WorldWideScience

Sample records for stadium kannapolis nc

  1. Human waves in stadiums

    Science.gov (United States)

    Farkas, I.; Helbing, D.; Vicsek, T.

    2003-12-01

    Mexican wave first widely broadcasted during the 1986 World Cup held in Mexico, is a human wave moving along the stands of stadiums as one section of spectators stands up, arms lifting, then sits down as the next section does the same. Here we use variants of models originally developed for the description of excitable media to demonstrate that this collective human behaviour can be quantitatively interpreted by methods of statistical physics. Adequate modelling of reactions to triggering attempts provides a deeper insight into the mechanisms by which a crowd can be stimulated to execute a particular pattern of behaviour and represents a possible tool of control during events involving excited groups of people. Interactive simulations, video recordings and further images are available at the webpage dedicated to this work: http://angel.elte.hu/wave.

  2. Stadium Relocation in Professional Football

    DEFF Research Database (Denmark)

    Junghagen, Sven; Lillo, Gonzalo Leal

    The aim of this paper is to conceptually illustrate the tension between commercialisation and club authenticity, which is a potential consequence of stadium relocation. There is a commercial pressure for relocating a football club to new and more modern facilities, but also a pressure from...

  3. The Metamorphosis of a Football Stadium.

    Science.gov (United States)

    van der Have, Pieter J.

    1999-01-01

    Examines the planning, renovation and enlargement, and funding of a new University of Utah football stadium that would also be used in the 2002 Winter Olympics. Contractor selection, solutions to construction challenges, and the steps taken to minimize risk and guarantee success of the projects are discussed, including the fact that the stadium is…

  4. Structural design of Kaohsiung Stadium, Taiwan

    Science.gov (United States)

    Watanabe, Hideyuki; Tanno, Yoshiro; Nakai, Masayoshi; Ohshima, Takashi; Suguichi, Akihiro; Lee, William H.; Wang, Jensen

    2013-01-01

    This paper presents an outline description of the structural design of the main stadium for the World Games held in Kaohsiung City, Taiwan, in 2009. Three new design concepts, unseen in previous stadiums, were proposed and realized: “an open stadium”, “an urban park”, and “a spiral continuous form”. Based on the open stadium concept, simple cantilever trusses in the roof structure were arranged in a delicate rhythm, and a so-called oscillating hoop of steel tubes was wound around the top and bottom surfaces of a group of cantilever trusses to form a continuous spiral form. Also, at the same time by clearly grouping the structural elements of the roof structure, the dramatic effect of the urban park was highlighted by unifying the landscape and the spectator seating area to form the stadium facade. This paper specifically reports on the overview of the building, concepts of structural design, structural analysis of the roof, roof design, foundation design, and an outline of the construction.

  5. Vertical motion and ''scarred'' eigenfunctions in the stadium billiard

    International Nuclear Information System (INIS)

    Christoffel, K.M.; Brumer, P.

    1985-01-01

    A subset of pseudoregular eigenfunctions of the classically chaotic stadium billiard is shown to participate strongly in vertically directed motion, supporting the conjectures of McDonald and of Heller regarding periodic orbits and pseudoregular eigenfunctions

  6. Saltstone Matrix Characterization And Stadium Simulation Results

    International Nuclear Information System (INIS)

    Langton, C.

