 234}Th/{sup 238}U disequilibrium as another tracer for plankton production and export on a shorter timescale of several weeks. (orig.) [Deutsch] In der vorliegenden Arbeit wurde die Verteilung von Blei-210 und seinem Enkelnuklid Polonium-210 im Antarktischen Zirkumpolarstrom und im Weddellmeer bis 600 m Tiefe in mehreren meridionalen Transekten im australen Fruehjahr und Herbst waehrend der `Polarstern`-Expeditionen ANT-X/6 und ANT-XI/4 untersucht. Die Verteilung von {sup 210}Pb und {sup 210}Po wird von mehreren Faktoren beeinflusst, sowohl durch die Advektion von Wassermassen im Antarktischen Zirkumpolarstrom und im Weddellmeer als auch von biologischen Prozessen z.B. innerhalb einer Planktonbluete. Bevor die Verteilungsmuster von {sup 210}Pb und {sup 210}Po jedoch als Tracer fuer einen Prozess genutzt werden koennen, muss der Effekt der einzelnen Faktoren auf die Verteilung betrachtet werden. (orig.)

bildbild – visuelle Kompetenz im Unterricht

Directory of Open Access Journals (Sweden)

Norbert Grube

2013-05-01

Full Text Available Der vorliegende Artikel stellt das Webseiten-Projekt bildbild vor. Der Webseite liegt die Motivation zugrunde, Schülerinnen und Schüler für ein Nachdenken über globale Themen zu sensibilisieren. Ein solches Nachdenken ist immer auch eines über bildlich vermittelte Wirklichkeit. Es ist mit bildbild ein Anliegen, angesichts einer allseits konstatierten «Bilderflut» ein didaktisches Medium zu entwickeln, das einen Fundus an historischen und aktuellen Fotografien zur Verfügung stellt und diese so aufbereitet, dass sie gerade nicht hinter ihrer illustrativen Funktion verschwinden. Dadurch sollen die Bilder für ein selbständiges Lernen auf dem Weg hin zu einer visuellen Kompetenz einsetzbar gemacht werden. Der Beitrag beleuchtet die Entwicklung der Webseite vor dem Hintergrund kulturkritischer Haltungen zum Bild seit der Moderne sowie im Rahmen dessen, was seit den 1970er Jahren im pädagogischen Kontext als Visual Literacy diskutiert und gefördert wird. Dabei wird auch auf die medialen Potenziale einer Webseite für die Bildlesekompetenz von Jugendlichen eingegangen.

A plan for location calibration of IMS stations and near Kazakhstan

International Nuclear Information System (INIS)

Richards, P.G.; Kim, W.-Yo.; Khalturin, V.I.

2001-01-01

For purposes of monitoring compliance with the Comprehensive Nuclear Test-Ban Treaty, it is desirable to be able to locate seismic events routinely to within an uncertainty not greater than 1000 square km. From more than five years of experience with publication of the Reviewed Event Bulletin (REB) by the Prototype International Data Centre (PIDC), resulting in estimated locations for more than 100,000 seismic events, it is apparent that improved location accuracy is needed in order to reduce uncertainties below 1000 square km. In this paper, we outline a three-year program of applied research which commenced in March 2000 and which has the goal of achieving improved REB locations based upon data to be contributed to the International Data Centre from 30 IMS stations in Eastern Asia. Our first efforts will focus on the four IMS seismographic stations in Kazakhstan (AKT, BRV, KUR, MAK), together with IMS stations ZAL in Russia and AAK in Kyrgyzstan. Following the recommendations of two 'IMS Location Calibration Workshops' held in Oslo, Norway, in 1999 and 2000, our approach is to generate station-specific travel times for each observable seismic phase, as a function of distance and azimuth (and depth, where possible). Such travel times are obtained on the basis of (i) early studies based mainly on earthquake data (e.g. Nersesov and Rautian, 1964), (ii) Deep Seismic Sounding, and (iii) recent studies of nuclear and chemical explosions. We are also using (iv) an empirical approach in which phases are picked at IMS stations, for so-called Ground Truth events whose location is known quite accurately on the basis of additional data, obtained for example from local and regional networks. (author)

Prognostische Bedeutung der Expression der P2RY8-CRLF2-Fusions-assoziierten Gene LRRC32, BMP6 und VPREB1 für die Akute Lymphoblastische Leukämie im Kindes- und Jugendalter

OpenAIRE

Buchmann, Swantje

2017-01-01

Die Optimierung der Therapie der kindlichen ALL kann möglicherweise durch die Identifikation neuer molekularer Marker geschehen, die diejenigen Patienten schon zum Diagnosezeitpunkt oder während der initialen Therapie als Hochrisikopatienten charakterisieren, die noch nicht als solche gelten, aber mit einer hohen Wahrscheinlichkeit ein Rezidiv erleiden werden. Im Rahmen der ALL BFM 2000-Studie konnte gezeigt werden, dass in einer Subgruppe der pB-ALL die Existenz der P2RY8-CRLF2-Fusion mit...

Development and characterization of La/B{sub 4}C multilayer systems as X-ray mirrors in the energy range 100-200 eV; Entwicklung und Charakterisierung von La/B{sub 4}C-Multischichtsystemen als Roentgenspiegel im Energiebereich 100-200 eV

Energy Technology Data Exchange (ETDEWEB)

Hendel, Stefan

2009-01-15

The main topics of this thesis are the development and characterization of La/B{sub 4}C multilayer systems. For this these materials were evaluated and characterized for the applied electron-beam evaporation. For the monitoring of the evaporation process two separate in-situ layer thicknesses were available. For periodic multilayer systems the X-ray reflectometry used for Mo/Si multilayers was accepted. Because of the change from Mo/Si on La/B{sub 4}C the driving of the evaporation process had to be material-conditionedly further developed and optimized. For the fabrication of aperiodic La/B{sub 4}C multilayer systems additionally an in-situ ellipsometer was taken into operation. Furthermore a decreasement of the interface roughnesses and by this following increasement of the reflectivities of La/B{sub 4}C multilayers by polishing of the single layers with accelerated ions during the fabrication shall be studied. The fabricated multilayers are characterized and evaluated concerning roughnesses, reflectivities, ans spectral band width. [German] Im Mittelpunkt dieser Arbeit stehen die Entwicklung und Charakterisierung von La/B{sub 4}C-Multischichtsystemen. Dazu wurden diese Materialien fuer die verwendete Elektronenstrahlverdampfung evaluiert und charakterisiert. Fuer die Ueberwachung des Aufdampfprozesses standen zwei separate In-situ Schichtdickenkontrollen zur Verfuegung. Fuer periodische Multischichtsysteme wurde die fuer Mo/Si-Multischichten genutzte Roentgenreflektometrie uebernommen. Aufgrund des Wechsels von Mo/Si auf La/B{sub 4}C musste materialbedingt die Steuerung des Verdampfungsprozesses weiterentwickelt und optimiert werden. Fuer die Herstellung aperiodischer La/B{sub 4}C-Multischichtsysteme wurde zusaetzlich ein In-situ Ellipsometer in Betrieb genommen. Des Weiteren soll eine Senkung der Grenzflaechenrauigkeiten und damit einhergehende Erhoehung der Reflektivitaeten von La/B{sub 4}C-Multischichten durch das Polieren mit beschleunigten Ionen der

[Christofer Herrmann. Kloster und Burg - die architektur des Deutschens Ordens im Pressen und Livland. In : Glaube, Macht und Pracht. GeistlicheGemeinschaften des Ostseeraums im Zeitalter der Backsteingotik] / Dennis Hortmuth

Index Scriptorium Estoniae

Hortmuth, Dennis

2011-01-01

Arvustus: Christofer Herrmann. Kloster und Burg - die Architektur des Deutschen Ordens in Preussen und Livland. In : Glaube, Macht und Pracht. GeistlicheGemeinschaften des Ostseeraums im Zeitalter der Backsteingotik (=Archäologie und Geschichte im Ostseeraum; Archaeology and History of the Baltic 6) Rahden : Verlag Marie Leidorf, 2009. S. 209-219. Saksa Ordu arhitektuurist Preisi- ja Liivimaal

Practical route to the left wing of CTX1B and total syntheses of CTX1B and 54-deoxyCTX1B.

Science.gov (United States)

Yamashita, Shuji; Takeuchi, Katsutoshi; Koyama, Takuya; Inoue, Masayuki; Hayashi, Yujiro; Hirama, Masahiro

2015-02-02

Ciguatoxins, the principal causative agents of ciguatera seafood poisoning, are extremely large polycyclic ethers. We report herein a reliable route for constructing the left wing of CTX1B, which possesses the acid/base/oxidant-sensitive bisallylic ether moiety, by a 6-exo radical cyclization/ring-closing metathesis strategy. This new route enabled us to achieve the second-generation total synthesis of CTX1B and the first synthesis of 54-deoxyCTX1B. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

MIP-based enhanced mid-session macro-mobility for IMS-controlled state-full applications

DEFF Research Database (Denmark)

Renier, Thibault Julien; Fathi, Hanane; Schwefel, Hans-Peter

2007-01-01

, e.g., block unauthorized visiting users. The 3GPP IP Multimedia Subsystem (IMS) is a platform standardized towards network-independent access and session control. The current IMS specifications do not allow for any change of the user's current IP address during an ongoing session, which prevents...

ODE/IM correspondence and the Argyres-Douglas theory

Science.gov (United States)

Ito, Katsushi; Shu, Hongfei

2017-08-01

We study the quantum spectral curve of the Argyres-Douglas theories in the Nekrasov-Sahashvili limit of the Omega-background. Using the ODE/IM correspondence we investigate the quantum integrable model corresponding to the quantum spectral curve. We show that the models for the A 2 N -type theories are non-unitary coset models ( A 1)1 × ( A 1) L /( A 1) L+1 at the fractional level L=2/2N+1-2 , which appear in the study of the 4d/2d correspondence of N = 2 superconformal field theories. Based on the WKB analysis, we clarify the relation between the Y-functions and the quantum periods and study the exact Bohr-Sommerfeld quantization condition for the quantum periods. We also discuss the quantum spectral curves for the D and E type theories.

Produkteinführung im Umfeld des Niedergangs: Die Blu-ray Disk

OpenAIRE

Oestreicher, Klaus; Walton, Nigel; Newnham, M.

2014-01-01

Dieses Kapitel diskutiert die Problematik existenzieller Bedrohung durch radikale Innovationen. Virtuelle Marktangebote verändern Märkte im Home Entertainment und das Konsumverhalten grund¬legend. Zunehmend gefährden dematerialisierte Produkte, welche zu Services werden und Folge der Information Communication Tech¬nologies (ICT) sind, die Lebensfähigkeit physischer Produkte. Deren Märkte sind im Niedergang und das bedroht nicht nur die Hersteller optischer Disks (CD und DVD), sondern beeinflu...

Oberflächenstrukturierung metallischer Werkstoffe, z. B. für stents

Science.gov (United States)

Stöver, Michael; Wintermantel, Erich

Eine topologische Oberflächenmodifikation von metallischen Implantaten kann aus verschiedenen Gründen sinnvoll sein. Im Allgemeinen lassen sich zwei Hauptziele unterscheiden. Zum einen dienen Oberflächen dazu, bestimmte Zellreaktionen zu forcieren. Die Anwendungsbeispiele reichen hier von sehr rauen Oberflächen in Fällen wo eine gute Integration eines Permanentimplantates in das Gewebe erwünscht ist bis hin zu glatt polierten Oberflächen. Letztere werden in erster Linie dort eingesetzt, wo das Implantat in direktem Kontakt mit Blut ist. Ein Beispiel für die Erforderlichkeit einer hohen Rauheit (Rz > 100 μm) sind meist aus Titan gefertigte Schäfte von Gelenksimplantaten [1,2]. Die Autoren machten den Vorschlag, die Aufrauung von Titan- und Edelstahl-Stents analog der Aufrauung bei Hüftprothesenschäften zu versuchen, um eine noch bessere Biokompatibilität zu erreichen. [7, 8 ,9]. Sehr glatte Oberflächen, in der Regel mit Rz Werten von unter 0,1 μm, sind z. B. bei Herzklappenprothesen und der Innenseite von Gefäßstützen gefordert. Mittlere Rauheiten werden oft bei temporären Implantaten eingesetzt, in die in reguliertem Maße Gewebe einwachsen, allerdings keine unlösbare Verbindung bilden sollen. Sehr genau eingestellt werden müssen auch die Oberflächentopographien bei Implantaten in sehr empfindlichen Gebieten wie z. B. der Gehirnregion. Hierbei muss eine gute Verankerung im Gewebe vorhanden sein, um ein Verrutschen des Implantates zu verhindern. Zum anderen darf keine überschüssige Zellproliferation entstehen, um ein Einwachsen in sensible Regionen zu verhindern. Zum anderen werden Oberflächenmikrostrukturen genutzt, um Wirkstoffe in Implantate einzubringen, die lokal über einen bestimmten Zeitraum freigesetzt werden sollen. Als wichtigste Wirkstoffe sind hier Antibiotika und entzündungshemmende Mittel sowie im kardiovaskulären Bereich Proliferationshemmer zu nennen.

A flicker noise/IM3 cancellation technique for active mixer using negative impedance

NARCIS (Netherlands)

Cheng, W.; Annema, Anne J.; Wienk, Gerhardus J.M.; Nauta, Bram

2013-01-01

Abstract—This paper presents an approach to simultaneously cancel flicker noise and IM3 in Gilbert-type mixers, utilizing negative impedances. For proof of concept, two prototype double-balanced mixers in 0.16- m CMOS are fabricated. The first demonstration mixer chip was optimized for full IM3

26 CFR 1.280B-1 - Demolition of structures.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Demolition of structures. 1.280B-1 Section 1... (CONTINUED) INCOME TAXES Items Not Deductible § 1.280B-1 Demolition of structures. (a) In general. Section 280B provides that, in the case of the demolition of any structure, no deduction otherwise allowable...

78 FR 79498 - Notice Pursuant to The National Cooperative Research and Production Act of 1993-IMS Global...

Science.gov (United States)

2013-12-30

... Production Act of 1993--IMS Global Learning Consortium, Inc. Notice is hereby given that, on November 22....C. Sec. 4301 et seq. (``the Act''), IMS Global Learning Consortium, Inc. (``IMS Global'') has filed..., Carson-Dellosa Publishing, Greensboro, NC; Data Recognition Group, Maple Grove, MN; Nelson Education Ltd...

78 FR 7456 - Notice Pursuant to the National Cooperative Research and Production Act of 1993-IMS Global...

Science.gov (United States)

2013-02-01

... District, Selbyville, DE; learning.com , Portland, OR; State of Michigan Dept. of Education, Bureau of... Production Act of 1993--IMS Global Learning Consortium, Inc. Notice is hereby given that, on December 28....C. 4301 et seq. (``the Act''), IMS Global Learning Consortium, Inc. (``IMS Global'') has filed...

SISTEMAS MULTIMEDIA BASADOS EN PROTOCOLO IP IMS APLICADOS A SERVICIOS LTE DE 4G

Directory of Open Access Journals (Sweden)

Edgar Alfonso Cipagauta Pedraza

2013-01-01

Full Text Available Este artículo presenta de una manera sencilla, el sistema creado para soportar los servicios de multimedia dentro de red de nueva generación (NGN llamada IP Multimedia Subsystem (IMS a la vez que se explica su relación con la tecnología Long Term Evolution (LTE definida por el 3GPP en su release 8. IMS se trata de una arquitectura integrada en el núcleo de red para ofrecer servicios multimediales de audio y video sobre una infraestructura. Entonces ahora, los servicios prestados pasarán a ser ofrecidos a través de IP IMS y será la piedra angular en donde estos servicios se generarán y se ofrecerán. LTE es sin duda un impulsor de IMS, pero hay otros factores que empiezan a favorecer y a plantear un modelo de negocio favorable para la arquitectura multimedia. IMS está orientado a habilitar la convergencia de servicios, combinando el crecimiento de la Internet con el de las comunicaciones móviles, desde cualquier ubicación y método de forma continua y permanente.

EXTREMISMUS IM KLASSENZIMMER - THEORETISCHE CHANCEN UND MÖGLICHKEITEN DES POLITIKUNTERRICHTES.

Directory of Open Access Journals (Sweden)

Amelie Zuschke

2015-06-01

Full Text Available Durch Phänomene wie PEGIDA wird eine Unsicherheit in der Bevölkerung ausgedrückt, die auch vor den Schultüren nicht Halt macht. Ein Querschnitt der Gesellschaft sitzt im Klassenraum und auf diesen muss sich eingestellt werden. Ob Kinder zuhause oder in ihrer Freizeit mit Populismus konfrontiert werden, die Schule hat als immer größerer Teil im Leben von Schülern in Deutschland (im Zuge der nach und nach fortschreitenden Einführung eines Ganztages-Prinzips auch eine Verantwortung mit diesen Eindrücken und Einflüssen bedacht umzugehen. Deutschland sollte aus der eigenen Geschichte heraus zudem die aufmerksame und sensible Handhabung mit extremem Gedankengut im Allgemeinen und mit rechtsextremistischem Gedankengut im Besonderen haben. Die Tendenz zu den politischen Extremen in wirtschaftlich und sozial herausfordernden Zeiten ist ein mit jedem wirtschaftlichen Abschwung auftretendes Phänomen, aber stark nationalistisches Gedankengut ist mit der heutigen Idealvorstellung von einem offenen Europa nicht vereinbar. In der Bundesrepublik Deutschland fußt die politische Bildung, geschichtlich begründet, auf demokratievermittelnden Prinzipien. Diese eignen sich vielseitig für die Auseinandersetzung mit Extremismus und den hierzu unumstrittenen Grundlagen und Werte der pluralistischen Gesellschaft in einer Demokratie. Das Kontroversitätsgebot des Beutelsbacher Konsenses aus dem Jahr 1977 (vgl Breit/Massig, 1993 bietet einen Ansatz zur Behandlung von Extremismus in der politischen Bildung auf der Grundlage der gegenseitigen Akzeptanz. Hier wird das Kontroversitätsgebot aufgeschlüsselt und anschließend auf Extremismus in der Schule bezogen. Die Fragestellung, wie der Politikunterricht trotz des Kontroversitätsgebotes mit Extremismus umgehen sollte, ist auf den Umgang mit dem gegenwärtigen Rechtsextremismus ausgelegt, welcher einen großen Teil politisch motivierter Straftaten begründet, sich in radikalisierter Form am stärksten gegen

Farklı Karbondioksit Dozlarının Hidroponik Buğday (Triticum aestivum L. Çim Suyunun Verim ve Besin Değerleri Üzerine Etkileri

Directory of Open Access Journals (Sweden)

Muhammet KARAŞAHİN

2015-11-01

Full Text Available dozda karbondioksit uygulamalarının çim suyu verim ve besin değerleri üzerine etkilerini belirlemek amacıyla 01.03.2015 ile 01.08.2015 tarihleri arasında Karabük Üniversitesi Eskipazar Meslek Yüksekokulu Bitkisel ve Hayvansal Üretim Bölümü iklimlendirme odasında yürütülmüştür. Çalışmada; üç farklı karbondioksit dozu (Kontrol; 0, D1; 750, D2; 1500 ve D3; 2000 ppm yetiştirme ortamına uygulanarak, bitki verimi tohum oranı, bitki ve çim verimi, çim suyu verimi ve pH, bitki boyu ve kök uzunluğu, bitki ve çim kuru madde oranları, çim suyu enerji ve makro besin değerleri (rutubet, karbonhidrat, protein, yağ, diyet lif ve kül ile mineral madde (N, P, K, Ca, Mg, Fe, Cu, Mn, Zn ve Na içerikleri üzerine etkileri araştırılmıştır. Araştırma sonuçlarına göre en yüksek bitki, çim ve çim suyu verimleri ile bitki boyu değerleri D1 uygulamasından elde edilmiştir. En yüksek kök uzunluğu değerleri D1 ve D3 uygulamalarından elde edilirken, en yüksek bitki kuru madde oranı değerleri kontrol, D2 ve D3 uygulamalarından elde edilmiştir. En yüksek yağ, Ca ve Fe içerikleri ise D3 uygulamasından elde edilmiştir. En yüksek Mn içerikleri kontrol ve D3 uygulamalarından elde edilirken, en yüksek Mg içerikleri D1, D2 ve D3 uygulamalarından elde edilmiştir. En yüksek Na içerikleri ise kontrol ve D1 uygulamalarından elde edilmiştir. Sadece en yüksek çim ve çim suyu verim değerleri elde etmek için D1 uygulaması tavsiye edilebilir niteliktedir.

IMS Learning Design desde dentro. Una especificación para crear escenarios de aprendizaje online (parte I)

NARCIS (Netherlands)

Burgos, Daniel; Berbegal, Nidia; Griffiths, David; Tattersall, Colin; Koper, Rob

2005-01-01

IMS Learning Design, IMS LD de ahora en adelante (IMS, 2003), es una especificación centrada en formación online o e-learning y que permite modelar programaciones curriculares o lecciones presenciales de forma que puedan ser seguidas online, construyendo lo que se denomina Unidades de Aprendizaje

Competency-orientated brand cooperations of power supply companies in the B2B sector; Kompetenzorientierte Markenkooperationen von Energieversorgungsunternehmen im B2B-Kundenbereich

Energy Technology Data Exchange (ETDEWEB)

Peuser, M.M.

2008-07-01

On the basis of an extensive empirical study with B2B electricity users, the author of the book under consideration examines brand co-operations of power supply companies with companies not working in the area of energy production. Based on the view of various co-operation alternatives, impact relations and success-determining factors of influence in the area of B2B customers are identified. The term of the authority of an energy brand is discussed. Beside this, profiles of concrete brands of current power supply companies from the view of B2B customers are pointed out, and recommendations for the organization of brand co-operation and the structure of mark authority in practice are shown. This contribution is written for lecturers and students of the management economics with the emphasis of marketing and management as well as high-level personnel in the energy industry, who wants to develop strong mark authority by brand co-operation.

Aplicativo Web para la Fusión de Imágenes Satelitales

Directory of Open Access Journals (Sweden)

Javier Medina

2013-06-01

Full Text Available En este artículo se implementa un servicio en la Web que ofrece la posibilidad de realizar la fusión de imágenes de satélite. A lo largo del artículo tres temáticas importantes son abordadas. La primera temática corresponde al servicio Web, éste servicio es implementado usando software libre, donde el usuario puede realizar una solicitud del servicio de fusión. La segunda temática se ocupa del análisis de la transformada rápida de Wavelet haar (TRWH. La última temática detalla la metodología, para realizar la fusión de imágenes usando la TRWH. Con el fin de determinar la eficiencia de la TRWH, cinco Wavelets diferentes fueron implementadas para fusionar el mismo par de imágenes satelitales. Las imágenes resultantes fueron evaluadas tanto en la calidad espacial como espectral a través de cuatro índices. Los mejores resultados de la evaluación fueron obtenidos con la TRWH la cual preserva la riqueza espectral y mejora su calidad espacial

Original models of NGN/IMS-networks surrounded by circuit-switched systems

OpenAIRE

Kulikov, Nikolay

2014-01-01

On obtaining of the Alexander Graham Bell a patent for invention of the telephone in 1987, the communication system consistently has gone through several evolutionary stages: from analog lines and manual switches to video telephony and IMS architecture. Each of the stages can be described by specific switching systems, data transmission systems and types of transmitted information. After implementation of such solution, it is possible to create a number of access nodes in the Operators IMS-ne...

Bilişim Teknolojileri Öğretmen Adaylarının E-Kitap ve Etkileşimli E-Kitap Kavramına İlişkin Metaforik Algıları

Directory of Open Access Journals (Sweden)

Seda Özer

2015-04-01

Full Text Available Öz Bu araştırmanın amacı bilişim teknolojileri öğretmen adaylarının e-kitap ve etkileşimli kitaba ilişkin algılarını metafor analizi yoluyla incelemektir. Araştırmanın çalışma grubunu, 2013-2014 öğretim yılı Bahar döneminde Fırat Üniversitesi, Eğitim Fakültesi, Bilgisayar ve Öğretim Teknolojileri Eğitimi lisans programına devam eden (1., 2. ,3. ve 4. sınıf öğretmen adayı oluşturmaktadır. Katılımcılardan “E-kitap …… gibidir. Çünkü…..” ve “Etkileşimli e-kitap …… gibidir. Çünkü…..”  ifadelerini metafor kullanarak doldurmaları istenmiştir. Bilişim teknolojileri öğretmen adaylarından elde edilen bu veriler içerik analizi yöntemi kullanılarak incelenmiştir. Elde edilen veriler doğrultusunda bilişim teknolojileri öğretmen adaylarının e-kitaba yönelik geçerli 153, etkileşimli kitaba yönelik geçerli 151 metafor geliştirdikleri görülmüştür. Araştırmanın bulguları ışığında öğretmen adayları e-kitaba ilişkin olumlu ve olumsuz metaforlar üretirlerken, etkileşimli kitaba yönelik sadece olumlu metaforlar ürettikleri ve etkileşimli e-kitap kullanımını daha cazip gördükleri söylenebilir. Salt metin formatı dışında sunulan etkileşimli kitapların öğrenme sürecinde kullanımının önemi yine bu araştırma sonuçlarıyla desteklenmiştir. Araştırma sonucunda bilişim teknolojileri öğretmen adaylarının e-kitaba ilişkin geliştirdikleri metaforlar arasında ilk sırayı “kolay taşınabilir” metaforu almaktadır. Bu özellik e-kitabın avantajları arasında sayılmaktadır. Öğrencilerin etkileşimli kitaba yönelik geliştirilen metaforları arasında ise ilk sırayı “birden çok duyuya hitap eder” metaforu almıştır. Çoklu ortam materyalleri ile öğrenme ortamının desteklenmesinin öğrenciler için önemi, bu çalışmada vurgulanmıştır. Anahtar Sözcükler: E-kitap, etkileşimli kitap, metafor

Measurement of the mass splittings between the b bar bχb,J(1P) states

International Nuclear Information System (INIS)

Edwards, K.W.; Edwards, K.W.; Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M.; Sadoff, A.J.; Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L.; Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A.; Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F.; Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M.; Richichi, S.J.; Severini, H.; Skubic, P.; Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M.; Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H.; Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X.; Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J.; Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.

1999-01-01

We present new measurements of photon energies and branching fractions for the radiative transitions Υ(2S)→γχ b(J=0,1,2) (1P). The masses of the χ b states are determined from the measured radiative photon energies. The ratio of mass splittings between the χ b substates, r≡(M J=2 -M J=1 )/(M J=1 -M J=0 ), with M the χ b mass, provides information on the nature of the b bar b confining potential. We find r(1P)=0.542±0.022±0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P) b (1P) states than for the χ b (2P) states. copyright 1999 The American Physical Society

An IMS Station life cycle from a sustainment point of view

Science.gov (United States)

Brely, Natalie; Gautier, Jean-Pierre; Foster, Daniel

2014-05-01

The International Monitoring System (IMS) is to consist of 321 monitoring facilities, composed of four different technologies with a variety of designs and equipment types, deployed in a range of environments around the globe. The International Monitoring System is conceived to operate in perpetuity through maintenance, replacement and recapitalization of IMS facilities' infrastructure and equipment when the end of service life is reached [CTBT/PTS/INF.1163]. Life Cycle techniques and modellization are being used by the PTS to plan and forecast life cycle sustainment requirements of IMS facilities. Through historical data analysis, Engineering inputs and Feedback from experienced Station Operators, the PTS currently works towards increasing the level of confidence on these forecasts and sustainment requirements planning. Continued validation, feedback and improvement of source data from scientific community and experienced users is sought and essential in order to ensure limited effect on data availability and optimal costs (human and financial).

International Monitoring system (IMS) build-up in Africa: Current status and the way forward

International Nuclear Information System (INIS)

Basham, P.

2002-01-01

The complete IMS verification system for primary and auxiliary seismic together with that of radionuclide, hydroacoustic and infrasound is plotted on a global map and Africa in particular showing its status. IMS situation in East and Southern Africa is included

Entwurf eines Soll-Prozessmodells für die Verwaltung von Herbarbelegen im Botanischen Garten/Botanischen Museum in Berlin-Dahlem

OpenAIRE

Krause, Manfred

2009-01-01

Das Forschungspapier entwirft ein Soll-Prozessmuster für die Verwaltung von Herbarbelegen im Botanischen Garten/ Botanischen Museum in Berlin-Dahlem im Rahmen des Forschungsvorhabens "Herbar Digital". Ausgangspunkt für die Erstellung des Soll- Modells sind die bereits dokumentierten Geschäftsprozesse. Die bestehenden Prozesse werden an die Ausbaustufe 1 von Herbar Digital angepasst, um die Kosten für die Digitalisierung eines Herbarbeleges zu senken. Als Grundlage für die Optimierung der Gesc...

Einige Überlegungen zur Bestimmung des Äquivalenzgrades am Beispiel des lexikalischen Feldes „Erhebung im Gelände“

Directory of Open Access Journals (Sweden)

Daumantas Katinas

2013-12-01

Full Text Available Eine der wichtigsten Fragen in der kontrastiven Lexikologie, zweisprachigen Lexikografie und der Übersetzungswissenschaft ist die Bestimmung des Äquivalenzgrades zwischen den Lexemen der Vergleichssprachen. Die meisten Lexikologen, die sich mit kontrastiven Untersuchungen beschäftigen, sprechen von der Voll-, Teil- und Nulläquivalenz. In der Praxis existiert allerdings nur die so genannte Teiläquivalenz. Wenn man aber in der wissenschaftlichen Diskussion nur diesen Begriff verwenden würde, entstünden somit noch größere Schwierigkeiten bei der Bestimmung des Äquivalenzgrades, weil sich das Spektrum der Teiläquivalenz von 1 bis 99 Prozent erstrecken würde. Daher wird im vorliegenden Beitrag eine Formel zur Berechnung des Äquivalenzgrades zwischen zwei Vergleichslexemen vorgeschlagen. In erster Linie wird die semantische Analyse des lexikalischen Feldes „Erhebung im Gelände“ im Litauischen und im Deutschen, das die Grundlage der Formel bildet, kurz präsentiert. Dazu wird der von Helmut Henne und Herbert Ernst Wiegand (Henne 1972, Wiegand 1970, Kühn 1979 vorgeschlagene Entwurf, die lexikalische Bedeutung mit Hilfe von onomasiologischen, komplementär-semasiologischen und autonom-semasiologischen Operationsschritten zu beschreiben, herangezogen. Dieser Entwurf wird durch kontrastive, prototypensemantische und korpusgestützte Aspekte ergänzt. Im zweiten Teil wird die mathematische Formel zur Berechnung des Äquivalenzgrades zwischen zwei Vergleichslexemen angegeben und durch das Beispiel des Lexempaars kalva–Hügel veranschaulicht.

Implementing Adaptive Educational Methods with IMS Learning Design

NARCIS (Netherlands)

Specht, Marcus; Burgos, Daniel

2006-01-01

Please, cite this publication as: Specht, M. & Burgos, D. (2006). Implementing Adaptive Educational Methods with IMS Learning Design. Proceedings of Adaptive Hypermedia. June, Dublin, Ireland. Retrieved June 30th, 2006, from http://dspace.learningnetworks.org

Multimedia als Entwicklungsfaktor im ländlichen Raum? : Fallbeispiel Wirtschaftsregion Friedrichshafen/Bodensee

OpenAIRE

Haupenthal, Edmund; Leuninger, Stefan; Beermann, Petra; Kutter, Martina

1998-01-01

Im Rahmen der vorliegenden empirischen Studie in der Wirtschaftsregion Friedrichshafen wurden die Wechselwirkungen zwischen regionalen Strukturfaktoren und „Multimedia-Entwicklungen“ im ländlichen Raum untersucht. Die positive Multimedia-Entwicklung geht auf folgende regionale Erfolgsfaktoren zurück: die politische Akzeptanz der neuen Technologie, die Vorhaltung der Multimedia-Akademie, die regionale Nachfrage, die Verfügbarkeit ausreichenden Know-hows und Humankapitals sowie das Vorhandensei...

Emotionsregulationsstrategien und aggressives Verhalten im Kindergartenalter

OpenAIRE

Helmsen, Johanna; Petermann, Franz

2010-01-01

In der vorliegenden Studie (N = 193) wurde untersucht, ob sich körperlich und relational aggressive Kinder im Kindergartenalter (mittleres Alter: 55 Monate) in ihren Emotionsregulationsstrategien von ihren unauffälligen Altersgenossen unterscheiden. Zur Erhebung der Emotionsregulation wurde eine strukturierte, videografierte Verhaltensbeobachtung durchgeführt, in der gezielt Frustration ausgelöst wurde. Anschließend wurden Regulationsstrategien in sieben verschiedenen Kategorien ausgewertet. ...

MIDDIS: ARQUITECTURA DE REFERENCIA PARA LA INTERACCIÓN DE SERVICIOS BASADOS EN SOA E IMS

Directory of Open Access Journals (Sweden)

Ximena Velasco Melo

2010-01-01

Full Text Available En telecomunicaciones la tendencia actual está dirigida hacia una búsqueda de la convergencia de redes fijas y móviles, y por lo tanto, las redes que se diseñan son más complejas. Así mismo, se presentan nuevos retos en el campo de la interconexión e integración de servicios a través de múltiples redes, tecnologías y áreas de negocio, lo cual hace imprescindible interoperar los servicios de las Tecnologías de Información (Information Technologies, IT , con los de telecomunicaciones. Para aportar en la solución de estos retos y debido además, a la ausencia de un entorno de telecomunicaciones convergente y completamente adecuado para la prestación de servicios tradicionales y nuevos, en este artículo se presenta una arquitectura de referencia que permite la habilitación y entrega rápida de servicios convergentes para el mundo IT y el mundo de las Telecomunicaciones, con la mediación en la interacción de servicios basados en la Arquitectura Orientada a Servicios (Service Oriented Architecture, SOA, y el Subsistema Multimedia IP (IP Multimedia Subsystem, IMS . La característica esencial del middleware, implementado en un Entorno de Ejecución de Lógica de Servicio (Service Logic Execution Environment, SLEE, consiste en que IMS utiliza a SOA para integrar sus propios elementos software con componentes externos y de esta manera, se logra la combinación de las facilidades de la Web y de IMS para exponer un conjunto de servicios enriquecidos para ambos mundos.

STUDI KUALITATIF MENGENAI PERSEPSI DAN PERILAKU SEKSUAL WANITA PEKERJA SEKS KOMERSIAL (PSK DALAM UPAYA PENCEGAHAN IMS DI KOTA SEMARANG TAHUN 2012

Directory of Open Access Journals (Sweden)

Ratu Matahari

2015-04-01

Full Text Available Pendahuluan: Peningkatan jumlah kasus IMS di Kota Semarangdengan jumlah kasus IMS pada tahun 2009 tercatat mencapai 2.471 kasusdan jumlah kasus IMS pada tahun 2011 adalah 2473 kasus. Tujuan: Mendeskripsikan persepsi dan perilaku seksual wanita Pekerja Seks Komersial (PSK di Lokalisasi Sunan Kuning terhadap upaya pencegahan Infeksi Menular Seksual (IMS di Kota Semarang. Metode: Penelitian ini dilakukan dengan menggunakan teknik wawancara mendalam (indepth interview pada enam PSK yang mengalami IMS dan mewawancarai dua kelompok diskusi (FGD, seorang mucikari, dan seorang petugas lapangan (PL sebagai triangulasi. Analisis data menggunakan analisis isi (content analysis. Hasil: Pola Pengetahuan PSK dan persepsi PSK terhadap IMS juga sudah baik, tetapi perilaku PSK dalam upaya mencegah penularan IMS masih belum bisa dikatakan baik karena penggunaan kondom diantara pekerja seks komersial pada saat melakukan hubungan seksual dengan pelanggannya masih rendah. Tidak adanya dukungan dari mucikari dalam meningkatkan perilaku pencegahan IMS. Hal ini menunjukkan bahwa kepedulian terhadap kesehatan diri sendiri masih rendah. Kesimpulan: Perilaku pencegahan PSK terhadap penularan IMS belum baik. Perlu diadakan pelatihan dengan metode role playing kepada para PSK dan mucikari untuk meningkatkan kepedulian mereka terhadap kesehatan sehingga diharapkan akan terjadi perubahan perilaku baru dalam upaya pencegahan penularan IMS terhadap diri mereka sendiri atau pelanggan.  Kata kunci: Persepsi, pekerja seks komersial, IMS, Kota Semarang

Suchverhalten im Web: Empirische Ergebnisse

OpenAIRE

Schmidt-Mänz, Nadine

2005-01-01

Nadine Schmidt-Mänz vom Institut für Entscheidungstheorie u. Unternehmensforschung, Universität Karlsruhe, berichtete über „Suchverhalten im Web: Empirische Ergebnisse“. Rund 6000 Benutzer von Suchmaschinen füllten den von ihr hergestellten Online-Fragebogen aus. Einige ihrer Erkenntnisse: Als Suchmaschine wurde mit 91,3 % Google benutzt. Die Monopolstellung von Google war den Suchenden nicht bewußt. Einer der Schlüsse der Referentin: Es mangelt nicht an Suchmaschinen, sondern an der „Weitere...

Contaminant screening of wastewater with HPLC-IM-qTOF-MS and LC+LC-IM-qTOF-MS using a CCS database.

Science.gov (United States)

Stephan, Susanne; Hippler, Joerg; Köhler, Timo; Deeb, Ahmad A; Schmidt, Torsten C; Schmitz, Oliver J

2016-09-01

Non-target analysis has become an important tool in the field of water analysis since a broad variety of pollutants from different sources are released to the water cycle. For identification of compounds in such complex samples, liquid chromatography coupled to high resolution mass spectrometry are often used. The introduction of ion mobility spectrometry provides an additional separation dimension and allows determining collision cross sections (CCS) of the analytes as a further physicochemical constant supporting the identification. A CCS database with more than 500 standard substances including drug-like compounds and pesticides was used for CCS data base search in this work. A non-target analysis of a wastewater sample was initially performed with high performance liquid chromatography (HPLC) coupled to an ion mobility-quadrupole-time of flight mass spectrometer (IM-qTOF-MS). A database search including exact mass (±5 ppm) and CCS (±1 %) delivered 22 different compounds. Furthermore, the same sample was analyzed with a two-dimensional LC method, called LC+LC, developed in our group for the coupling to IM-qTOF-MS. This four dimensional separation platform revealed 53 different compounds, identified over exact mass and CCS, in the examined wastewater sample. It is demonstrated that the CCS database can also help to distinguish between isobaric structures exemplified for cyclophosphamide and ifosfamide. Graphical Abstract Scheme of sample analysis and database screening.

Induction of Encephalitis in Rhesus Monkeys Infused with Lymphocryptovirus-Infected B-Cells Presenting MOG34–56 Peptide

Science.gov (United States)

Haanstra, Krista G.; Wubben, Jacqueline A. M.; Jonker, Margreet; Hart, Bert A. ‘t.

2013-01-01

The overlapping epidemiology of multiple sclerosis (MS) and Epstein-Barr virus (EBV), the increased risk to develop MS after infectious mononucleosis (IM) and the localization of EBV-infected B-cells within the MS brain suggest a causal link between EBV and MS. However, the underlying mechanism is unknown. We hypothesize that EBV-infected B-cells are capable of eliciting a central nervous system (CNS) targeting autoimmune reaction. To test this hypothesis we have developed a novel experimental model in rhesus monkeys of IM-like disease induced by infusing autologous B-lymphoblastoid cells (B-LCL). Herpesvirus papio (HVP) is a lymphocryptovirus related to EBV and was used to generate rhesus monkey B-LCL. Three groups of five animals were included; each group received three intravenous infusions of B-LCL that were either pulsed with the encephalitogenic self peptide MOG34–56 (group A), a mimicry peptide (981–1003) of the major capsid protein of cytomegalovirus (CMVmcp981–1003; group B) or the citrullinated MOG34–56 (cMOG34–56; group C). Groups A and B received on day 98 a single immunization with MOG34–56 in incomplete Freund’s adjuvant (IFA). Group C monkeys were euthanized just prior to day 98 without booster immunization. We observed self-peptide-specific proliferation of T-cells, superimposed on similar strong proliferation of CD3+CD8+ T-cells against the B-LCL as observed in IM. The brains of several monkeys contained perivascular inflammatory lesions of variable size, comprising CD3+ and CD68+ cells. Moreover, clusters of CD3+ and CD20+ cells were detected in the meninges. The only evident clinical sign was substantial loss of bodyweight (>15%), a symptom observed both in early autoimmune encephalitis and IM. In conclusion, this model suggests that EBV-induced B-LCL can elicit a CNS targeting inflammatory (auto)immune reaction. PMID:23977076

Wind tunel tests of Risoe-B1-18 and Risoe-B1-24

Energy Technology Data Exchange (ETDEWEB)

Fuglsang, P.; Bak, C.; Gaunaa, M.; Antoniou, I.