    2009-01-01

    SIMCO Technologies, Inc. was contracted to evaluate the durability of the saltstone matrix material and to measure saltstone transport properties. This information will be used to: (1) Parameterize the STADIUM(reg s ign) service life code, (2) Predict the leach rate (degradation rate) for the saltstone matrix over 10,000 years using the STADIUM(reg s ign) concrete service life code, and (3) Validate the modeled results by conducting leaching (water immersion) tests. Saltstone durability for this evaluation is limited to changes in the matrix itself and does not include changes in the chemical speciation of the contaminants in the saltstone. This report summarized results obtained to date which include: characterization data for saltstone cured up to 365 days and characterization of saltstone cured for 137 days and immersed in water for 31 days. Chemicals for preparing simulated non-radioactive salt solution were obtained from chemical suppliers. The saltstone slurry was mixed according to directions provided by SRNL. However SIMCO Technologies Inc. personnel made a mistake in the premix proportions. The formulation SIMCO personnel used to prepare saltstone premix was not the reference mix proportions: 45 wt% slag, 45 wt% fly ash, and 10 wt% cement. SIMCO Technologies Inc. personnel used the following proportions: 21 wt% slag, 65 wt% fly ash, and 14 wt% cement. The mistake was acknowledged and new mixes have been prepared and are curing. The results presented in this report are assumed to be conservative since the excessive fly ash was used in the SIMCO saltstone. The SIMCO mixes are low in slag which is very reactive in the caustic salt solution. The impact is that the results presented in this report are expected to be conservative since the samples prepared were deficient in slag and contained excess fly ash. The hydraulic reactivity of slag is about four times that of fly ash so the amount of hydrated binder formed per unit volume in the SIMCO saltstone samples

  7. An Urban Soccer Stadium for Washington D.C.

    OpenAIRE

    Ard, John Christopher

    2014-01-01

    Expansive parking lots, miles of asphalt, and traffic jams: this is what the modern sport stadia has come to represent. Does it have to be this way? What does the future of sports stadia hold? Can we build a stadium that is better integrated to the community around it? The stadium must become a major urban element again and it must engage the urban context. D.C. United, the most storied franchise in MLS history, needs a new home. Baltimore and other locations in Maryland would gladly we...

  8. Recognizing chaotic states in stadium billiard by calculating gyration radius

    Directory of Open Access Journals (Sweden)

    M. Barezi

    2006-12-01

    Full Text Available   Nowadays study of chaotic quantum billiards because of their relation to Nano technology. In this paper distribution of zeros of wave function on the boundary of two circular and stadium billiards are investigated. By calculating gyration radius for these points chaotic and non-chaotic states are distinguished.

  9. Likelihood of illegal alcohol sales at professional sport stadiums.

    Science.gov (United States)

    Toomey, Traci L; Erickson, Darin J; Lenk, Kathleen M; Kilian, Gunna R

    2008-11-01

    Several studies have assessed the propensity for illegal alcohol sales at licensed alcohol establishments and community festivals, but no previous studies examined the propensity for these sales at professional sport stadiums. In this study, we assessed the likelihood of alcohol sales to both underage youth and obviously intoxicated patrons at professional sports stadiums across the United States, and assessed the factors related to likelihood of both types of alcohol sales. We conducted pseudo-underage (i.e., persons age 21 or older who appear under 21) and pseudo-intoxicated (i.e., persons feigning intoxication) alcohol purchase attempts at stadiums that house professional hockey, basketball, baseball, and football teams. We conducted the purchase attempts at 16 sport stadiums located in 5 states. We measured 2 outcome variables: pseudo-underage sale (yes, no) and pseudo-intoxicated sale (yes, no), and 3 types of independent variables: (1) seller characteristics, (2) purchase attempt characteristics, and (3) event characteristics. Following univariate and bivariate analyses, we a separate series of logistic generalized mixed regression models for each outcome variable. The overall sales rates to the pseudo-underage and pseudo-intoxicated buyers were 18% and 74%, respectively. In the multivariate logistic analyses, we found that the odds of a sale to a pseudo-underage buyer in the stands was 2.9 as large as the odds of a sale at the concession booths (30% vs. 13%; p = 0.01). The odds of a sale to an obviously intoxicated buyer in the stands was 2.9 as large as the odds of a sale at the concession booths (89% vs. 73%; p = 0.02). Similar to studies assessing illegal alcohol sales at licensed alcohol establishments and community festivals, findings from this study shows the need for interventions specifically focused on illegal alcohol sales at professional sporting events.

  10. Integrated Brand Promotion – Advertisement for STADIUM OY

    OpenAIRE

    Mai, Tung

    2014-01-01

    This project-based thesis is an advertisement for Stadium Oy. In 23 years of leading marketing department, Stadium’s marketing manager had to say this is a pioneer time when Stadium’s outsources an advertising project to an external individual resource. The project, therefore, consists a number of business partners so that professional quality is guaranteed to deliver. STADIUM’s advertising strategy stays committed to the company’s business model and its mission. This directly affec...