2003-01-01

This report contains 2D measurements of the Risoe-B1-18 and Risoe-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel, which has a background turbulence intensity of 1%, and an inlet flow velocity of 42 m/s. The airfoil sections had a chord of 0.600 m giving a Reynolds number of 1.6Oe106. The span was 1.9 m and end plates were used to minimize 3D flow effects. The measurements comprised both static and dynamic inflow. Static inflow covered angles of attack from 5o to 30 deg. Dynamic inflow was obtained by pitching the airfoil in a harmonic motion around various mean angles of attack. The test matrix involved smooth flow, various kinds of leading edge roughness, stall strips, vortex generators and Gurney flaps in different combinations. The quality of the measurements was good and the agreement between measurements and numerical CFD predictions with EllipSys2D was good. For both airfoils predictions with turbulent flow captured very well the shapes of lift and drag curves as well as the magnitude of maximum lift. Measurements of Risoe-B1-18 showed that the maximum lift coefficient was 1.64 at an angle of attack of approximately 13 deg. The airfoil was not very sensitive to leading edge roughness despite its high maximum lift. Measurements with stall strips showed that stall strips could control the level of maximum lift. The Risoe-B1-24 measurements showed that the maximum lift coefficient was 1.62 at an angle of attack of approximately 14 deg. The airfoil was only little sensitive to leading edge roughness despite its high relative thickness and high maximum lift. Measurements with delta wing shaped vortex generators increased the maximum lift coefficient to 2.02 and measurements with Gurney flaps increased the maximum lift coefficient to 1.85. Measurements with combination of vortex generators and Gurney flaps showed a maximum

7 CFR 15b.1 - Purpose.

Science.gov (United States)

2010-01-01

... FEDERAL FINANCIAL ASSISTANCE General Provisions § 15b.1 Purpose. The purpose of this part is to implement... 7 Agriculture 1 2010-01-01 2010-01-01 false Purpose. 15b.1 Section 15b.1 Agriculture Office of the... receiving Federal financial assistance. ...

Analysis of more than 70 volatile organic compounds in personal breathing air; Untersuchung der personenbezogenen Luft im Atembereich auf ueber 70 fluechtige organische Verbindungen. Vergleich von Tankstellen-Anwohnern mit Kontrollpersonen

Energy Technology Data Exchange (ETDEWEB)

Heudorf, U. [Gesundheitsamt Frankfurt am Main (Germany). Abt. Umweltmedizin und Hygiene; Ullrich, D.; Ung, L. [Umweltbundesamt, Berlin (Germany). Inst. fuer Wasser-, Boden- und Lufthygiene

1998-10-01

,8 {mu}g/m{sup 3} und 34 {mu}g/m{sup 3}. Alle uebrigen Aromaten wiesen eine mittlere Belastung von unter 3 {mu}g/m{sup 3} auf. Saemtliche halogenierten Kohlenwasserstoffe lagen im Mittel unter 1 {mu}g/m{sup 3}. Die mittlere Belastung der personenbezogenen Luft im Atembereich von Tankstellenanwohnern unterschied sich nicht von der Belastung einer kleinen Gruppe von Kontrollpersonen. Die Belastung war insgesamt gering, einzelne Maximalwerte konnten durch spezifische berufliche oder private Belastungen (z.B. Renovieren der Wohnung waehrend des Untersuchungszeitraums, Rauchen) erklaert werden. Im Vergleich mit den Ergebnissen des Umweltsurveys 1990/91 wurden bei allen Einzelsubstanzen deutlich niedrigere Mittelwerte bestimmt; jahreszeitliche Unterschiede waehrend der Probenahmephase sind hier die wahrscheinlich bedeutendste Ursache. (orig.)

miR-200b mediates post-transcriptional repression of ZFHX1B

DEFF Research Database (Denmark)

Christoffersen, Nanna Rønbjerg; Silahtaroglu, Asli; Ørom, Ulf Lupo Andersson

2007-01-01

of E-cadherin. We show that Zfhx1b and miR-200b are regionally coexpressed in the adult mouse brain and that miR-200b represses the expression of Zfhx1b via multiple sequence elements present in the 3'-untranslated region. Overexpression of miR-200b leads to repression of endogenous ZFHX1B...

Artroscopia del hombro: Técnica e imágenes

OpenAIRE

ARANGO GARCIA, GASTON; ALVAREZ CAMBRAS, RODRIGO; LOPEZ CABRERA, JOSE RAMON; MIRANDEZ OLARAN, HUGO; LARA VALDIVIA, JESUS

1995-01-01

En este trabajo se muestra cómo realizar la técnica de la artroscopia de la articulación del hombro. Se presentan vistas de las imágenes artroscópicas y de la anatomía normal de la articulación para ayudar a la interpretación e identificación de las imágenes patológicas más comúnmente encontradas. Se realizó la técnica en 8 pacientes, deportistas con hombros dolorosos, en los cuales el diagnóstico clínico no era certero. Este trabajo se realizó en 1990 para introducir la técnica artroscópica ...

Systeme im Einsatz. Lernmanagement, Kompetenzmanagement und PLE

NARCIS (Netherlands)

Kalz, Marco; Schön, Sandra; Lindner, Martin; Roth, Detlev; Baumgartner, Peter

2011-01-01

Kalz, M., Schön, S., Lindner, M., Roth, D., & Baumgartner, P. (2011). Systeme im Einsatz. Lernmanagement, Kompetenzmanagement und PLE. In M. Ebner, & S. Schön (Eds.), L3T - Lerhbuch für Lernen und Lehren mit Technologie (pp. 111-118). Graz, Austria: Uni Graz. Available at

Design and performance investigation of LDPC-coded upstream transmission systems in IM/DD OFDM-PONs

Science.gov (United States)

Gong, Xiaoxue; Guo, Lei; Wu, Jingjing; Ning, Zhaolong

2016-12-01

In Intensity-Modulation Direct-Detection (IM/DD) Orthogonal Frequency Division Multiplexing Passive Optical Networks (OFDM-PONs), aside from Subcarrier-to-Subcarrier Intermixing Interferences (SSII) induced by square-law detection, the same laser frequency for data sending from Optical Network Units (ONUs) results in ONU-to-ONU Beating Interferences (OOBI) at the receiver. To mitigate those interferences, we design a Low-Density Parity Check (LDPC)-coded and spectrum-efficient upstream transmission system. A theoretical channel model is also derived, in order to analyze the detrimental factors influencing system performances. Simulation results demonstrate that the receiver sensitivity is improved 3.4 dB and 2.5 dB under QPSK and 8QAM, respectively, after 100 km Standard Single-Mode Fiber (SSMF) transmission. Furthermore, the spectrum efficiency can be improved by about 50%.

Isolation and Characterization of Plantaricin Produced by Lactobacillus plantarum Strains (IIA-1A5, IIA-1B1, IIA-2B2

Directory of Open Access Journals (Sweden)

I. I. Arief

2013-08-01

Full Text Available Bacteriocins produced by Indonesian lactic acid bacteria Lactobacillus plantarum IIA-1A5, IIA-1B1, IIA-2B2 were purified and characterized. Plantaricin W gene had been successfully amplified from all strains. This amplicon showed the expected 200 bp size of plantaricin W gene. This bacteriocins purified from L. plantarum IIA-1A5, IIA-1B1, and IIA-2B2 were named plantaricin IIA-1A5, IIA-1B1, and IIA-2B2. Purification by cation exchange chromatography increased the purity (fold and activity of plantaricins. Purity of plantaricin IIA-1A5 was increased by 3.13 fold with specific activity 13.40 AU/mg. Plantaricin IIA-1B1 had 2.98 fold purity with specific activity 5.12 AU/mg, while purity of plantaricin IIA-2B2 was 1.37 fold with specific activity 7.70 AU/mg. All plantaricins could inhibit the growth of pathogenic bacteria, such as Escherichia coli, Salmonella typhimurium, Bacillus cereus, and Staphylococcus aureus. Plantaricins could be digested by trypsin. Stability of plantaricins at 80 oC for 30 min and at 121 oC for 15 min were affected by type of plantaricin and species of pathogenic bacteria. Generally, plantaricin IIA-1A5 was better as antimicrobial agent than plantaricin IIA-1B1 and plantaricin IIA-2B2.

Efficacy of buprenorphine added to 2% lignocaine plus adrenaline 1:80,000 in providing postoperative analgesia after lower third molar surgery.

Science.gov (United States)

Chhabra, N; Sharma, P; Chhabra, S; Gupta, N

2016-12-01

A number of trials have examined the peripheral analgesic effect of opioids, known to have an anti-nociceptive effect at the central and/or spinal cord level. This study aimed to evaluate the efficacy of buprenorphine added to 2% lignocaine with adrenaline 1:80,000 in providing postoperative analgesia after lower third molar surgery. Sixty patients were randomized to three groups: group A received lignocaine 2% with adrenaline 1:80,000 for inferior alveolar nerve block (IANB), along with intramuscular (IM) injection of 1ml saline; group B received buprenorphine mixed with lignocaine 2% with adrenaline 1:80,000 for IANB (0.01mg buprenorphine/ml lignocaine with adrenaline), along with 1ml saline IM; group C received lignocaine 2% with adrenaline 1:80,000 for IANB, along with 0.03mg buprenorphine IM. Mean postoperative pain scores (visual analogue scale; when the patient first felt pain) were 6.0 for group A, 1.0 for group B, and 4.4 for group C. The mean duration of postoperative analgesia was 3.5h in groups A and C and 12h in group B. The mean number of postoperative analgesics consumed was 5.8 in groups A and C and 3.9 in group B. The addition of buprenorphine (0.03mg) to 2% lignocaine with adrenaline 1:80,000 significantly reduced the severity of postoperative pain and prolonged the duration of analgesia, thereby decreasing the need for postoperative analgesics. Copyright © 2016 International Association of Oral and Maxillofacial Surgeons. Published by Elsevier Ltd. All rights reserved.

How IMS Enables Converged Services for Cable and 3G Technologies: A Survey

Directory of Open Access Journals (Sweden)

Noël Crespi

2008-04-01

Full Text Available The IP multimedia subsystem (IMS is a service control overlay standardized by the 3GPP. The IMS is based on session initiation protocol (SIP to establish, modify, and terminate the sessions. It provides a clean separation between services, signaling, and media with the potential to enable control and management of services over multiple transport technologies. In the scope of fixed-mobile convergence, this paper is dedicated to presenting a review of how cable networks can be integrated into IMS technology to achieve 3G-cable horizontal convergence. Cable networks, as one of the major fixed broadband access technologies with PacketCable architecture, are able to provide broadband internet access and VoIP in addition to cable TV. In this article, we review the evolution in PacketCable architecture to take up IMS. In this way, we consider the standardization and research activities to address this integration. We review some important challenges such as SIP protocol compatibility, defining unique user profile, required enhancement in authentication process, QoS and charging system.

How IMS Enables Converged Services for Cable and 3G Technologies: A Survey

Directory of Open Access Journals (Sweden)

Mani Mehdi

2008-01-01

Full Text Available The IP multimedia subsystem (IMS is a service control overlay standardized by the 3GPP. The IMS is based on session initiation protocol (SIP to establish, modify, and terminate the sessions. It provides a clean separation between services, signaling, and media with the potential to enable control and management of services over multiple transport technologies. In the scope of fixed-mobile convergence, this paper is dedicated to presenting a review of how cable networks can be integrated into IMS technology to achieve 3G-cable horizontal convergence. Cable networks, as one of the major fixed broadband access technologies with PacketCable architecture, are able to provide broadband internet access and VoIP in addition to cable TV. In this article, we review the evolution in PacketCable architecture to take up IMS. In this way, we consider the standardization and research activities to address this integration. We review some important challenges such as SIP protocol compatibility, defining unique user profile, required enhancement in authentication process, QoS and charging system.

Effects of prolonged oral administration of fumonisin B1 and aflatoxin B1 in rats.

Science.gov (United States)

Pozzi, C R; Corrêa, B; Xavier, J G; Direito, G M; Orsi, R B; Matarazzo, S V

2001-01-01

The effects of prolonged oral administration (21 days) of fumonisin B1 (FB1) and aflatoxin B1 (AFB1) were evaluated on male Wistar rats. The animals were housed in individual metabolic cages and submitted to the following treatments: 1-0 microg AFB1 + 0 mg FB1/100g bw.; 2-72 microg AFB1+ 0 mg FB1/100 g bw; 3-0 microg AFB1 + 0.5 mg FB1 g bw; 4-0 microg AFB1 + 1.5 mg FB1/100 g bw; 5-72 microg AFB1 + 0.5 mg FB1/100g bw; 6-72 microgAFB1 + 1.5 mg FB1/100g bw. On day 21, the rats were sacrificed for evaluation. The results showed that treated animals presented differences in body weight and absolute/relative weights of liver and kidney as well as altered hepatic function and cholesterol blood levels. Rats fed with the greatest doses of AFB1 and FB1 gained less weight (2.79 g/day) at the end of the experimental period; their blood concentrations of liver enzymes aspartate aminotransferase (AST) and alkaline phosphatase (AP) were above control levels (130.35 micro/l and 471.00 micro/l, respectively). Blood cholesterol increased in the groups treated with the highest dose of FB1 or FB1 associated with AFB1. Histopathology revealed the occurrence of apoptosis in the liver of rats exposed to FB1. The association of aflatoxin B1 with fumonisin B1 at higher dose probably potentiated the effects of the higher dose of fumonisin B1 acting singly.

An IMS-Based Middleware Solution for Energy-Efficient and Cost-Effective Mobile Multimedia Services

Science.gov (United States)

Bellavista, Paolo; Corradi, Antonio; Foschini, Luca

Mobile multimedia services have recently become of extreme industrial relevance due to the advances in both wireless client devices and multimedia communications. That has motivated important standardization efforts, such as the IP Multimedia Subsystem (IMS) to support session control, mobility, and interoperability in all-IP next generation networks. Notwithstanding the central role of IMS in novel mobile multimedia, the potential of IMS-based service composition for the development of new classes of ready-to-use, energy-efficient, and cost-effective services is still widely unexplored. The paper proposes an original solution for the dynamic and standard-compliant redirection of incoming voice calls towards WiFi-equipped smart phones. The primary design guideline is to reduce energy consumption and service costs for the final user by automatically switching from the 3G to the WiFi infrastructure whenever possible. The proposal is fully compliant with the IMS standard and exploits the recently released IMS presence service to update device location and current communication opportunities. The reported experimental results point out that our solution, in a simple way and with full compliance with state-of-the-art industrially-accepted standards, can significantly increase battery lifetime without negative effects on call initiation delay.

Antisemitismus, Shoah und deutsche Verantwortung:(Nach)Wirkungen des Nationalsozialismus im medialen Nahostdiskurs

OpenAIRE

Ullrich, Peter

2010-01-01

Wahrscheinlich wird kein anderer internationaler Konflikt derart kontrovers und emotional in der bundesrepublikanischen Öffentlichkeit sowie auch und gerade in der politischen Linken diskutiert wie der israelisch-palästinensische oder weiter gefasst, der Nahost-Konflikt. Aus diesem Grund nimmt dieses Thema einen besonderen Platz in der Bildungsarbeit der Rosa-Luxemburg- Stiftung im Inland wie im Ausland ein. Wenngleich dabei auch in der Stiftung und ihrem Umfeld die Meinungen auseinandergehen...

L1-mediated retrotransposition of murine B1 and B2 SINEs recapitulated in cultured cells.

Science.gov (United States)

Dewannieux, Marie; Heidmann, Thierry

2005-06-03

SINEs are short interspersed nucleotide elements with transpositional activity, present at a high copy number (up to a million) in mammalian genomes. They are 80-400 bp long, non-coding sequences which derive either from the 7SL RNA (e.g. human Alus, murine B1s) or tRNA (e.g. murine B2s) polymerase III-driven genes. We have previously demonstrated that Alus very efficiently divert the enzymatic machinery of the autonomous L1 LINE (long interspersed nucleotide element) retrotransposons to transpose at a high rate. Here we show, using an ex vivo assay for transposition, that both B1 and B2 SINEs can be mobilized by murine LINEs, with the hallmarks of a bona fide retrotransposition process, including target site duplications of varying lengths and integrations into A-rich sequences. Despite different phylogenetic origins, transposition of the tRNA-derived B2 sequences is as efficient as that of the human Alus, whereas that of B1s is 20-100-fold lower despite a similar high copy number of these elements in the mouse genome. We provide evidence, via an appropriate nucleotide substitution within the B1 sequence in a domain essential for its intracellular targeting, that the current B1 SINEs are not optimal for transposition, a feature most probably selected for the host sake in the course of evolution.

Predominant porB1A and porB1B genotypes and correlation of gene mutations with drug resistance in Neisseria gonorrhoeae isolates in Eastern China

Directory of Open Access Journals (Sweden)

Tang Renxian

2010-11-01

Full Text Available Abstract Background Variations of porB1A and porB1B genes and their serotypes exist in Neisseria gonorrhoeae isolates from different geographical areas, and some site mutations in the porB1B gene correlate with drug resistance. Methods The β-lactamase production of N. gonorrhoeae isolates was determined by paper acidometric test and nitrocefin discs. The porB1A and porB1B genes of 315 non-penicillinase-producting N. gonorrhoeae (non-PPNG strains were amplified by PCR for sequencing to determine serotypes and site mutations. A duplex PCR was designed to simultaneously detect both porB1A and porB1B genes. Penicillin and tetracycline resistance was assessed by an in vitro drug sensitivity test. Results Of the N. gonorrhoeae isolates, 31.1% tested positive for porB1A and 68.9% for porB1B genes. All the 98 porB1A+ isolates belonging to IA6 serotype with either no mutation at the 120 and 121 sites (88.8% or a D120G (11.2% mutation and were no resistance to both penicillin and tetracycline. Among the 217 porB1B+ isolates, 26.7%, 22.6% and 11.5% belonged to IB3, IB3/6 and IB4 serotypes, respectively. Particularly, two novel chimeric serotypes, IB3/6-IB2 and IB2-IB4-IB2, were found in 77 and 8 porB1B+ isolates. Two hundred and twelve (97.7% of the porB1B+ isolates were presented G120 and/or A121 mutations with 163 (76.9% at both sites. Interestingly, within the 77 porB1B+ isolates belonging to IB3/6-IB2 serotype, 15 were discovered to possess novel deletions at both A121 and N122 sites. All the replacement mutations at these sites in PorB1B were correlated with resistance and the deletion mutation showed the highest resistance. Conclusion N. gonorrhoeae isolates circulating in Eastern China include a sole PorB1A serotype (IA6 and five PorB1B serotypes. Multiple mutations in porB1B genes, including novel A121 and N122 deletions, are correlated with high levels of penicillin and tetracycline resistance.

Branching Fraction and CP Asymmetry Measurements in Inclusive B → Xs ℓ+ℓ- and B → Xsγ Decays from BABAR

International Nuclear Information System (INIS)

Eigen, G.

2015-01-01

We present an update on total and partial branching fractions and on CP asymmetries in the semi-inclusive decay B → X s ℓ + ℓ - . Further, we summarize our results on branching fractions and CP asymmetries for semi-inclusive and fully-inclusive B → X s γ decays. We present the first result on the CP asymmetry difference of charged and neutral B → X s γ decays yielding the first constraint on the ratio of Wilson coefficients Im(C 8 eff /C 7 eff ).

Environmental policy. Ambient radioactivity levels and radiation doses in 1996; Umweltpolitik. Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

The report is intended as information for the German Bundestag and Bundesrat as well as for the general population interested in issues of radiological protection. The information presented in the report shows that in 1996, the radiation dose to the population was low and amounted to an average of 4 millisievert (mSv), with 60% contributed by natural radiation sources, and 40% by artificial sources. The major natural source was the radioactive gas radon in buildings. Anthropogenic radiation exposure almost exclusively resulted from application of radioactive substances and ionizing radiation in the medical field, for diagnostic purposes. There still is a potential for reducing radiation doses due to these applications. In the reporting year, there were 340 000 persons occupationally exposed to ionizing radiation. Only 15% of these received a dose different from zero, the average dose was 1.8 mSv. The data show that the anthropogenic radiation exposure emanating from the uses of atomic energy or applications of ionizing radiation in technology is very low. (orig./CB) [Deutsch] Der vorliegende Bericht ueber die `Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996` richtet sich an Bundestag und Bundesrat und darueber hinaus an alle an Fragen des Strahlenschutzes interessierte Buerger. Der Bericht belegt, dass die Strahlenbelastung der Bevoelkerung im Jahr 1996 gering war und insgesamt durchschnittlich 4 Millisievert (mSv) betrug. Dieser Wert war zu 60% auf natuerliche und zu 40% auf kuenstliche Strahlenquellen zurueckzufuehren. Den wesentlichen Beitrag zur natuerlichen Strahlenbelastung lieferte das radioaktive Gas Radon in Wohnungen. Die zivilisatorische Strahlenexposition der Bevoelkerung wurde fast ausschliesslich durch die Anwendung radioaktiver Stoffe und ionisierender Strahlen in der Medizin im Rahmen der Diagnostik hervorgerufen. Hier bestehen nach wie vor Moeglichkeiten zur Reduktion der Strahlenbelastung. Im Jahre 1996 waren 340 000 Personen beruflich

Impact of IL1B gene polymorphisms and interleukin 1B levels on susceptibility to spontaneous preterm birth.

Science.gov (United States)

Langmia, Immaculate M; Apalasamy, Yamunah D; Omar, Siti Z; Mohamed, Zahurin

2016-11-01

Genetic factors influence susceptibility to preterm birth (PTB) and the immune pathway of PTB that involves the production of cytokines such as interleukins has been implicated in PTB disease. The aim of this study is to investigate the association of interleukin 1β (IL1B) gene polymorphisms and IL1B levels with spontaneous PTB. Peripheral maternal blood from 495 women was used for extraction of DNA and genotyping was carried out using the Sequenom MassARRAY platform. Maternal plasma was used to measure IL1B levels. There was no significant association between the allelic and genotype distribution of IL1B single nucleotide polymorphism (SNP) (rs1143634, rs1143627, rs16944) and the risk of PTB among Malaysian Malay women (rs1143634, P=0.722; rs1143627, P=0.543; rs16944, P=0.615). However, IL1B levels were significantly different between women who delivered preterm compared with those who delivered at term (P=0.030); high mean levels were observed among Malay women who delivered at preterm (mean=32.52) compared with term (mean=21.68). IL1B SNPs were not associated with IL1B plasma levels. This study indicates a significant association between IL1B levels and reduced risk of PTB among the Malaysian Malay women. This study shows the impact of IL1B levels on susceptibility to PTB disease; however, the high levels of IL1B observed among women in the preterm group are not associated with IL1B SNPs investigated in this study; IL1B high levels may be because of other factors not explored in this study and therefore warrant further investigation.

Interferon Gamma-1b Injection

Science.gov (United States)

Interferon gamma-1b injection is used to reduce the frequency and severity of serious infections in people with chronic ... severe, malignant osteopetrosis (an inherited bone disease). Interferon gamma-1b is in a class of medications called ...

34 CFR 5b.1 - Definitions.

Science.gov (United States)

2010-07-01

... maintained by the Department, including but not limited to the individual's education, financial transactions... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 5b.1 Section 5b.1 Education Office of the Secretary, Department of Education PRIVACY ACT REGULATIONS § 5b.1 Definitions. As used in this part: (a...

15 CFR 8b.1 - Purpose.

Science.gov (United States)

2010-01-01

... of handicap in any program or activity receiving Federal financial assistance. The purpose of this... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Purpose. 8b.1 Section 8b.1 Commerce... HANDICAPPED IN FEDERALLY ASSISTED PROGRAMS OPERATED BY THE DEPARTMENT OF COMMERCE General Provisions § 8b.1...

Spatially resolved chemical analysis of cicada wings using laser-ablation electrospray ionization (LAESI) imaging mass spectrometry (IMS).

Science.gov (United States)

Román, Jessica K; Walsh, Callee M; Oh, Junho; Dana, Catherine E; Hong, Sungmin; Jo, Kyoo D; Alleyne, Marianne; Miljkovic, Nenad; Cropek, Donald M

2018-03-01

Laser-ablation electrospray ionization (LAESI) imaging mass spectrometry (IMS) is an emerging bioanalytical tool for direct imaging and analysis of biological tissues. Performing ionization in an ambient environment, this technique requires little sample preparation and no additional matrix, and can be performed on natural, uneven surfaces. When combined with optical microscopy, the investigation of biological samples by LAESI allows for spatially resolved compositional analysis. We demonstrate here the applicability of LAESI-IMS for the chemical analysis of thin, desiccated biological samples, specifically Neotibicen pruinosus cicada wings. Positive-ion LAESI-IMS accurate ion-map data was acquired from several wing cells and superimposed onto optical images allowing for compositional comparisons across areas of the wing. Various putative chemical identifications were made indicating the presence of hydrocarbons, lipids/esters, amines/amides, and sulfonated/phosphorylated compounds. With the spatial resolution capability, surprising chemical distribution patterns were observed across the cicada wing, which may assist in correlating trends in surface properties with chemical distribution. Observed ions were either (1) equally dispersed across the wing, (2) more concentrated closer to the body of the insect (proximal end), or (3) more concentrated toward the tip of the wing (distal end). These findings demonstrate LAESI-IMS as a tool for the acquisition of spatially resolved chemical information from fragile, dried insect wings. This LAESI-IMS technique has important implications for the study of functional biomaterials, where understanding the correlation between chemical composition, physical structure, and biological function is critical. Graphical abstract Positive-ion laser-ablation electrospray ionization mass spectrometry coupled with optical imaging provides a powerful tool for the spatially resolved chemical analysis of cicada wings.

Medien im Lehramtsstudium für die Sekundarstufe in Österreich. Eine quantitativ-inhaltsanalytische Lehrplananalyse von vier Curricula.

Directory of Open Access Journals (Sweden)

Christian Swertz

2015-12-01

Full Text Available Medien sind für Erziehung und Unterricht notwendig sowie im Alltag, in der Politik und der Ökonomie relevant. Daher ist zu erwarten, dass Medien in den Curricula für die Lehramtsausbildung im Sekundarbereich vorkommen. Ob diese Erwartung zutrifft, wird an vier Curricula für den Sekundarbereich mit einem quantitativen inhaltsanalytischen Verfahren untersucht. Die Ergebnisse zeigen, dass Medien im Allgemeinen und Medienpädagogik, Medienkompetenz und Mediendidaktik im Besonderen nur selten vorkommen und die meisten der seltenen Vorkommnisse irrelevant sind.

RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets

Directory of Open Access Journals (Sweden)

SOTE VLADIMIROV

2005-10-01

Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanol–water (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.

Linkage of genes for laminin B1 and B2 subunits on chromosome 1 in mouse.

Science.gov (United States)

Elliott, R W; Barlow, D; Hogan, B L

1985-08-01

We have used cDNA clones for the B1 and B2 subunits of laminin to find restriction fragment length DNA polymorphisms for the genes encoding these polypeptides in the mouse. Three alleles were found for LamB2 and two for LamB1 among the inbred mouse strains. The segregation of these polymorphisms among recombinant inbred strains showed that these genes are tightly linked in the central region of mouse Chromosome 1 between Sas-1 and Ly-m22, 7.4 +/- 3.2 cM distal to the Pep-3 locus. There is no evidence in the mouse for pseudogenes for these proteins.

Experimental Study of 1.55-μm EML-Based Optical IM/DD PAM-4/8 Short Reach Systems

DEFF Research Database (Denmark)

Pang, Xiaodan; Ozolins, Oskars; Gaiarin, Simone

2017-01-01

We experimentally evaluate high-speed intensity modulation/direct detection (IM/DD) transmissions with a 1.55-μm broadband electro-absorption modulated laser and pulse amplitude modulations (PAM). We demonstrate 80 Gb/s/λ PAM-4 and 96 Gb/s/λ PAM-8 transmissions with low-complexity digital...... equalizers at the receiver. Performance comparison with different types of equalizers are performed, including linear symbol-spaced feed-forward equalizer (FFE), fractional (half-symbol) spaced FFE and decision feedback equalizer (DFE), with different tap number. It is found that for both cases, a 6-tap...... symbol-spaced FFE is sufficient to achieve a stable performance with bit-error-rate below the 7% overhead hard decision forward error correction (7%-OH HD-FEC) threshold over a 4 km standard single mode fiber link. Practical considerations including comparison between adaptive and static equalizer...

[Geisteswissenschaft und Publizistik im Baltikum des 19. und frühen 20. Jahrhunderts] / Manfred von Boetticher

Index Scriptorium Estoniae

Boetticher, Manfred von, 1947-

2012-01-01

Arvustus: Geisteswissenschaft und Publizistik im Baltikum des 19. und frühen 20. Jahrhunderts (Schriften der Baltischen Historischen Kommission, 17; Baltische Biographische Forschungen, 1). Hrsg. von Norbert Angermann, Wilhelm Lenz und Konrad Maier. (Berlin: LIT-Varlag, 2011)

La política de las imágenes en Jacques Rancière

OpenAIRE

Corella Lacasa, Miguel

2011-01-01

Someto hoy a discusión la crónica de mi particular recorrido fragmentario e inacabado por la obra de Rancière, que organizaré a partir algunas de las imágenes que, en mi opinión, juegan un papel importante en su argumenta ción. Espero que este álbum de imágenes y el discurso tramado a partir de ellas puedan ser de alguna utilidad para el debate acerca del sentido o el uso político de las imágenes y, más en general, para la discusión de las relaciones entre estética y po...

Veränderungen der Serumlipide bei Senioren im Verlauf des Alterns unter Berücksichtigung ausgewählter Einflussfaktoren : eine Untersuchung im Rahmen der Gießener Senioren Langzeitstudie

OpenAIRE

Richter, Margrit

2014-01-01

In der vorliegenden Arbeit wurde im Rahmen der Giessener Senioren Langzeitstudie (GISELA) untersucht, ob und in wie weit sich die Konzentrationen der Serumlipide (Gesamtcholesterol (TC), HDL-Cholesterol (HDL-C), LDL-Cholesterol (LDL-C), NonHDL-Cholesterol (NonHDL-C) und Triglyceride (TG)) im Verlauf fortgeschrittenen Alterns verändern. Dabei wurden folgende mögliche Einflussfaktoren berücksichtigt: BMI, WHR, PAI, Fettmasse, Kohlenhydrat¬zufuhr, Ballaststoffzufuhr, Zufuhr mehrfach ungesättigte...

Datamart use for complex data retrieval in an ArcIMS application

Energy Technology Data Exchange (ETDEWEB)

Scherma, S. (Steven); Bolivar, Stephen L.

2004-01-01

This paper describes the use of datamarts and data warehousing concepts to expedite retrieval and display of complex attribute data from multi-million record databases. Los Alamos National Laboratory has developed an Internet application (SMART) using ArcIMS that relies on datamarts to quickly retrieve attribute data, associated with, but not contained within GIS layers. The volume of data and the complex relationships within the transactional database made data display within ArcIMS impractical without the use of datamarts. The technical issues and solutions involved in the development are discussed.

An Introduction of IMS(Intramuscular Stimulation Therapy with Theoretcial Basis and Clinical Applications

Directory of Open Access Journals (Sweden)

Ki-Rok Kwon

2003-06-01

Full Text Available Results : 1. The most important concept of IMS is chronic pain illness that may develop into hypersensitivity of the nerves, i.e., neuropathy. 2. Muscle shortening may be triggered by stress, including emotional, physical, external, and internal factors. 3. Muscle shortening increases mechanical tension on the muscles as well as inducing abrasion of the tissues by stretching ligament, tendon, cartilage, bone, and etc. 4. Pain from neuropathy is normally manifested on musculoskeletal system and spasm or shortening play as the central axis of this pain. 5. Neuropathy often appears at the nerve root level and the most important decisive factor of radiculopathy is muscle shortening. 6. Spondylosis is the most common cause of radiculopathy. 7. The most significant treatment principle of IMS is to relieve muscle shortening and remove stimulating determinant from the vertebrae. 8. Dry needling is quite effective for treating various pain caused by muscle shortening.

Security in the internet; Sicherheitsaspekte im Internet

Energy Technology Data Exchange (ETDEWEB)

Seibel, R.M.M.; Kocher, K.; Landsberg, P. [Witten-Herdecke Univ., Witten (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie

2000-04-01

Aim of the study: Is it possible to use the Internet as a secure media for transport of telemedicine? Which risks exist for routine use? In this article state of the art methods of security were analysed. Telemedicine in the Internet has severe risks, because patient data and hospital data of a secure Intranet can be manipulated by connecting it to the Web. Conclusions: Establishing of a firewall and the introduction of HPC (Health Professional Card) are minimizing the risk of un-authorized access to the hospital server. HPC allows good safety with digital signature and authentication of host and client of medical data. For secure e-mail PGP (Pretty Good Privacy) is easy to use as a standard protocol. Planning all activities exactly as well as following legal regulations are important requisites for reduction of safety risks in Internet. (orig.) [German] Ziele der Studie und Analyse: Es sollten die Fragen beantwortet werden, ob es moeglich ist, das Internet als sicheres Uebermittlungsmedium fuer Telemedizin zu nutzen und welche Sicherheitsrisiken bestehen. Dazu wurden die gaengigen Sicherheitsmethoden analysiert. Telemedizin im Internet ist mit Sicherheitsrisiken behaftet, die durch die Oeffnung eines Intranets mit der Moeglichkeit zur unberechtigten Manipulation von aussen bedingt sind. Schlussfolgerung: Diese Sicherheitsrisiken koennen durch eine Firewall weitgehend unterbunden werden. Chipkarten wie die Health professional card ermoeglichen eine hohe Sicherheit bei digitaler Signatur und sicherer Authentifikation der Sender und Empfaenger von Daten im Internet. Auch Standards wie Pretty good privacy sind inzwischen fuer sichere e-mails einfach einzusetzen. Wichtige Voraussetzung fuer die Reduktion von Sicherheitsrisiken ist unter Beruecksichtigung der gesetzlichen Vorgaben die exakte Planung aller Aktivitaeten im Internet, bei denen medizinische Patientendaten versandt werden sollen, in einem Team aus Aerzten und Informatikern. (orig.)

Dynamik des Kaufverhaltens im Bio-Sortiment

OpenAIRE

Buder, Fabian; Hamm, Ulrich; Bickel, Malte; Bien, Barbara; Michels, Paul

2010-01-01

Das Gesamtziel des vorliegenden Forschungsprojekts war es, eine detaillierte Informationsgrundlage zum tatsächlichen Kaufverhalten von deutschen Haushalten bei ökologischen Lebensmitteln auf der Basis von Haushaltspaneldaten zu erstellen. Dazu sollten zum einen relevante Aspekte des Kaufverhaltens von Haushalten bei Öko-Lebensmitteln im Zeitverlauf von 2004 bis 2008 analysiert und zum anderen die Einflussfaktoren des Kaufverhaltens bei Öko-Lebensmitteln für das Jahr 2008 identifiziert werden....

Gewerbsmässigkeit im schweizerischen Luftrecht

OpenAIRE

Müller, Roland

2005-01-01

Der Begriff der Gewerbsmässigkeit hat im schweizerischen Luftrecht eine grosse Bedeutung. Werden gewerbsmässige Flüge ohne die entsprechenden Bewilligungen und Voraussetzungen durchgeführt, so resultieren gravierende zivilrechtliche, strafrechtliche und administrative Konsequenzen. In den massgebenden internationalen Luftfahrtabkommen findet sich keine Definition der Gewerbsmässigkeit, dies wird den einzelnen Staaten überlassen. Nur in den Joint Aviation Requirements und in der EU-Zollver...

The coalification profile of the Grambach 1 exploration well - first indication of an oil kitchen in the molasse basin; Das Inkohlungsprofil der Bohrung Grambach 1 - erster Hinweis auf eine ``Oelkueche`` im Molassebecken

Energy Technology Data Exchange (ETDEWEB)

Hiltmann, W.; Wehner, H. [Bundesanstalt fuer Geowissenschaften und Rohstoffe, Hannover (Germany); Kuckelkorn, K. [Niedersaechsisches Landesamt fuer Bodenforschung, Hannover (Germany)

1999-06-01

For the first time an exploration well beneath the German part of the Alpine overthrust zone met vitrinite reflectance values raising up to 1,6% R{sub r} - and this in a widespread tectonic high position. The interpretation as an oil and gas kitchen is confirmed by oil maturity (derived by biomarkers and carbon isotope ratios). (orig.) [Deutsch] Erstmals traf im deutschen Teil der alpinen Ueberschiebungszone eine Bohrung ein bis 1,6% R{sub r} ansteigendes Inkohlungsprofil an und dies in einer ausgedehnten Hochscholle. Die Interpretation als `Oel- und Gaskueche` wurde durch die Reife des zugeschlossenen Erdoels (Biomarker, Kohlenstoffisotopen) bestaetigt. (orig.)

ImBuild: Impact of building energy efficiency programs

Energy Technology Data Exchange (ETDEWEB)

Scott, M.J.; Hostick, D.J.; Belzer, D.B.

1998-04-01

As part of measuring the impact of government programs on improving the energy efficiency of the Nation`s building stock, the Department of Energy Office of Building Technology, State and Community Programs (BTS) is interested in assessing the economic impacts of its portfolio of programs, specifically the potential impact on national employment and income. The special-purpose version of the IMPLAN model used in this study is called ImBuild. In comparison with simple economic multiplier approaches, such as Department of Commerce RIMS 2 system, ImBuild allows for more complete and automated analysis of the economic impacts of energy efficiency investments in buildings. ImBuild is also easier to use than existing macroeconomic simulation models. The authors conducted an analysis of three sample BTS energy programs: the residential generator-absorber heat exchange gas heat pump (GAX heat pump), the low power sulfur lamp (LPSL) in residential and commercial applications, and the Building America program. The GAX heat pump would address the market for the high-efficiency residential combined heating and cooling systems. The LPSL would replace some highly efficient fluorescent commercial lighting. Building America seeks to improve the energy efficiency of new factory-built, modular, manufactured, and small-volume, site-built homes through use of systems engineering concepts and early incorporation of new products and processes, and by increasing the demand for more energy-efficient homes. The authors analyze a scenario for market penetration of each of these technologies devised for BTS programs reported in the BTS GPRA Metrics Estimates, FY99 Budget Request, December 19, 1997. 46 figs., 4 tabs.

Die nonverbale Kommunikation im Bundestagswahlkampf 2002:Gerhard Schröder versus Edmund Stoiber

OpenAIRE

Dieball, W. (Werner)

2004-01-01

Diese interdisziplinäre Dissertation aus dem Fachbereich Politikwissenschaften verfolgt vordergründig das Ziel, die Wirkungsweise der nonverbalen Kommunikation im Bundestagswahlkampf 2002 zu analysieren. Im Zentrum der empirisch-analytischen Untersuchung stehen Gerhard Schröder und Edmund Stoiber, die nach den nonverbalen Merkmalen: äußeres Erscheinungsbild, Mimik, Stimmklang, Gestik und Motorik untersucht werden. Das leitende Forschungsinteresse der Arbeit besteht darin, zu eruieren, inwiewe...

[Geisteswissenschaften und Publizistik im Baltikum des 19. und frühen 20. Jahrhunderts] / Gert von Pistohlkors

Index Scriptorium Estoniae

Pistohlkors, Gert von, 1935-

2013-01-01

Arvustus: Geisteswissenschaften und Publizistik im Baltikum des 19. und frühen 20. Jahrhunderts. Hrsg. von Norbert Angermann, Wilhelm Lenz und Konrad Maier. (Schriften der Baltischen Historischen Kommission, Bd. 17; Baltische Biographische Forschungen, Bd. 1.) Lit. Münster 2011

Heat shock factors HsfB1 and HsfB2b are involved in the regulation of Pdf1.2 expression and pathogen resistance in Arabidopsis.

Science.gov (United States)

Kumar, Mukesh; Busch, Wolfgang; Birke, Hannah; Kemmerling, Birgit; Nürnberger, Thorsten; Schöffl, Friedrich

2009-01-01

In order to assess the functional roles of heat stress-induced class B-heat shock factors in Arabidopsis, we investigated T-DNA knockout mutants of AtHsfB1 and AtHsfB2b. Micorarray analysis of double knockout hsfB1/hsfB2b plants revealed as strong an up-regulation of the basal mRNA-levels of the defensin genes Pdf1.2a/b in mutant plants. The Pdf expression was further enhanced by jasmonic acid treatment or infection with the necrotrophic fungus Alternaria brassicicola. The single mutant hsfB2b and the double mutant hsfB1/B2b were significantly improved in disease resistance after A. brassicicola infection. There was no indication for a direct interaction of Hsf with the promoter of Pdf1.2, which is devoid of perfect HSE consensus Hsf-binding sequences. However, changes in the formation of late HsfA2-dependent HSE binding were detected in hsfB1/B2b plants. This suggests that HsfB1/B2b may interact with class A-Hsf in regulating the shut-off of the heat shock response. The identification of Pdf genes as targets of Hsf-dependent negative regulation is the first evidence for an interconnection of Hsf in the regulation of biotic and abiotic responses.

Was bedeutet Trägheit? Begriff und Wirkung der Trägheit im Rahmen des Wechselverhaltens von Konsumenten im Strommarkt

NARCIS (Netherlands)

Henseler, Jörg

2006-01-01

In Wissenschaft und Praxis wird die Trägheit der Konsumenten als Ursache der geringen Wechselrate im deutschen Strommarkt für Haushaltskunden diskutiert. Der vorliegende Beitrag arbeitet heraus, dass es sich bei dieser Argumentation entweder um eine Tautologie oder ein Synomym für den Verbleib in

Flight Control Requirements for Weapon Delivery. Volume 1. Development of the Terminal Aerial Weapon Delivery Simulation (TAWDS) Programs and Their Use in Formulating Flying Qualities Guidelines for Manually Coupled Aircraft Weapon Delivery Systems

Science.gov (United States)

1976-03-01

t) AT(t) + B(t) Q(t) BT(t) X XX 1 267 ■■ ^"""■’■"-’■ «-I ...,r^.-^^ Mitm *<^ «^r*.»*** ■..fin^....^ ■"■""■"""■"" ■ ■»IM II Uli« svn^im^M

Miniature GC-Minicell Ion Mobility Spectrometer (IMS) for In Situ Measurements in Astrobiology Planetary Missions

Science.gov (United States)

Kojiro, Daniel R.; Stimac, Robert M.; Kaye, William J.; Holland, Paul M.; Takeuchi, Norishige

2006-01-01

Astrobiology flight experiments require highly sensitive instrumentation for in situ analysis of volatile chemical species and minerals present in the atmospheres and surfaces of planets, moons, and asteroids. The complex mixtures encountered place a heavy burden on the analytical instrumentation to detect and identify all species present. The use of land rovers and balloon aero-rovers place additional emphasis on miniaturization of the analytical instrumentation. In addition, smaller instruments, using tiny amounts of consumables, allow the use of more instrumentation and/or ionger mission life for stationary landers/laboratories. The miniCometary Ice and Dust Experiment (miniCIDEX), which combined Gas Chromatography (GC) with helium Ion Mobility Spectrometry (IMS), was capable of providing the wide range of analytical information required for Astrobiology missions. The IMS used here was based on the PCP model 111 IMS. A similar system, the Titan Ice and Dust Experiment (TIDE), was proposed as part of the Titan Orbiter Aerorover Mission (TOAM). Newer GC systems employing Micro Electro- Mechanical System (MEMS) based technology have greatly reduced both the size and resource requirements for space GCs. These smaller GCs, as well as the continuing miniaturization of Astrobiology analytical instruments in general, has highlighted the need for smaller, dry helium IMS systems. We describe here the development of a miniature, MEMS GC-IMS system (MEMS GC developed by Thorleaf Research Inc.), employing the MiniCell Ion Mobility Spectrometer (IMS), from Ion Applications Inc., developed through NASA's Astrobiology Science and Technology Instrument Development (ASTID) Program and NASA s Small Business Innovative Research (SBIR) Program.

Die filmstilistische Darstellung von Klaras Gehbehinderung im Kinderfilm "Heidi"

Directory of Open Access Journals (Sweden)

Maria Ohrfandl

2016-09-01

Full Text Available Dieser Beitrag soll die Forschungslücke zur Darstellung von Behinderungen speziell im Kinderfilm im deutschsprachigen Raum füllen. Auf Basis einer neoformalistisch orientierten Filmanalyse nach Bordwell und Thompson (2008, wird anhand von drei Filmsequenzen eine mögliche Lesart des Kinderfilms "Heidi" (Marcus 2005 entwickelt, um die filmstilistische Darstellung der Gehbehinderung des Mädchens Klara zu untersuchen. Die Ergebnisse werden mit theoretischen Überlegungen zur Problematik der Begriffsbestimmung von Körperbehinderung sowie zur Mobilität und Selbstbestimmung von Menschen mit Körperbehinderungen in Bezug gesetzt. Dabei zeigt sich im Wesentlichen, dass im Kinderfilm "Heidi" (Marcus 2005 Klaras Gehbehinderung als 'heilbare Krankheit' und der Rollstuhl als Einschränkung von Mobilität begriffen wird. Außerdem unterliegt Klara aufgrund ihrer Körperbehinderung überwiegend der Fremdbestimmung von Erwachsenen. Zur Klärung wahrscheinlicher filmischer Bildungspotenziale werden die Ergebnisse schließlich anhand der von Jörissen und Marotzki (2009 entwickelten Orientierungsdimensionen "Wissens-, Handlungs-, Grenz- und Biographiebezug" diskutiert. This article aims to bridge a knowledge gap by showing ways of representing disabilities in the German children film genre. Using Bordwell and Thomson's (2008 neoformalistically orientated film analysis approach, the movie "Heidi" (Marcus 2005 is analysed. Bordwell and Thompson's (2008 method is applied to three sequences of "Heidi" in order to present an interpretation and to discuss the representation of Clara's walking impediment. The results are then associated with theoretical considerations regarding the mobility and self-determination of people with disabilities and problematic definitions of the term 'physical disability'. It is shown that characters in the children's film "Heidi" (Marcus 2005 regard Clara's walking impediment as a 'curable disease' and the wheelchair as a limitation

Expression and biological activity of the cystine knot bioinsecticide PA1b (Pea Albumin 1 Subunit b.

Directory of Open Access Journals (Sweden)

Vanessa Eyraud

Full Text Available The PA1b (Pea Albumin 1, subunit b peptide is an entomotoxin extract from Legume seeds with lethal activity on several insect pests, such as mosquitoes, some aphids and cereal weevils. This 37 amino-acid cysteine-rich peptide has been, until now, obtained by biochemical purification or chemical synthesis. In this paper, we present our results for the transient production of the peptide in Nicotiana benthamiana by agro-infiltration, with a yield of about 35 µg/g of fresh leaves and maximum production 8 days after infiltration. PA1b is part of the PA1 gene which, after post-translational modifications, encodes two peptides (PA1b and PA1a. We show that transforming tobacco with the PA1b cDNA alone does not result in production of the toxin and, in fact, the entire cDNA is necessary, raising the question of the role of PA1a. We constructed a PA1-cassette, allowing for the quick "cut/paste" of different PA1b mutants within a conserved PA1 cDNA. This cassette enabled us to produce the six isoforms of PA1b which exist in pea seeds. Biological tests revealed that all the isoforms display similar activity, with the exception of one which is inactive. The lack of activity in this isoform led us to conclude that the amphiphilic nature of the peptide is necessary for activity. The possible applications of this expression system for other cysteine-rich biomolecules are discussed.

[Preussen und Livland im Zeichen der Reformation] / Anti Selart

Index Scriptorium Estoniae

Selart, Anti, 1973-

2015-01-01

Arvustus: Preussen und Livland im Zeichen der Reformation. Hrsg. von Arno Mentzel-Reuters und Klaus Neitmann. (Tagungsberichte der Historischen Kommission für ost- und westpreussische Landesforschung, 28). Fibre Verlag. Osnabrück 2014

Covalent Allosteric Inactivation of Protein Tyrosine Phosphatase 1B (PTP1B) by an Inhibitor-Electrophile Conjugate.

Science.gov (United States)

Punthasee, Puminan; Laciak, Adrian R; Cummings, Andrea H; Ruddraraju, Kasi Viswanatharaju; Lewis, Sarah M; Hillebrand, Roman; Singh, Harkewal; Tanner, John J; Gates, Kent S

2017-04-11

Protein tyrosine phosphatase 1B (PTP1B) is a validated drug target, but it has proven difficult to develop medicinally useful, reversible inhibitors of this enzyme. Here we explored covalent strategies for the inactivation of PTP1B using a conjugate composed of an active site-directed 5-aryl-1,2,5-thiadiazolidin-3-one 1,1-dioxide inhibitor connected via a short linker to an electrophilic α-bromoacetamide moiety. Inhibitor-electrophile conjugate 5a caused time-dependent loss of PTP1B activity consistent with a covalent inactivation mechanism. The inactivation occurred with a second-order rate constant of (1.7 ± 0.3) × 10 2 M -1 min -1 . Mass spectrometric analysis of the inactivated enzyme indicated that the primary site of modification was C121, a residue distant from the active site. Previous work provided evidence that covalent modification of the allosteric residue C121 can cause inactivation of PTP1B [Hansen, S. K., Cancilla, M. T., Shiau, T. P., Kung, J., Chen, T., and Erlanson, D. A. (2005) Biochemistry 44, 7704-7712]. Overall, our results are consistent with an unusual enzyme inactivation process in which noncovalent binding of the inhibitor-electrophile conjugate to the active site of PTP1B protects the nucleophilic catalytic C215 residue from covalent modification, thus allowing inactivation of the enzyme via selective modification of allosteric residue C121.

[Bernt Ahrenholz : Verweise mit Demonstrativa im Gesprochenen Deutsch...] / Klaus Geyer

Index Scriptorium Estoniae

Geyer, Klaus

2008-01-01

Arvustus: Ahrenholz, Bernt. Verweise mit Demonstrativa im gesprochenen Deutsch : Grammatik, Zweitspracherwerb und Deutsch als Fremdsprache. Berlin ; New York : de Gruyter, 2007. (Linguistik - Impulse & Tendenzen ; 17)

Protein Tyrosine Phosphatase 1B (PTP1B): A Potential Target for Alzheimer's Therapy?

Science.gov (United States)

Vieira, Marcelo N N; Lyra E Silva, Natalia M; Ferreira, Sergio T; De Felice, Fernanda G

2017-01-01

Despite significant advances in current understanding of mechanisms of pathogenesis in Alzheimer's disease (AD), attempts at drug development based on those discoveries have failed to translate into effective, disease-modifying therapies. AD is a complex and multifactorial disease comprising a range of aberrant cellular/molecular processes taking part in different cell types and brain regions. As a consequence, therapeutics for AD should be able to block or compensate multiple abnormal pathological events. Here, we examine recent evidence that inhibition of protein tyrosine phosphatase 1B (PTP1B) may represent a promising strategy to combat a variety of AD-related detrimental processes. Besides its well described role as a negative regulator of insulin and leptin signaling, PTB1B recently emerged as a modulator of various other processes in the central nervous system (CNS) that are also implicated in AD. These include signaling pathways germane to learning and memory, regulation of synapse dynamics, endoplasmic reticulum (ER) stress and microglia-mediated neuroinflammation. We propose that PTP1B inhibition may represent an attractive and yet unexplored therapeutic approach to correct aberrant signaling pathways linked to AD.

Geschichtsbezogene und rechtspolitische Polonica im Bücherbestand Gottfried Lengnichs

Directory of Open Access Journals (Sweden)

Iwona Imańska

2017-11-01

Full Text Available Gottfried Lengnich, der Historiker und Syndikus der Stadt Danzig aus dem 18. Jahrhundert, hinterließ eine Büchersammlung mit über viertausend Büchern, die nach seinem Tode in zwei Auktionen im Juli und November 1774 versteigert werden sollten. Die Auktionskataloge befinden sich in der Staatsbibliothek zu Berlin – Stiftung Preußischer Kulturbesitz und sind auch online zugänglich. Wegen wissenschaftlicher Interessen Lengnichs befanden sich in seiner Bibliothek ca. 600 Polonica-Drucke, die meisten davon waren Abhandlungen im Themenfeld Geschichte, Recht und Politik. Die Analyse dieses Fragments des Bücherbestands Lengnichs bewies, dass der Syndikus eine perfekte Arbeitswerkstatt für sich schuf, indem er die Werke der meisten wichtigsten polnischen und fremden Autoren, die über die Geschichte und die Gesetzgebung Polens und Preußens schrieben, sammelte.

Synthesis of 9H-Indeno [1, 2-b] Pyrazine and 11H-Indeno [1, 2-b ...

African Journals Online (AJOL)

NICO

Synthesis of 9H-Indeno [1, 2-b] Pyrazine and. 11H-Indeno [1, 2-b] Quinoxaline Derivatives in. One-step Reaction from 2-Bromo-4-chloro-1-indanone. S. Jasouri1,2, J. Khalafy1,*, M. Badali2 and R.H. Prager3. 1Department of Chemistry, Urmia University, Urmia 57154, Iran. 2Daana Pharmaceutical Co., P.O. Box 5181, Tabriz ...

In vitro study of vitamins B1, B2 and B6 adsorption on zeolite

Directory of Open Access Journals (Sweden)

Basić Zorica

2011-01-01

Full Text Available Background/Aim. Zeolites are the hydratised alumosilicates of alcali and earthalcali cations, which have a long three-dimensional crystal structure. Preparations on the basis of zeolites are used for adsorption of organic and nonorganic toxic substances and they, also, find more and more use in veterinary and human medicine and pharmacy. The aim of this study was to evaluate the possibilities of zeolite to adsorb vitamins B1, B2 and B6 in acid and neutral solutions, as well as the characteristics of the process (saturability, reversibility and competitivness. Methods. The specific and sensitive HPLC method with fluorescent detector was used for determination of vitamins B1, B2 and B6. Analyte separation and detection were carried out by applying the reverse-phase method on column C18. An in vitro experiment was done by testing the influence of pH value (2 and 7, concentration of vitamin solution (1, 2 and 5 mg/L, the lenght of contact with zeolite (10-180 min and cation competitiveness on the exchange capacity, which is achieved by media and zeolite contact, as well as a possible vitamins desorption through changing pH value of the solution at 37°C. Jon competitiveness was examined by adding commercial feed mixture (grower with a defined content of the examined vitamines in zeolite solutions the pH = 2 and pH = 7. Results. Vitamins B1, B2 and B6 were stable in both pH=2 and pH = 7 solutions at 37°C, in the defined time intervals. In acid solution concentrations of vitamins significantly declined in the first 10 min, with no significant decline in further 30 min for all the three concentrations testch. In neutral solution, after the addition of 1% zeolite, decrease in vitamins concentrations was slightly lower than in acid solution, but also significant in the first 10 min of the contact with zeolite. It was found that zeolite, which adsorbed vitamins in acid solution, transferred in the neutral one released a significant quantity of adsorbed

CD25+ B-1a Cells Express Aicda

Directory of Open Access Journals (Sweden)

Hiroaki Kaku

2017-06-01

Full Text Available B-1a cells are innate-like B-lymphocytes producing natural antibodies. Activation-induced cytidine deaminase (AID, a product of the Aicda gene, plays a central role in class-switch recombination and somatic hypermutation in B cells. Although a role for Aicda in B-1a cells has been suggested on the basis of experiments with knock out (KO mice, whether B-1a cells express Aicda, and if so, which B-1a cell subpopulation expresses Aicda, remains unknown. Here, we demonstrate that B-1 cells express Aicda, but at a level below that expressed by germinal center (GC B cells. We previously reported that B-1a cells can be subdivided based on CD25 expression. We show here that B-1a cell Aicda expression is concentrated in the CD25+ B-1a cell subpopulation. These results suggest the possibility that previous studies of memory B cells identified on the basis of Aicda expression may have inadvertently included an unknown number of CD25+ B-1a cells. Although B-1a cells develop normally in the absence of Aicda, a competitive reconstitution assay reveals enhanced vigor for AID KO B-1a cell bone marrow (BM progenitors, as compared with wild-type BM B-1 cell progenitors. These results suggest that AID inhibits the development of B-1a cells from BM B-1 cell progenitors in a competitive environment.

26 CFR 1.1402(b)-1 - Self-employment income.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Self-employment income. 1.1402(b)-1 Section 1... (CONTINUED) INCOME TAXES Tax on Self-Employment Income § 1.1402(b)-1 Self-employment income. (a) In general... this section, the term “self-employment income” means the net earnings from self-employment derived by...

Confidence in the use of information management and technology (IM and T) in radiography: Is age a barrier?

Energy Technology Data Exchange (ETDEWEB)

Rogers, Hywel, E-mail: rogershj1@cf.ac.u [Department of Radiography, School of Healthcare Studies, Cardiff University, Heath Park, Cardiff, CF14 4XN (United Kingdom); Pratt, Shaaron; Brown, Paul; Gambling, Tina [Department of Radiography, School of Healthcare Studies, Cardiff University, Heath Park, Cardiff, CF14 4XN (United Kingdom)

2010-08-15

Introduction: Age has been reported as a barrier to the use of Information Management and Technology (IM and T). Radiographers' confidence and ability in IM and T may be related to age and it is the aim of this research to investigate this relationship. Method: An online survey method gathered views from the radiographic population, between 31st August 2008 and 10th October 2008. The questionnaire encompassed IM and T ability, work based IM and T usage, personal IM and T usage, security and governance issues, education and training experience, the future and demographic details. For the purpose of this paper the first three sections and demographic section were considered. Results: Radiographers showed a good level of ability and confidence in the use of IM and T. Some general applications such as word processing showed a decreased confidence with age. Confidence in all radiography specific applications was scored highly although confidence in the use of Hospital Information Systems (HIS) and radiotherapy Treatment Planning Systems (TPS) showed the least confidence. Statistical analysis did not reveal a strong link between age and confidence in all applications. Discussion: While a link between age and confidence was not found in this study, frequency of use and training in IM and T require further investigation in relation to specific roles.

Confidence in the use of information management and technology (IM and T) in radiography: Is age a barrier?

International Nuclear Information System (INIS)

Rogers, Hywel; Pratt, Shaaron; Brown, Paul; Gambling, Tina

2010-01-01

Introduction: Age has been reported as a barrier to the use of Information Management and Technology (IM and T). Radiographers' confidence and ability in IM and T may be related to age and it is the aim of this research to investigate this relationship. Method: An online survey method gathered views from the radiographic population, between 31st August 2008 and 10th October 2008. The questionnaire encompassed IM and T ability, work based IM and T usage, personal IM and T usage, security and governance issues, education and training experience, the future and demographic details. For the purpose of this paper the first three sections and demographic section were considered. Results: Radiographers showed a good level of ability and confidence in the use of IM and T. Some general applications such as word processing showed a decreased confidence with age. Confidence in all radiography specific applications was scored highly although confidence in the use of Hospital Information Systems (HIS) and radiotherapy Treatment Planning Systems (TPS) showed the least confidence. Statistical analysis did not reveal a strong link between age and confidence in all applications. Discussion: While a link between age and confidence was not found in this study, frequency of use and training in IM and T require further investigation in relation to specific roles.

Computer-Aided Teaching Using MATLAB/Simulink for Enhancing an IM Course With Laboratory Tests

Science.gov (United States)

Bentounsi, A.; Djeghloud, H.; Benalla, H.; Birem, T.; Amiar, H.

2011-01-01

This paper describes an automatic procedure using MATLAB software to plot the circle diagram for two induction motors (IMs), with wound and squirrel-cage rotors, from no-load and blocked-rotor tests. The advantage of this approach is that it avoids the need for a direct load test in predetermining the IM characteristics under reduced power.…

Stokes flow with slip and Kuwabara boundary conditions

Indian Academy of Sciences (India)

R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

∂r. ( r−2 ∂ψ1. ∂r. ) = [λ{2(−6B2a−3 + 4C2a2 + D2a−1). − m(m − 1)(2A2 − B2a−3 + 4C2a2 + D2a−1)}. − 2a(A2 + B2a−3 + 6C2a2)]I2Im, for r = a. (5.7). On the cell surface. (iii) The continuity of normal velocity. ∂ψ1. ∂θ. = [(2A2b2 − B2b−1 + 4C2b4 + D2b + 2Ub2). × (I2Im + I1Im)]sin θ, for r = b. (5.8). (iv) Vanishing of vorticity.

Architektur für ein System zur Dokumentanalyse im Unternehmenskontext - Integration von Datenbeständen, Aufbau- und Ablauforganisation

OpenAIRE

Baumann, Stephan; Lichter, Jürgen; Malburg, Michael; Maus, Heiko; Meyer auf´m Hofe, Harald; Wenzel, Claudia

1998-01-01

Workflowmanagementsysteme werden im Bürobereich verstärkt zur effizienten Geschäftsprozeßabwicklung eingesetzt. Das bereits Mitte der 70er Jahre propagierte papierlose Büro bleibt jedoch gegenwärtig immer noch Utopie. Dieser Widerspruch liegt darin begründet, daß die Handhabung von papierintensiven Vorgängen in hohem Maße abhängig ist von einer Identifkation und Aufbereitung der in den Dokumenten enthaltenen Informationen. Allerdings müssen solche Daten z.B. bei eingehender Post immer noch v...

Reconstrucción Tridimensional de Imágenes Ecocardiográficas

Directory of Open Access Journals (Sweden)

Jan Ramírez

2001-04-01

Full Text Available

Las imágenes ecocardiográficas convencionales permiten la evaluación
anatómica y funcional del corazón; por ser bidimensionales son difíciles de interpretar sin un entrenamiento adecuado; los últimos desarrollos han estado orientados a la reconstrucción del corazón en 3 y 4 dimensiones directamente en el equipo de ultrasonido o usando programas especializados. El objetivo es un software en MATLAB™ para la reconstrucción 3D y 4D de imágenes ecocardiográficas.

Protein tyrosine phosphatase 1B (PTP1B) is required for cardiac lineage differentiation of mouse embryonic stem cells.

Science.gov (United States)

Eshkiki, Zahra Shokati; Ghahremani, Mohammad Hossein; Shabani, Parisa; Firuzjaee, Sattar Gorgani; Sadeghi, Asie; Ghanbarian, Hossein; Meshkani, Reza

2017-01-01

Protein tyrosine phosphatase 1B (PTP1B) has been shown to regulate multiple cellular events such as differentiation, cell growth, and proliferation; however, the role of PTP1B in differentiation of embryonic stem (ES) cells into cardiomyocytes remains unexplored. In the present study, we investigated the effects of PTP1B inhibition on differentiation of ES cells into cardiomyocytes. PTP1B mRNA and protein levels were increased during the differentiation of ES cells into cardiomyocytes. Accordingly, a stable ES cell line expressing PTP1B shRNA was established. In vitro, the number and size of spontaneously beating embryoid bodies were significantly decreased in PTP1B-knockdown cells, compared with the control cells. Decreased expression of cardiac-specific markers Nkx2-5, MHC-α, cTnT, and CX43, as assessed by real-time PCR analysis, was further confirmed by immunocytochemistry of the markers. The results also showed that PTP1B inhibition induced apoptosis in both differentiated and undifferentiated ES cells, as presented by increasing the level of cleaved caspase-3, cytochrome C, and cleaved PARP. Further analyses revealed that PTP1B inhibition did not change proliferation and pluripotency of undifferentiated ES cells. Taken together, the data presented here suggest that PTP1B is essential for proper differentiation of ES cells into cardiomyocytes.

A P387L variant in protein tyrosine phosphatase-1B (PTP-1B) is associated with type 2 diabetes and impaired serine phosphorylation of PTP-1B in vitro

DEFF Research Database (Denmark)

Echwald, Søren M; Riis, Helle Bach; Vestergaard, Henrik

2002-01-01

In the present study, we tested the hypothesis that variability in the protein tyrosine phosphatase-1B (PTP-1B) gene is associated with type 2 diabetes. Using single-strand conformational polymorphism analysis, we examined cDNA of PTP-1B from 56 insulin-resistant patients with type 2 diabetes.......0012). In summary, a rare P387L variant of the PTP-1B gene is associated with a 3.7 (CI 1.26-10.93, P = 0.02) genotype relative risk of type 2 diabetes in the examined population of Danish Caucasian subjects and results in impaired in vitro serine phosphorylation of the PTP-1B peptide....

Aktuelle Tendenzen im computerunterstützten (Fach- Fremdsprachenunterricht

Directory of Open Access Journals (Sweden)

Pawel Szerszeń

2015-03-01

Full Text Available Die heutigen Entwicklungen im Bereich der Kommunikations-und Informationstechnologien tragen u.a. dazu bei,dass wir immer wieder mit neuen E-Learning-Angeboten im (Fach-Fremdsprachenunterricht konfrontiert werden. Diese Tatsa-che stellt u.a. die FremdsprachendidaktikerInnen vor neue Herausforderungen, für die eine kritische Reflexion über die didakti-sche Effizienz von E-Learning-Produkten Vorrang hat. Für eine solche didaktische Reflexion muss jedoch zunächst geklärt wer-den, welche Haupttypen von E-Learning-Produkten bestehen. Das Hauptziel des vorliegenden Beitrags ist somit der Versuch, diezurzeit bestehenden Haupttypen zu erfassen, zu kategorisieren sowie mit einigen Beispielen zu veranschaulichen wie auch aufinteressante Features ausgewählter Lernplattformen/Lernprogramme und auf einige neue E-Learning-Tendenzen hinzuweisen.Dieser Überblick stellt eine nötige und geeignete Grundlage für eine zukünftig mögliche Effizienzreflexion und-diskussion vordem Hintergrund möglicher Produktvergleiche dar

International Conference on Informatics and Management Science (IMS)

CERN Document Server

Informatics and Management Science III

2013-01-01

The International Conference on Informatics and Management Science (IMS) 2012 will be held on November 16-19, 2012, in Chongqing, China, which is organized by Chongqing Normal University, Chongqing University, Shanghai Jiao Tong University, Nanyang Technological University, University of Michigan, Chongqing University of Arts and Sciences, and sponsored by National Natural Science Foundation of China (NSFC). The objective of IMS 2012 is to facilitate an exchange of information on best practices for the latest research advances in a range of areas. Informatics and Management Science contains over 600 contributions to suggest and inspire solutions and methods drawing from multiple disciplines including: ·         Computer Science ·         Communications and Electrical Engineering ·         Management Science ·         Service Science ·         Business Intelligence

Surface characterization of IM7/5260 composites by x-ray photoelectron spectroscopy

International Nuclear Information System (INIS)

Ohno, Satomi; Lee, Moon-Hwan; Lin, Kuen Y.; Ohuchi, Fumio S.

2001-01-01

Surfaces of high-performance carbon fiber/bismeleimide (BMI) composites (IM7/5260) have been characterized by x-ray photoelectron spectroscopy. An experimental technique to separately examine the chemical natures of the carbon fibers and BMI resin in the composite form was developed. This technique uses a flood gun to establish differential charging conditions on the BMI resin. The binding energies from the BMI resin were shifted by an amount of voltage applied to the flood gun, whereas those from the carbon fibers were uniquely determined due to their electrically conducting nature. By adding external bias voltage to the sample, the binding energies for conducting fibers were further shifted from those of the BMI resin, thereby separating the IM7 phase completely from the BMI phase in the binding energy scale, allowing independent measurement of the chemical changes associated with those peaks. Using this technique, the effects of thermal aging and surface plasma treatment on the IM7/5260 composite were studied

Effects of oral administration of aflatoxin B1 and fumonisin B1 in rabbits (Oryctolagus cuniculus).

Science.gov (United States)

Orsi, R B; Oliveira, C A F; Dilkin, P; Xavier, J G; Direito, G M; Corrêa, B

2007-12-15

The effects of prolonged oral administration (21 days) of fumonisin B(1) (FB(1)) and aflatoxin B(1) (AFB(1)) were studied in male New Zealand rabbits by clinical, pathological, biochemical and sphingolipid analyses. Twenty-four animals were randomly divided into the following four experimental groups: (A) 0 mg FB(1)+0 microg AFB(1)/(kg body weight(bw)day) (control); (B) 0 mg FB(1)+30 microg AFB(1)/(kg bw day); (C) 1.5 mg FB(1)/(kg bw day)+30 microg AFB(1)/(kg bw day); (D) 1.5 mg FB(1)/(kg bw day)+0 microg AFB(1). Animals from group B and principally from group C presented clinical signs of intoxication. Rabbits from group C presented a lower body weight gain than controls. Differences were observed between intoxicated rabbits and controls with respect to absolute and relative liver and kidney weight, hepatic function, serum urea and creatinine levels and Sa/So ratio. The most frequent hepatic and renal injuries were vacuolar degeneration of the liver and kidney as shown by the histopathological and serum biochemical results. Combined administration of AFB(1) and FB(1) resulted in synergistic toxic effects both in the liver and in the kidney, but hepatic injuries were more marked.

Mluvené slovo J. V. Šimáka

Czech Academy of Sciences Publication Activity Database

Kábová, Hana

2011-01-01

Roč. 28, č. 0 (2011), s. 63-74 ISSN 1211-8184 Institutional support: RVO:67985921 Keywords : Šimák, Josef Vítězslav * Czech historiography * popularisation of scientific knowledge Subject RIV: AB - History

Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a ...

Indian Academy of Sciences (India)

RESEARCH ARTICLE. Deletion of SNURF/SNRPN U1B and U1B* upstream exons in a child ... whereby genes are expressed in a parent-of-origin dependent manner. One of the ... lity, neurodevelopmental delay, features of attention deficit hyperactivity .... Received 16 December 2015; accepted 8 January 2016. Unedited ...

Measurement of the mass splittings between the b{bar b}{chi}{sub b,J}(1P) states

Energy Technology Data Exchange (ETDEWEB)

Edwards, K.W.; Edwards, K.W. [Institute of Particle Physics (Canada); Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M. [Institute of Particle Physics (Canada); Sadoff, A.J. [Ithaca College, Ithaca, New York,14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L. [University of Kansas, Lawrence, Kansas, 66045 (United States); Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A. [University of Minnesota, Minneapolis, Minnesota, 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York, 12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio, 43210 (United States); Richichi, S.J.; Severini, H.; Skubic, P. [University of Oklahoma, Norman, Oklahoma, 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana, 47907 (United States); Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York, 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California, 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas, 75275 (United States); Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; and others

1999-02-01

We present new measurements of photon energies and branching fractions for the radiative transitions {Upsilon}(2S){r_arrow}{gamma}{chi}{sub b(J=0,1,2)}(1P). The masses of the {chi}{sub b} states are determined from the measured radiative photon energies. The ratio of mass splittings between the {chi}{sub b} substates, r{equivalent_to}(M{sub J=2}{minus}M{sub J=1})/(M{sub J=1}{minus}M{sub J=0}), with M the {chi}{sub b} mass, provides information on the nature of the b{bar b} confining potential. We find r(1P)=0.542{plus_minus}0.022{plus_minus}0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P){lt}r(2P); i.e., that this mass splitting ratio is smaller for the {chi}{sub b}(1P) states than for the {chi}{sub b}(2P) states. {copyright} {ital 1999} {ital The American Physical Society}

Post‐Secondary Students Prefer IM to E‐mail for Personal and Social Communication. A review of: Lancaster, Sean, David C. Yen, Albert H. Huang, and Shin‐Yuan Hung. “The Selection of Instant Messaging or E‐mail: College Students’ Perspective for Computer Communication.” Information Management & Computer Security 15.1 (2007: 5‐22.

Directory of Open Access Journals (Sweden)

Virginia Wilson

2008-03-01

Full Text Available Objective – This study investigates college students’ perceptions of instant messaging (IM and e‐mail for conveying emotions, aiding in relationship building, ease of use, and reliability.Design – A survey consisting of 59 questions was administered to 1,000 college students, resulting in 545 usable responses.Setting – The research took place at a midwestern university in the United States.Subjects – 1,000 Management Information Systems (MIS college students.Methods – A 59‐question survey was distributed to 1,000 MIS students during the 2005 academic year. 545 usable responses were returned. Participation was voluntary. During the pre‐phase of the research, four categories were determined: emotion, relationship, usage, and reliability. Questions were then written for a pilot study using Likert scaling. The post‐research phase involved evaluating the questions linguistically to ensure proper word usage, comprehension, and lack of bias. Main Results – The questions in the section on conveying emotion dealt with how well the two technologies (e‐mail and IM communicated feelings and emotions. While both technologies were acknowledged as being able to communicate more than merely text, IM was clearly preferred for expressing emotion. Fifty‐two percent of the respondents strongly agreed or agreed that they used emoticons (originally symbols created with letters and special characters; later evolving into graphical images produced and made available by IM companies to express emotion in IM, while fewer than 11% agreed or strongly agreed that they did so in e‐mail. More than 70% of the respondents strongly agreed or agreed that their friends used emoticons in IM,while fewer than 14% strongly agreed or agreed that their friends used emoticons in e‐mails. More than 75% of respondents agreed that it is easier to convey emotions in IM than via e‐mail. Analysis on the questions that dealt with the technologies as useful

Processing TES Level-1B Data

Science.gov (United States)

DeBaca, Richard C.; Sarkissian, Edwin; Madatyan, Mariyetta; Shepard, Douglas; Gluck, Scott; Apolinski, Mark; McDuffie, James; Tremblay, Dennis

2006-01-01

TES L1B Subsystem is a computer program that performs several functions for the Tropospheric Emission Spectrometer (TES). The term "L1B" (an abbreviation of "level 1B"), refers to data, specific to the TES, on radiometric calibrated spectral radiances and their corresponding noise equivalent spectral radiances (NESRs), plus ancillary geolocation, quality, and engineering data. The functions performed by TES L1B Subsystem include shear analysis, monitoring of signal levels, detection of ice build-up, and phase correction and radiometric and spectral calibration of TES target data. Also, the program computes NESRs for target spectra, writes scientific TES level-1B data to hierarchical- data-format (HDF) files for public distribution, computes brightness temperatures, and quantifies interpixel signal variability for the purpose of first-order cloud and heterogeneous land screening by the level-2 software summarized in the immediately following article. This program uses an in-house-developed algorithm, called "NUSRT," to correct instrument line-shape factors.

Safety and reliability of a multiphase pump system (MPA). Phase 1b; Sicherheit und Zuverlaessigkeit eines Mehrphasen-Pumpen Systems (MPA). Phase 1b

Energy Technology Data Exchange (ETDEWEB)

Wuersig, G.; Woehren, N.

2001-07-01

dreidimensionalen Finite Elemente Rechnungen. (b) Vorversuche an einer Versuchspumpe bei JHB als Teil der Definition des Messwerterfassungssystems (Abschnitt 7). (c) Systematische Analyse der moeglichen Fehlerzustaende (Abschnitt 8.1) zur Definition sicherheitsrelevanter Fehlerzustaende und zur technischen Beurteilung des Systems. (d) Untersuchungen zur Fluiddynamik (Abschnitt 8.2) als Basis fuer die geplante Entwicklung des als Teil der Zustandsueberwachung geplanten Simulationsmodells. Das Vorhaben wurde erfolgreich abgeschlossen und bildet die technisch wissenschaftliche Grundlage der z.Z. im Folgevorhaben MTK-0623 laufenden Arbeiten. (orig.)

Un marco teórico variacional para la corrección perceptual del color en imágenes digitales

OpenAIRE

Provenzi, Edoardo; Bertalmío Barate, Marcelo; Caselles Costa, Vicent

2010-01-01

Las técnicas variacionales constituyen una herramienta muy útil para entender las características de las imágenes y crear algoritmos nuevos y eficientes. Recientemente, se ha propuesto un marco teórico variacional que incorpora las características básicas de la visión humana y que puede abarcar varios modelos conocidos en la literatura. Aquí discutimos los aspectos más relevantes de este marco teórico y presentamos unos ejemplos notables.

CopperCore, an Open Source IMS Learning Design Engine

NARCIS (Netherlands)

Vogten, Hubert

2004-01-01

The presentation gives an overview of the approach of the development programme of the OTEC department towards the development of Open Source. The CopperCore IMS Learning Design engine is described as an example of this approach.

Wind tunnel tests of Risø-B1-18 and Risø-B1-24

DEFF Research Database (Denmark)

Fuglsang, P.; Bak, Christian; Gaunaa, Mac

2003-01-01

This report contains 2D measurements of the Risø-B1-18 and Risø-B1-24 airfoils. The aerodynamic properties were derived from pressure measurements on the airfoil surface and in the wake. The measurements were conducted in the VELUX open jet wind tunnel,which has a background turbulence intensity...

Cyclophilin B enhances HIV-1 infection

Energy Technology Data Exchange (ETDEWEB)

DeBoer, Jason; Madson, Christian J. [Department of Medical Microbiology and Immunology, Creighton University, Omaha, NE (United States); Belshan, Michael, E-mail: michaelbelshan@creighton.edu [Department of Medical Microbiology and Immunology, Creighton University, Omaha, NE (United States); The Nebraska Center for Virology, University of Nebraska, Lincoln, NE (United States)

2016-02-15

Cyclophilin B (CypB) is a member of the immunophilin family and intracellular chaperone. It predominantly localizes to the ER, but also contains a nuclear localization signal and is secreted from cells. CypB has been shown to interact with the Gag protein of human immunodeficiency type 1 (HIV-1). Several proteomic and genetic studies identified it as a potential factor involved in HIV replication. Herein, we show that over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA. This enhancement was unaffected by cyclosporine treatment and requires the N-terminus of the protein. The N-terminus contains an ER leader sequence, putative nuclear localization signal, and is required for secretion. Deletion of the N-terminus resulted in mislocalization from the ER and suppression of HIV infection. Passive transfer experiments showed that secreted CypB did not impact HIV infection. Combined, these experiments show that intracellular CypB modulates a pathway of HIV nuclear import. - Highlights: • CypB has been identified in several proteomic studies of HIV-1 infection. • CypB expression is upregulated in activated and infected T-cells. • Over-expression of CypB enhances HIV nuclear import and infection. • The N-terminus of CypB is necessary for these effects.

Cyclophilin B enhances HIV-1 infection

International Nuclear Information System (INIS)

DeBoer, Jason; Madson, Christian J.; Belshan, Michael

2016-01-01

Cyclophilin B (CypB) is a member of the immunophilin family and intracellular chaperone. It predominantly localizes to the ER, but also contains a nuclear localization signal and is secreted from cells. CypB has been shown to interact with the Gag protein of human immunodeficiency type 1 (HIV-1). Several proteomic and genetic studies identified it as a potential factor involved in HIV replication. Herein, we show that over-expression of CypB enhances HIV infection by increasing nuclear import of viral DNA. This enhancement was unaffected by cyclosporine treatment and requires the N-terminus of the protein. The N-terminus contains an ER leader sequence, putative nuclear localization signal, and is required for secretion. Deletion of the N-terminus resulted in mislocalization from the ER and suppression of HIV infection. Passive transfer experiments showed that secreted CypB did not impact HIV infection. Combined, these experiments show that intracellular CypB modulates a pathway of HIV nuclear import. - Highlights: • CypB has been identified in several proteomic studies of HIV-1 infection. • CypB expression is upregulated in activated and infected T-cells. • Over-expression of CypB enhances HIV nuclear import and infection. • The N-terminus of CypB is necessary for these effects.

VLBI FOR GRAVITY PROBE B. IV. A NEW ASTROMETRIC ANALYSIS TECHNIQUE AND A COMPARISON WITH RESULTS FROM OTHER TECHNIQUES

International Nuclear Information System (INIS)

Lebach, D. E.; Ratner, M. I.; Shapiro, I. I.; Bartel, N.; Bietenholz, M. F.; Lederman, J. I.; Ransom, R. R.; Campbell, R. M.; Gordon, D.; Lestrade, J.-F.

2012-01-01

When very long baseline interferometry (VLBI) observations are used to determine the position or motion of a radio source relative to reference sources nearby on the sky, the astrometric information is usually obtained via (1) phase-referenced maps or (2) parametric model fits to measured fringe phases or multiband delays. In this paper, we describe a 'merged' analysis technique which combines some of the most important advantages of these other two approaches. In particular, our merged technique combines the superior model-correction capabilities of parametric model fits with the ability of phase-referenced maps to yield astrometric measurements of sources that are too weak to be used in parametric model fits. We compare the results from this merged technique with the results from phase-referenced maps and from parametric model fits in the analysis of astrometric VLBI observations of the radio-bright star IM Pegasi (HR 8703) and the radio source B2252+172 nearby on the sky. In these studies we use central-core components of radio sources 3C 454.3 and B2250+194 as our positional references. We obtain astrometric results for IM Peg with our merged technique even when the source is too weak to be used in parametric model fits, and we find that our merged technique yields astrometric results superior to the phase-referenced mapping technique. We used our merged technique to estimate the proper motion and other astrometric parameters of IM Peg in support of the NASA/Stanford Gravity Probe B mission.

Design of data transportation based on dual-port RAM in IMS system

International Nuclear Information System (INIS)

Zhang Guohui; Li Yongping

2010-01-01

Ion mobility spectroscopy (IMS) is a rugged, portable, sensitive, low cost, field instrumental technique capable of trace organic detection and monitoring for environmental pollutants, pesticides, explosives, narcotics, and other analytes, hence it is of great significance to social security and stability. High rate data transmission mechanism between DSP processor and ARM core is required in the electronic system of IMS. After careful comparison of UART and dual port RAM, a new design based on dual port RAM that can be applied to other similar systems. (authors)

RSCAT_LEVEL_2B_OWV_COMP_12_V1.1:1

Data.gov (United States)

National Aeronautics and Space Administration — This dataset contains the RapidScat Level 2B 12.5km Version 1.1 science-quality ocean surface wind vectors. The Level 2B wind vectors are binned on a 12.5 km Wind...

I'm Positive: Growing Up with Self-Esteem.

Science.gov (United States)

Kansas State Univ., Manhattan. Cooperative Extension Service.

This document presents "I'm Positive: Growing Up With Self-Esteem," an informal, personal study course designed to strengthen the reader's ability to nurture self-esteem in children from birth through adolescence. Special emphasis is given to four parenting skills: acceptance, encouragement, empowerment, and love. Weekly activities are provided…

Study in environmental medicine in the areas of Bitterfeld and Hettstedt and a comparison area, 1995 - 1996. Data Book; Umweltmedizinische Untersuchungen im Raum Bitterfeld, im Raum Hettstedt und einem Vergleichsgebiet 1995-1996. Data Book

Energy Technology Data Exchange (ETDEWEB)

Heinrich, J.; Jacob, B.; Hoelscher, B.; Wilde, B.; Wolff, H.; Wjst, M.; Cyrys, J.; Wichmann, H.E. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Epidemiologie

1998-10-01

were determined and heavy-metal analyses carried out. Complete blood tests were done for lead, cadmium and mercury; urine tests were done for arsenic, cadmium and mercury. (orig.) [Deutsch] Die Umweltsituation im industriellen Ballungsgebiet Bitterfeld/Wolfen war in der Vergangenheit durch eine ausserordentlich hohe Belastung der Luft, u.a. mit Staeuben, Schwefeldioxid, Stickoxiden und chlorierten Kohlenwasserstoffen, der Gewaesser und des Bodens gekennzeichnet. Dagegen spielte im Raum Hettstedt die Schwermetallbelastung durch jahrzehntelangen Bergbau und die Emissionen der buntmetallurgischen Industriebetriebe die Hauptrolle. Ziel der vom Umweltbundesamt gefoerderten umweltepidemiologischen Studie ist es, moegliche gesundheitliche Beeintraechtigungen der Bevoelkerung in diesen zwei Belastungsgebieten im Vergleich zu dem wenig belasteten Kontrollterritorium Zerbst zu ermitteln. Diese sollen vor dem Hintergrund der Langzeitwirkung einer hohen Luftbelastung in den Regionen Bitterfeld und Hettstedt quantifiziert werden. Darueber hinaus werden die zeitlichen Veraenderungen der Gesundheitsparameter begleitend zu den laufenden Sanierungsmassnahmen ueber einen Zeitraum von 6 Jahren erfasst, um die Sanierung an den gesundheitlichen Gegebenheiten ausrichten zu koennen. Die Untersuchungen 1995/96 erfolgten wie auch beim 1. Survey im Jahre 1992/93 durch Aerzte und Schwestern in Schulen, Kindergaerten, Gesundheitsaemtern sowie teilweise in einem mit Lungenfunktionsgeraeten ausgestatteten Untersuchungsbus. In allen drei Orten wurde nach den gleichen standardisierten Vorschriften verfahren, wobei die gleichen Geraete und die gleichen Untersucher im Einsatz waren. Durch Befragung der Eltern der Kinder wurden Informationen erhoben zu Erkrankungen und Symptomen, insbesondere zu Atemwegserkrankungen und Allergien, sowie zu soziodemographischen Charakteristika und Merkmalen der haeuslichen Umgebung, welche die interessierenden Zielgroessen mitbeeinflussen koennen. Es wurde die

Method for Estimating Evaporative Potential (IM/CLO) from ASTM Standard Single Wind Velocity Measures

Science.gov (United States)

2016-08-10

IM/CLO) FROM ASTM STANDARD SINGLE WIND VELOCITY MEASURES DISCLAIMER The opinions or assertions contained herein are the private views of the...USARIEM TECHNICAL REPORT T16-14 METHOD FOR ESTIMATING EVAPORATIVE POTENTIAL (IM/CLO) FROM ASTM STANDARD SINGLE WIND VELOCITY... ASTM STANDARD SINGLE WIND VELOCITY MEASURES Adam W. Potter Biophysics and Biomedical Modeling Division U.S. Army Research Institute of Environmental

Die Freunde im und die Freude am Fernsehen

Directory of Open Access Journals (Sweden)

Amina Ovcina Cajacob

2012-09-01

Full Text Available Das Ziel der vorliegenden Arbeit besteht darin, die Wirkungen von Popstars und Popbands auf Jugendliche (13- bis 17-Jährige zu erforschen. Im Mittelpunkt der Interessen steht die Frage, welche Wirkungen aus der Rezeption von Musiksendungen (bzw. Videoclips von Musiksendern entstehen und welche Charakteristika innerhalb der aufgebauten Beziehungen zu den Stars bemerkbar sind. Andererseits wurden die Unterschiede und Parallelen zwischen parasozialen Beziehungen zu den Stars und orthosozialen Beziehungen aufgezeigt. Im Zusammenhang mit der empirischen Untersuchung bezieht sich die Autorin auf den Uses-and-Gratifications-Approach, wobei die bedürfnissbefriedigenden Wirkungen von Musikkanälen und den dazu gehörigen Popstars im Mittelpunkt stehen. Mit Hilfe des Uses-and-Gratifications-Approach wird angenommen, dass das Konsumieren der Musiksendungen und der Musikstars von den Jugendlichen gezielt zur Befriedigung bestimmter Bedürfnisse eingesetzt wird.The objective of this study is to explore the effects of pop stars on adolescents (aged between 13 and 17. The focus of interest is the question what effect music channels (i.e. video clips from music channels produce and what characteristics are noticeable from the formed relationship between adolescents and pop stars. On the other side, parallels and differences have been drawn between the para-social relationships to pop stars and ortho-social relationships. In connection with empirical study, the author also refers to Uses-and Gratification-Approach where the need satisfying effects of music channels and pop stars are in focus. With the help of Uses-and Gratification-Approach it will be assumed, that aim of watching music channels and therefore pop stars will be pointed toward the gratification of specific needs.

Das Problem der Ethnogenese im antiken Griechenland

Directory of Open Access Journals (Sweden)

Welwei Karl-Wilhelm

2011-01-01

Full Text Available Sprachwissenschaftliche Untersuchungen lassen darauf schließen, dass die historischen Dialekte der alten Hellenen erst auf griechischem Boden um und nach 1000 v. Chr. entstanden sind. Bei den frühen Zuwanderern kann es sich nur um kleinere Verbände gehandelt haben, so daß zweifelllos keine großen „Stämme“ nach Griechenland vorgedrungen sind, wie man in der älteren Forschung angenommen hat. In Griechenland haben die Zuwanderer die Suffixe -ss und -nth oder -nd nicht erst kennengelernt, sondern zumindest zum Teil schon mitgebracht und vermutlich im 3. Jahrtausend v. Chr. die allmähliche Entwicklung des späteren Griechischen eingeleitet. Impulse für die Entwicklung der materiellen Kultur gingen um 1700 v. Chr. von Kreta aus und beeinflussten in starkem Maße die mykenische Zeit mit ihren Palastsystemen, deren Zusammenbruch um 1200 v. Chr. aber nicht schon zum Ende der mykenischen Kultur führte, wenn auch die Linear B-Schrift nicht mehr benutzt wurde und die Infrastrukturen der Machtzentren zusammenbrachen. Dies war zugleich die Voraussetzung für die Bildung kleinerer Siedlungen mit neuen Führungssystemen und Sozialstrukturen sowie mit einem jeweils eigenen Identitätsbewußtsein.

The Question of Descriptors for Academic Writing in European Language Framework: a Critical View. Der Fertigkeitsbereich „Wissenschaftliches Schreiben“ im Gemeinsamen Europäischen Referenzrahmen: einekritische Beurteilung

Directory of Open Access Journals (Sweden)

JoAnne Neff

2008-01-01

Full Text Available Ziel dieses Beitrags ist es, einen Bereich zu analysieren, der im europäischen Referenzrahmen nicht ausreichend definiert, jedoch von zentraler Bedeutung für das berufliche Lernen unserer Studenten ist: der des wissenschaftlichen Schreibens. Die Professoren und Dozenten unserer Forschungsgrup­pe, die auf diesem Gebiet vor allem in der englischen Fremdsprache tätig ist, halten es für notwen­dig, den Lernenden klare Anweisungen zu strukturellen und rhetorischen Elementen vorzugeben. Innerhalb der 24 Wochen, die unser Kurs zum wissenschaftlichen Lesen und Schreiben dauert, ist es schwierig, die Kompetenz der Studenten in der englischen Sprache an sich wesentlich zu ver­bessern, aber, und das zeigen unsere Ergebnisse, können auch Studierende auf der B1.1-Stufe des Oxford Placement Tests (Ergebnis 32/100 von den klaren Anweisungen zum Schreiben profitieren. Das Ergebnis ihrer Leistungen insgesamt verbessert sich bis zum Ende des Kurses erheblich und scheint sich dem B2.1-Niveau anzunähern.

77 FR 3284 - Comment Request for Information Collection for the H-1B Technical Skills Training (H-1B) and the...

Science.gov (United States)

2012-01-23

... concerning the collection of data about H-1B Technical Skills Training (H-1B) [SGA/DFA PY-10-13] and H-1B... DEPARTMENT OF LABOR Comment Request for Information Collection for the H-1B Technical Skills Training (H-1B) and the H-1B Jobs and Innovation Accelerator Challenge (JIAC) Grant Programs, New...

26 CFR 31.3306(b)-1 - Wages.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Wages. 31.3306(b)-1 Section 31.3306(b)-1... Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3306(b)-1 Wages. (a) Applicable law and... after 1938 constitutes wages is determined under section 3306(b). Accordingly, only remuneration paid...

New 5-deoxyflavonoids and their inhibitory effects on protein tyrosine phosphatase 1B (PTP1B) activity

DEFF Research Database (Denmark)

Nguyen, Phi Hung; Dao, Trong Tuan; Kim, Jayeon

2011-01-01

.9 ± 1.6 to 19.2 ± 1.1 μM), while compounds (3, 5, and 9) with 2,2-dimethylpyrano ring showed less inhibitory effect (IC₅₀ 22.6 ± 2.3 to 72.9 ± 9.7 μM). These results suggest that prenyl and methoxy groups may be responsible for the increase on the activity of 5-deoxyflavonoids against PTP1B......, but the presence of 2,2-dimethylpyrano ring on the B ring may be induced the decrease of PTP1B inhibitory activity....

Bu-2470, a new peptide antibiotic complex. II. Structure determination of Bu-2470 A, B1, B2a and B2b.

Science.gov (United States)

Sugawara, K; Yonemoto, T; Konishi, M; Matsumoto, K; Miyaki, T; Kawaguchi, H

1983-06-01

The structures of Bu-2470 A, B1, B2a, and B2b have been determined. Bu-2470 A is a simple octapeptide having no fatty acid moiety, while Bu-2470 B1, B2a and B2b are octapeptides that have been acylated with a beta-hydroxy C11 or C10 fatty acid. The octapeptide structure of Bu-2470 components was found identical with that of octapeptin C1, hence generic names of octapeptin C0, C2, C3 and C4 are proposed for Bu-2470 A, B1, B2a and B2b, respectively.

Signal Processing for Indian and Pakistan Nuclear Tests Recorded at IMS Stations Located in Israel

Science.gov (United States)

Gitterman, Y.; Pinsky, V.; Hofstetter, R.

expected signal time interval, but yet was low for a reliable decision.After an NT is detected it should be recognized. Spectra were calculated in a 15-sec window including P and P-coda waves. The spectra for the first Pakistan NT showed a pronounced spectral null at 1.7Hz for all three components of the EIL station. The effect was confirmed by observation of the same spectral null at the vertical component of the ISN stations. For this ground-truth explosion with a reported shallow source depth, the phenomenon can be explained in terms of the interference of P and pP phases. However, the spectral null feature, considered separately, cannot serve as a reliable identification characteristic of nuclear explosions, because not all the tests provide the nulls, whereas some earthquakes show this feature. Therefore, the multi-channel spectral discrimination analysis, based on a spectral ratio of low-to-high frequency energy (in the 0.6-1Hz and 1-3Hz bands), and a semblance of spectral curves (in the 0.6-2Hz band), was conducted. Both statistics were calculated for the vertical component of the ISN stations as well for the three components of the EIL station. The statistics provided a reliable discrimination between the recent NT and several nearby earthquakes, and showed compliance with the former analysis of Soviet and Chinese NT, where nuclear tests demonstrated lower values of energy ratio and spectral semblance than earthquakes. Accurate location of NT requires calibration of travel time for IMS stations. Using known source locations, IASPEI91 travel-time tables and NEIC origin times we calculated expected arrival time for the P waves to the EIL and MRNI stations and showed that the measured arrival time has a delay of about 4 sec. Similar results were obtained for the nearby Pakistan earthquakes. The analysis was complimented by the P travel-time measurements for the set of Semipalatinsk NT, which showed delays of about 3.7sec to the short-period MBH station which is a

Deletion of Protein Tyrosine Phosphatase 1B (PTP1B Enhances Endothelial Cyclooxygenase 2 Expression and Protects Mice from Type 1 Diabetes-Induced Endothelial Dysfunction.

Directory of Open Access Journals (Sweden)

David J Herren

Full Text Available Protein tyrosine phosphatase 1B (PTP1B dephosphorylates receptors tyrosine kinase and acts as a molecular brake on insulin signaling pathway. Conditions of metabolic dysfunction increase PTP1B, when deletion of PTP1B protects against metabolic disorders by increasing insulin signaling. Although vascular insulin signaling contributes to the control of glucose disposal, little is known regarding the direct role of PTP1B in the control of endothelial function. We hypothesized that metabolic dysfunctions increase PTP1B expression in endothelial cells and that PTP1B deletion prevents endothelial dysfunction in situation of diminished insulin secretion. Type I diabetes (T1DM was induced in wild-type (WT and PTP1B-deficient mice (KO with streptozotocin (STZ injection. After 28 days of T1DM, KO mice exhibited a similar reduction in body weight and plasma insulin levels and a comparable increase in glycemia (WT: 384 ± 20 vs. Ko: 432 ± 29 mg/dL, cholesterol and triglycerides, as WT mice. T1DM increased PTP1B expression and impaired endothelial NO-dependent relaxation, in mouse aorta. PTP1B deletion did not affect baseline endothelial function, but preserved endothelium-dependent relaxation, in T1DM mice. NO synthase inhibition with L-NAME abolished endothelial relaxation in control and T1DM WT mice, whereas L-NAME and the cyclooxygenases inhibitor indomethacin were required to abolish endothelium relaxation in T1DM KO mice. PTP1B deletion increased COX-2 expression and PGI2 levels, in mouse aorta and plasma respectively, in T1DM mice. In parallel, simulation of diabetic conditions increased PTP1B expression and knockdown of PTP1B increased COX-2 but not COX-1 expression, in primary human aortic endothelial cells. Taken together these data indicate that deletion of PTP1B protected endothelial function by compensating the reduction in NO bioavailability by increasing COX-2-mediated release of the vasodilator prostanoid PGI2, in T1DM mice.

Evaluation of a C57BL/6J × 129S1/SvImJ Hybrid Nestin-Thymidine Kinase Transgenic Mouse Model for Studying the Functional Significance of Exercise-Induced Adult Hippocampal Neurogenesis.

Science.gov (United States)

Hamilton, G F; Majdak, P; Miller, D S; Bucko, P J; Merritt, J R; Krebs, C P; Rhodes, J S

2015-01-01

New neurons are continuously generated in the adult hippocampus but their function remains a mystery. The nestin thymidine kinase (nestin-TK) transgenic method has been used for selective and conditional reduction of neurogenesis for the purpose of testing the functional significance of new neurons in learning, memory and motor performance. Here we explored the nestin-TK model on a hybrid genetic background (to increase heterozygosity, and "hybrid vigor"). Transgenic C57BL/6J (B6) were crossed with 129S1/SvImJ (129) producing hybrid offspring (F1) with the B6 half of the genome carrying a herpes simplex virus thymidine kinase (TK) transgene regulated by a modified nestin promoter. In the presence of exogenously administered valganciclovir, new neurons expressing TK undergo apoptosis. Female B6 nestin-TK mice ( n = 80) were evaluated for neurogenesis reduction as a positive control. Male and female F1 nestin-TK mice ( n = 223) were used to determine the impact of neurogenesis reduction on the Morris water maze (MWM) and rotarod. All mice received BrdU injections to label dividing cells and either valganciclovir or control chow, with or without a running wheel for 30 days. Both the F1 and B6 background displayed approximately 50% reduction in neurogenesis, a difference that did not impair learning and memory on the MWM or rotarod performance. Running enhanced neurogenesis and performance on the rotarod but not MWM suggesting the F1 background may not be suitable for studying pro-cognitive effects of exercise on MWM. Greater reduction of neurogenesis may be required to observe behavioral impacts. Alternatively, new neurons may not play a critical role in learning, or compensatory mechanisms in pre-existing neurons could have masked the deficits. Further work using these and other models for selectively reducing neurogenesis are needed to establish the functional significance of adult hippocampal neurogenesis in behavior.

Strukturwandel, Verbandsabstinenz, Tarifflucht : zur Lage der Unternehmen und Arbeitgeberverbände im ostdeutschen verarbeitenden Gewerbe

OpenAIRE

Ettl, Wilfried; Heikenroth, André

1996-01-01

"Im Kontext der am Start der ostdeutschen Transformation vorgenommenen wirtschaftspolitischen Richtungsentscheidungen erwies sich die flächentarifvertragliche Normierung von Arbeits- und Entlohnungsbedingungen für die Arbeitgeberverbände als organisationspolitisch dysfunktional, weil sie der Differenzierung betriebswirtschaftlicher Kostenbedingungen und Interessenlagen im rasanten Strukturwandel nicht gerecht werden konnte. Anhand der Ergebnisse einer Befragung ostdeutscher ...

Travestie im alten Ägypten

Directory of Open Access Journals (Sweden)

prof.Magda Abdalla

2011-01-01

Full Text Available Der Artikel möchte versuchen zu beweisen, dass den alten Ägyptern Travestie bekannt war. In verschiedenen Texten wie Märchen, Fabeln und Liebesgedichten auf Papyri und Ostraka, finden sich Belege von Travestie. Zuerst muss jedoch betont werden, dass es einen Unterschied zwischen dem Begriff der Travestie, mit anderen Worten der Verkleidung,[1] und dem der Metamorphose, dem Verwandeln der Gestalt,[2] gibt. [1] Tra.ve´stie: f. satirisch, Verspottung eines Literaturwerkes, bei der (im Unterschied zur Parodie der Inhalt beibehalten und die Form verändert wird (frz. travestie „Verkleidung“; zu lat. trans „hinüber“+vestire, „kleiden“. G. Wahrig,. Deutsches Wörterbuch, mit einem „Lexikon der deutschen Sprachlehre“( München, 1987, 1292. Es gibt auch eine moderne Definition des Begriffes Travestie aus dem 17. Jahrhundert. Hier beinhaltet diese ein Verfahren oder eine kritische Zielsetzung.w.Karrer.,Parodie Travestie, Pastiche (München, 1977, 19, 46. [2] Me.ta.mor´pho.se Umwandlung eines Gesteins in ein anderes; Wandlung des jungen Tieres durch verschiedene äußere Stadien; Verwandlung von Menschen in Tiere, Pflanzen, Quellen usw. (Deutsches Wörterbuch, 883. الإحصائيات

Capacity Bounds for the Gaussian IM-DD Optical Multiple-Access Channel

KAUST Repository

Chaaban, Anas; Al-Ebraheemy, Omer M. S.; Al-Naffouri, Tareq Y.; Alouini, Mohamed-Slim

2017-01-01

Optical wireless communications (OWC) is a promising technology for closing the mismatch between the growing number of connected devices and the limited wireless network capabilities. Similar to downlink, uplink can also benefit from OWC for establishing connectivity between such devices and an optical access point. In this context, the incoherent intensitymodulation and direct-detection (IM-DD) scheme is desirable in practice. Hence, it is important to understand the fundamental limits of communication rates over an OWC uplink employing IM-DD, i.e., the channel capacity. This uplink, modeled as a Gaussian multiple-access channel (MAC) for indoors OWC, is studied in this paper, under the IM-DD constraints which form the main difference with the standard Gaussian MAC commonly studied in the radio-frequency context. Capacity region outer and inner bounds for this channel are derived. The bounds are fairly close at high signal-to-noise ratio (SNR), where a truncated- Gaussian input distribution achieves the capacity region within a constant gap. Furthermore, the bounds coincide at low SNR showing the optimality of on-off keying combined with successive cancellation decoding in this regime. At moderate SNR, an optimized uniformly-spaced discrete input distribution achieves fairly good performance.

Capacity Bounds for the Gaussian IM-DD Optical Multiple-Access Channel

KAUST Repository

Chaaban, Anas

2017-03-18

Optical wireless communications (OWC) is a promising technology for closing the mismatch between the growing number of connected devices and the limited wireless network capabilities. Similar to downlink, uplink can also benefit from OWC for establishing connectivity between such devices and an optical access point. In this context, the incoherent intensitymodulation and direct-detection (IM-DD) scheme is desirable in practice. Hence, it is important to understand the fundamental limits of communication rates over an OWC uplink employing IM-DD, i.e., the channel capacity. This uplink, modeled as a Gaussian multiple-access channel (MAC) for indoors OWC, is studied in this paper, under the IM-DD constraints which form the main difference with the standard Gaussian MAC commonly studied in the radio-frequency context. Capacity region outer and inner bounds for this channel are derived. The bounds are fairly close at high signal-to-noise ratio (SNR), where a truncated- Gaussian input distribution achieves the capacity region within a constant gap. Furthermore, the bounds coincide at low SNR showing the optimality of on-off keying combined with successive cancellation decoding in this regime. At moderate SNR, an optimized uniformly-spaced discrete input distribution achieves fairly good performance.

CD31-Expression am Primärtumor und Nachweis hämatogen disseminierter Tumorzellen im Knochenmark von Brustkrebspatientinnen

OpenAIRE

Eisenmann, Petra

2005-01-01

Der Nachweis von disseminierten Tumorzellen im Knochenmark von Patientinnen mit primärem Mammakarzinom ist ein wichtiger prognostischer Parameter. In der vorliegenden Arbeit wurde der Nachweis von CD31 am Primärtumor Mammakarzinom mit dem Auftreten von Mikrometastasen im Knochenmark korreliert. Ferner wurde die prognostische Bedeutung von disseminierten Tumorzellen im Knochenmark und die prognostische Bedeutung von CD31 evaluiert. Bei 50 Patientinnen des Gesamtkollektivs von 195 (25,6%) wu...

Ion mobility spectrometry-mass spectrometry (IMS-MS) for on- and offline analysis of atmospheric gas and aerosol species

Science.gov (United States)

Krechmer, Jordan E.; Groessl, Michael; Zhang, Xuan; Junninen, Heikki; Massoli, Paola; Lambe, Andrew T.; Kimmel, Joel R.; Cubison, Michael J.; Graf, Stephan; Lin, Ying-Hsuan; Budisulistiorini, Sri H.; Zhang, Haofei; Surratt, Jason D.; Knochenmuss, Richard; Jayne, John T.; Worsnop, Douglas R.; Jimenez, Jose-Luis; Canagaratna, Manjula R.

2016-07-01

Measurement techniques that provide molecular-level information are needed to elucidate the multiphase processes that produce secondary organic aerosol (SOA) species in the atmosphere. Here we demonstrate the application of ion mobility spectrometry-mass spectrometry (IMS-MS) to the simultaneous characterization of the elemental composition and molecular structures of organic species in the gas and particulate phases. Molecular ions of gas-phase organic species are measured online with IMS-MS after ionization with a custom-built nitrate chemical ionization (CI) source. This CI-IMS-MS technique is used to obtain time-resolved measurements (5 min) of highly oxidized organic molecules during the 2013 Southern Oxidant and Aerosol Study (SOAS) ambient field campaign in the forested SE US. The ambient IMS-MS signals are consistent with laboratory IMS-MS spectra obtained from single-component carboxylic acids and multicomponent mixtures of isoprene and monoterpene oxidation products. Mass-mobility correlations in the 2-D IMS-MS space provide a means of identifying ions with similar molecular structures within complex mass spectra and are used to separate and identify monoterpene oxidation products in the ambient data that are produced from different chemical pathways. Water-soluble organic carbon (WSOC) constituents of fine aerosol particles that are not resolvable with standard analytical separation methods, such as liquid chromatography (LC), are shown to be separable with IMS-MS coupled to an electrospray ionization (ESI) source. The capability to use ion mobility to differentiate between isomers is demonstrated for organosulfates derived from the reactive uptake of isomers of isoprene epoxydiols (IEPOX) onto wet acidic sulfate aerosol. Controlled fragmentation of precursor ions by collisionally induced dissociation (CID) in the transfer region between the IMS and the MS is used to validate MS peak assignments, elucidate structures of oligomers, and confirm the

LytB1 and LytB2 of Mycobacterium tuberculosis Are Not Genetically Redundant.

Directory of Open Access Journals (Sweden)

Amanda Claire Brown

Full Text Available Mycobacterium tuberculosis synthesises isoprenoid precursors via the MEP/DOXP pathway and at least five enzymes in the pathway (Dxs1, Dxr/IspC, IspD, IspF, and GcpE/IspG are required for growth in vitro. We investigated the role of LytB (IspH in M. tuberculosis; M. tuberculosis is unusual in that it has two homologs-LytB1 and LytB2. We were unable to delete the lytB2 gene unless we provided an additional copy elsewhere, demonstrating that this is the essential homolog. We expressed lytB1 from the lytB2 promoter and confirmed that this could not complement for loss of function of lytB2, despite LytB1 possessing all the previously described conserved critical residues. Interestingly the sole LytB homolog of Mycobacterium smegmatis was able to compensate for loss of LytB2 in M. tuberculosis. We tested translational fusions of LytB1 and LytB2 for functionality in M. tuberculosis, but only a fusion with 90% N-terminal LytB2 and 10% C-terminal LytB1 was functional. In order to identify the key difference between the two proteins, site directed mutagenesis was used to change LytB2 residues into their counterparts in LytB1. None of these amino acid substitutions was essential for function and all lytB2 mutant alleles were functional. In contrast, mutation of the key residues for [Fe4S4] cluster formation, as well as a catalytic residue in LytB1 did not result in functional complementation. Thus, although LytB1 and LytB2 are not genetically redundant, this is not dependent on small amino acid changes, but is likely to be a result of major overall structural differences.

26 CFR 1.50B-4 - Partnerships.

Science.gov (United States)

2010-04-01

... § 1.50A-3, or if the partnership fails to pay comparable wages and such failure is subject to the... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Partnerships. 1.50B-4 Section 1.50B-4 Internal... Credit for Expenses of Work Incentive Programs § 1.50B-4 Partnerships. (a) General rule—(1) In general...

Detección de malas hierbas en girasol en fase temprana mediante imágenes tomadas con un vehículo aéreo no tripulado (UAV

Directory of Open Access Journals (Sweden)

J.M. Peña

2014-12-01

Full Text Available La discriminación de malas hierbas en fase temprana con técnicas de teledetección requiere imágenes remotas de muy elevada resolución espacial (píxeles <5 cm. Actualmente, sólo los vehículos aéreos no tripulados (UAV pueden generar este tipo de imágenes. El objetivo de este trabajo fue evaluar imágenes UAV tomadas con una cámara visible a diferentes alturas de vuelo (40, 60, 80 y 100 m y cuantificar la influencia de la resolución espacial en la discriminación de malas hierbas en fase temprana en un cultivo de girasol. Se aplicó un algoritmo de clasificación de imágenes basado en objetos, el cual se divide en dos fases principales: 1 detección de líneas de cultivo y 2 clasificación de cultivo, malas hierbas y suelo desnudo. El algoritmo resultó 100% eficaz en la detección de las líneas de cultivo en todos los casos (fase 1, así como en la detección de zonas libres de mala hierba en las imágenes tomadas a 40 y 60 m de altura. En las zonas con presencia de malas hierbas, los mejores resultados se obtuvieron en las imágenes tomadas a baja altura (40 m, con un 71% de marcos de muestreo clasificados correctamente (fase 2. La mayoría de los fallos de clasificación cometidos en todas las imágenes fueron falsos negativos, es decir, malas hierbas no detectadas debido a su pequeño tamaño en el momento de la captura de las imágenes. Por tanto, el siguiente paso sería desarrollar un estudio multitemporal para estudiar la detección de las malas hierbas en estados fenológicos más avanzados. Esto podría facilitar su discriminación en las imágenes y, por tanto, disminuir el porcentaje de falsos negativos en las clasificaciones.

26 CFR 1.167(b)-1 - Straight line method.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining a...

Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

Lifescience Database Archive (English)

Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

26 CFR 1.802(b)-1 - Tax on life insurance companies.

Science.gov (United States)

2010-04-01

.... For the definition of the term “1954 life insurance company taxable income”, see § 1.805-1. (b) The... 26 Internal Revenue 8 2010-04-01 2010-04-01 false Tax on life insurance companies. 1.802(b)-1...) INCOME TAX (CONTINUED) INCOME TAXES Life Insurance Companies § 1.802(b)-1 Tax on life insurance companies...

Dr Zita Virginija Šimėnaitė (1950–2016

Directory of Open Access Journals (Sweden)

Zofia Sawaniewska-Mochowa

2016-12-01

Full Text Available Dr. Zita Virginija Šimėnaitė (1950–2016 Dr. Zita Šimėnaitė passed away on the 1st of August, 2016. She was a researcher who made a great contribution to the still developing field of Lithuanian lexicography. Between 2005 and 2014, she conducted work of the Lexicographical Centre in the Institute of the Lithuanian Language in Vilnius. Her academic and intellectual life was devoted to her two great passions: collaborating with other linguists in creation of new scientific dictionaries of the Lithuanian language, and artistic photography. She made a valuable contribution to the great dictionary of the Lithuanian language (Lietuvių kalbos žodynas; LKŽ via enriching files, editing and developing numerous entries, as well as preparing an electronic version of the dictionary (www.lkz.lt. She co-authored the phraseological dictionary of the Lithuanian language (2002 and the dictionary for learners of the Lithuanian language (2000, second edition 2010. She conducted many projects in the field of monolingual and translational lexicography. She also popularized ideas and work of Lithuanian lexicographers during symposia and conferences in her home country and abroad. She actively participated in the scientific exchange and cooperation between the Institute of the Lithuanian Language and the Institute of Slavic Studies, Polish Academy of Sciences in Warsaw.   Dr Zita Virginija Šimėnaitė (1950–2016 Dnia 1 sierpnia 2016 r. zmarła dr Zita Šimėnaitė, badaczka mająca wielkie zasługi dla pomnażania dorobku leksykografii litewskiej. Od 2005 do 2014 r. kierowała pracami Centrum Leksykograficznego Instytutu Języka Litewskiego w Wilnie. Swoje życie poświęciła realizacji dwóch wielkich pasji: tworzeniu we współpracy z innymi lingwistami naukowych słowników języka litewskiego oraz fotografii artystycznej. Wniosła cenny wkład w uzupełnianie kartoteki, opracowanie licznych haseł i redagowanie wielkiego słownika języka litewskiego

Detection capability of the IMS seismic network based on ambient seismic noise measurements

Science.gov (United States)

Gaebler, Peter J.; Ceranna, Lars

2016-04-01

All nuclear explosions - on the Earth's surface, underground, underwater or in the atmosphere - are banned by the Comprehensive Nuclear-Test-Ban Treaty (CTBT). As part of this treaty, a verification regime was put into place to detect, locate and characterize nuclear explosion testings at any time, by anyone and everywhere on the Earth. The International Monitoring System (IMS) plays a key role in the verification regime of the CTBT. Out of the different monitoring techniques used in the IMS, the seismic waveform approach is the most effective technology for monitoring nuclear underground testing and to identify and characterize potential nuclear events. This study introduces a method of seismic threshold monitoring to assess an upper magnitude limit of a potential seismic event in a certain given geographical region. The method is based on ambient seismic background noise measurements at the individual IMS seismic stations as well as on global distance correction terms for body wave magnitudes, which are calculated using the seismic reflectivity method. From our investigations we conclude that a global detection threshold of around mb 4.0 can be achieved using only stations from the primary seismic network, a clear latitudinal dependence for the detection threshold can be observed between northern and southern hemisphere. Including the seismic stations being part of the auxiliary seismic IMS network results in a slight improvement of global detection capability. However, including wave arrivals from distances greater than 120 degrees, mainly PKP-wave arrivals, leads to a significant improvement in average global detection capability. In special this leads to an improvement of the detection threshold on the southern hemisphere. We further investigate the dependence of the detection capability on spatial (latitude and longitude) and temporal (time) parameters, as well as on parameters such as source type and percentage of operational IMS stations.

An Innovative Approach to the Integrated Management System Development: SIMPRO-IMS Web Based Environment

Directory of Open Access Journals (Sweden)

Kristina Zgodavova

2012-12-01

Full Text Available The purpose of this paper is to contribute to learning, knowledge creation and knowledge transfer for building organization innovability by integrating the management systems in the SIMPRO-IMS web based environment. The paper content consists of the interpretation of role-play simulation, role-play simulation process description, methodology, and the employment of role-play simulation outcomes, as well as the discussion of the knowledge thus obtained. Primary the model of the SIMPRO-Q education environment has been developed and tested during a period of 15 years in several industrial organizations as well as service organizations such as Higher Education Institution (HEI and Healthcare Organization (HCO. The newest version SIMPRO-IMS has recently been developed to support a need of integration of management systems and information archiving. With the last development, SIMPRO-IMS web based environment, processes of five ISO systems are integrated for parallel development, implementation, auditing, maintaining and leading. SIMPRO-IMS provides management with the apparatus necessary to realize a systematic and verifiable approach to the creation and control of IMS documentation. At the same time contributes to the preservation of organization memory in response to the growing challenges of globalization and digitalization. The research is limited by the complexity of a real system and possible empiric results verification. The results achieved are verified when people really overcome the resistance to change. This can be assessed thoughtfully only after some period of time. Another limitation is presented by measurability of real enhancement achieved in quality, safety and environmentality of production, and business continuity and social responsibility of an organization. Development and progress in the methodology of SIMPRO-IMS web based environment is encoded in upgrading the SIMPRO database by processes of the environmental management

Doing religion im Phowa-Kurs: Praxeologische und reflexionslogische Studien zum "bewussten Sterben" im Diamantweg-Buddhismus

Directory of Open Access Journals (Sweden)

Werner Vogd

2015-07-01

Full Text Available Im Sinne einer pragmatistischen Perspektive, wie sie zuerst John DEWEY (1987 [1934] in Anschluss an William JAMES formulierte, ist das Religiöse weniger als eine spezifische Art von experience zu verstehen, denn als ein adjustment hin zu einer epistemischen Perspektive, die alle Erfahrungen in einem veränderten Licht erscheinen lässt. Religiosität zielt damit auf ein besonderes Selbst- und Weltverhältnis, in dem die Beziehung zwischen Selbst und Welt aus einer ganzheitlichen Perspektive betrachtet wird. Wie aber können fremde, auf den ersten Blick in ihrer Genese unwahrscheinliche und unter modernen Verhältnissen zudem anzweifelbare religiöse Haltungen und Sinnsysteme etabliert werden? Am Beispiel der im tibetischen Buddhismus verbreiteten Phowa-Meditation des "bewussten Sterbens" wird untersucht, wie für westliche Adept/innen auf den ersten Blick befremdlich und esoterisch anmutende spirituelle Lehren mit zunehmender Praxis an Evidenz und Sinnhaftigkeit gewinnen können, indem sich Gruppenprozesse, Visualisierungen, körperorientierte Übungen und psychisches Erleben zu einem übergreifenden Arrangement verschränken. Die empirische Datengrundlage für die Untersuchung liefern narrative Interviews mit westlich sozialisierten Schüler/innen und Lehrer/innen des Diamantweg-Buddhismus, der derzeit größten buddhistischen Gemeinschaft des tibetischen Buddhismus in Deutschland. Die Auswertung der Interviews erfolgte angelehnt an die dokumentarische Methode, erweitert durch eine Kontexturanalyse, um den Reflexionsverhältnissen gerecht zu werden, die den religiösen Selbst- und Weltbezug aufspannen. URN: http://nbn-resolving.de/urn:nbn:de:0114-fqs1503179

CYP1B1 expression, a potential risk factor for breast cancer

Energy Technology Data Exchange (ETDEWEB)

Goth-Goldstein, Regine; Erdmann, Christine A.; Russell, Marion

2001-05-31

CYP1B1 expression in non-tumor breast tissue from breast cancer patients and cancer-free individuals was determined to test the hypothesis that high CYP1B1 expression is a risk factor for breast cancer. Large interindividual variations in CYP1B1 expression were found with CYP1B1 levels notably higher in breast cancer patients than cancer-free individuals. The results indicate that CYP1B1 might play a role in breast cancer either through increased PAH activation or through metabolism of endogenous estrogen to a carcinogenic derivative.

Measurement of the CP Content and CP Violating Asymmetries in Neutral B Decays to Two D Mesons with the BaBar Detector

Energy Technology Data Exchange (ETDEWEB)

Lillard, V.

2005-04-25

This dissertation presents a measurement of time-dependent CP-violating asymmetries and a measurement of the CP-odd parity fraction in the decay B{sup 0} {yields} D*{sup +} D*{sup -}. The measurements are derived from a data sample of 88 x 10{sup 6} B{bar B} pairs collected by the BABAR detector at the PEP-II asymmetric-energy B Factory located at the Stanford Linear Accelerator Center. A one-dimensional angular analysis of the decay products measures the CP-odd fraction to be 0.063 {+-} 0.055(stat) {+-} 0.009(syst), indicating that the D*{sup +}D*{sup -} final state is mostly CP-even. The time-dependent CP asymmetry parameters Im({lambda}{sub +}) and |{lambda}{sub +}| are determined from an analysis of the time-dependence of flavor-tagged B decays. One neutral B meson is fully reconstructed in a D*{sup +} D*{sup -} final state, while the other B is inclusively reconstructed in order to determine its flavor. The Standard Model predicts the CP asymmetry parameters Im({lambda}{sub +}) and |{lambda}{sub +}| to be sin2{beta} and 1, respectively, in the absence of penguin diagram contributions. They are determined to be 0.05 {+-} 0.29(stat) {+-} 0.10(syst) and 0.75 {+-} 0.19(stat) {+-} 0.02(syst), respectively, which corresponds to a 2.5 sigma deviation from Standard Model predictions with penguin contributions ignored.

"ARZT IM GANZEN SPEKTRUM" ["PHYSICIAN IN THE FULL SPEKTRUM"

Directory of Open Access Journals (Sweden)

Mitzkat, Anika

2006-11-01

Full Text Available [english] For more than 20 years teaching in the medical program at Witten/Herdecke Private University has followed the goal of introducing students to the reality of patient care by a practical approach. The “adaptive physician personality” describes the educational objective of a physician who is able to orient towards “the full spectrum” of his professional core competencies. In regard to the “adaptive physician personality” four Integrated Curricula (Communication, Science, Ethics, and Health Economy had been developed along with the introduction of a model medical program in 2000. Witten/Herdecke University thereby today addresses the requirements defined by the New Medical Licensure Act of 27.06.2002 and brings forward at the same time a program which prepares the medical student for the multi-dimensional responsibilities in the reality of modern health care. This article describes the Integrated Curricula exemplified by the Communication curriculum. This relatively young area of medical teaching in Germany is still extensively unexplored concerning evidence-based research about its effectiveness and efficiency of teaching. [german] Die Lehre im Studiengang Humanmedizin an der Privaten Universität Witten/Herdecke (UWH verfolgt seit mehr als 20 Jahren das Ziel, Studierende praxisnah an die Realität der Patientenversorgung heranzuführen. Das Ausbildungsziel des Medizinstudiums ist dabei die ”lernfähige Arztpersönlichkeit”, die sich möglichst „im ganzen Spektrum” ärztlicher Kernkompetenzen zu orientieren vermag. Im Hinblick auf das Ziel der „lernfähigen Arztpersönlichkeit“ wurden mit der Einführung des Modellstudiengangs Medizin im Jahr 2000 vier Integrierte Curricula (Kommunikation, Wissenschaft, Ethik und Gesundheitsökonomie aufgebaut. Die Lehre an der Universität Witten/Herdecke geht damit einerseits auf die Anforderungen, die mit Einführung der neuen Approbationsordnung für Ärzte vom 27.06.2002 an

Replacement of the feedwater pipe system in reactor building outside containment at the nuclear power plant Philippsburg; Austausch der Speisewasserleitung im Reaktorgebaeude ausserhalb SHB im Kernkraftwerk Philippsburg I

Energy Technology Data Exchange (ETDEWEB)

Kessler, A. [Energie-Versorgung Schwaben AG, Stuttgart (Germany); Labes, M. [Siemens AG Unternehmensbereich KWU, Offenbach am Main (Germany); Schwenk, B. [Kernkraftwerk Philippsburg GmbH (Germany)

1998-11-01

After full replacement of the feedwater pipe system during the inspection period in 1997, combined with a modern materials, manufacturing and analysis concept, the entire pipe system of the water/steam cycle in the reactor building of KKP 1 now consists of high-toughness materials. The safety level of the entire plant has been increased by leaving aside postulation of F2 breaks in the reactor building and providing for protection against 0.1 leaks. Based on fluid-dynamic calculations for the cases of pump failure and pipe break, as well as pipe system calculations in 5 extensive calculation cycles, about 130 documents were filed for inspection and approval (excluding preliminary test documents on restraints). Points of main interest for safety analysis in this context were the optimised closing performance of the 3rd check valves and the integrity of the nozzle region at the RPV. (oirg./CB) [Deutsch] Durch den Restaustausch der Speisewasserleitungen in der Revision 1997, verbunden mit einem modernen Werkstoff-, Fertigungs- und Nachweiskonzept, sind im Reaktorgebaeude von KKP 1 in den Hauptleitungen des Wasser-Dampf-Kreislaufes nur noch hochzaehe Werkstoffe eingesetzt. Durch den Verzicht auf das Postulat von 2F-Bruechen im Reaktorgebaeude und durch die Auslegung gegen 0,1F-Lecks wird das Sicherheitsniveau der Anlage insgesamt gesteigert. Ausgehend von fluiddynamischen Berechnungen fuer Pumpenausfall und Rohrbruch sowie Rohrsystem-Berechnungen in 5 umfangreichen Berechnungskreisen wurden fuer die Genehmigung und Begutachtung ca. 130 Unterlagen (ohne Halterungs-Vorpruefunterlagen) eingereicht und vom Gutachter geprueft. Schwerpunkte der Nachweisfuehrung waren die Optimierung des Schliessverhaltens der 3. Rueckschlagarmaturen sowie der Integritaetsnachweis des RDB-Anschlusses. (orig./MM)

Asperentin B, a New Inhibitor of the Protein Tyrosine Phosphatase 1B.

Science.gov (United States)

Wiese, Jutta; Aldemir, Hülya; Schmaljohann, Rolf; Gulder, Tobias A M; Imhoff, Johannes F

2017-06-21

In the frame of studies on secondary metabolites produced by fungi from deep-sea environments we have investigated inhibitors of enzymes playing key roles in signaling cascades of biochemical pathways relevant for the treatment of diseases. Here we report on a new inhibitor of the human protein tyrosine phosphatase 1B (PTP1B), a target in the signaling pathway of insulin. A new asperentin analog is produced by an Aspergillus sydowii strain isolated from the sediment of the deep Mediterranean Sea. Asperentin B ( 1 ) contains an additional phenolic hydroxy function at C-6 and exhibits an IC 50 value against PTP1B of 2 μM in vitro, which is six times stronger than the positive control, suramin. Interestingly, asperentin ( 2 ) did not show any inhibition of this enzymatic activity. Asperentin B ( 1 ) is discussed as possible therapeutic agents for type 2 diabetes and sleeping sickness.

EphrinB1/EphB3b Coordinate Bidirectional Epithelial-Mesenchymal Interactions Controlling Liver Morphogenesis and Laterality

DEFF Research Database (Denmark)

Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C

2016-01-01

Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...

45 CFR 73b.1 - Scope.

Science.gov (United States)

2010-10-01

... 45 Public Welfare 1 2010-10-01 2010-10-01 false Scope. 73b.1 Section 73b.1 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES... officer or employee of the Department, including former and retired officers of the commissioned corps of...

The B(E2;4^+1->2^+1) / B(E2;2^+1->0^+1) Ratio in Even-Even Nuclei

Science.gov (United States)

Loelius, C.; Sharon, Y. Y.; Zamick, L.; G"Urdal, G.