  11. Typology of Retractable Roof Structures in Stadiums and Sports Halls

    Directory of Open Access Journals (Sweden)

    Andrej Mahovič

    2015-10-01

    Full Text Available Retractable roof structures are one of the four fundamental systems (in addition to the playing area, stands and facade in a stadium and sports hall. The roof protects users against various weather conditions and creates optimum circumstances for carrying out different activities. Stadiums and sports halls with retractable roof structures can host a greater variety of activities, improve the quality of their implementation and the quality of visitors’ experience, and affect the perception and experience of people using or observing such buildings. A retractable roof structure allows for natural lighting and ventilation of the venue, gives optimal conditions for grass growth on the playing field, and reduces costs of use and maintenance of the building. Different typologies of movement of roof structures (frequency of opening and closing, design of the structure, and methods of movement are categorised in terms of their architectural and structural design. Application of different retractable roof systems worldwide is indicator of their effectiveness and efficiency, and is basis for use of movement also in other fundamental systems of stadiums and sports halls. Research and identification of characteristics of retractable roof structures lead to the design of new moving systems that can with the application of the moving principle change the purpose of movable elements or assume the characteristics of other fundamental systems.

  12. Aplikasi Sistem Pendukung Keputusan Stadium Penyakit Kanker Payudara Menggunakan Logika Fuzzy Berbasis Android

    OpenAIRE

    Rico Adrial

    2017-01-01

    Kanker payudara dapat lebih mudah diatasi saat masih stadium dini. Langkah awal dari pengobatan kanker payudara adalah dengan mendeteksi apakah gejala yang muncul pada tubuh pasien benar-benar merupakan sel kanker. Stadium kanker adalah hasil diagnosis dari fisikawan medis sehingga memudahkan pemahaman tentang penyakit pasien. Pada penelitian ini digunakan Fuzzy Logic sebagai metode yang membantu pada sistem pendukung keputusan dalam menentukan stadium kanker payudara. Saat ini banyak aplikas...

  13. Home field advantage: new stadium construction and team performance in professional sports.

    Science.gov (United States)

    Watson, Jack C; Krantz, Andrew J

    2003-12-01

    To identify the relations between new stadiums and home team performance and attendance for professional baseball (MLB) (n=14), basketball (NBA) (n=13), and football (NFL) (n=25) teams in the USA since 1950 dependent t tests assessed significance of increases in attendance in both MLB and the NBA and a significantly improved home winning percentage in MLB following the building of new stadiums. Implications include a better understanding of the rationales used by owners, fans, and players for building new stadiums.

  14. Computational analysis of natural ventilation in a large semi-enclosed stadium

    NARCIS (Netherlands)

    Hooff, van T.A.J.; Blocken, B.J.E.; Borri, C.; Augusti, G.; Bartoli, G.; Facchini, L.

    2009-01-01

    The last decades, newly built large sports stadia are also increasingly being used for other events such as concerts, conferences and other activities. An example of such a modern multifunctional stadium is the Amsterdam ‘ArenA’ in the Netherlands. This stadium is equipped with a roof that can be

  15. Recycling at Penn State's Beaver Stadium. "Recycle on the Go" Success Story

    Science.gov (United States)

    US Environmental Protection Agency, 2009

    2009-01-01

    With a 13-year-old recycling program, The Pennsylvania State University's (Penn State) Beaver Stadium in the past diverted nearly 30 tons of recyclables per year from local landfills. A new initiative to promote recycling in the stadium's tailgating area has helped Penn State more than triple its old recycling record, collecting 112 tons in 2008.…

  16. 2010 FIFA World Cup stadium investment: Does the post-event ...

    African Journals Online (AJOL)

    Bank Stadium (Soccer City) in Johannesburg and construct five new ... In South Africa's case, many ... studied. Much academic effort has been invested in the development of ... the construction costs and upgrades to stadiums, France, who hosted the WC in ..... the Economic Impact of the World Cup', Regional Studies, vol.

  17. Influence of wind direction and urban surroundings on natural ventilation of a large football stadium

    NARCIS (Netherlands)

    Hooff, van T.A.J.; Blocken, B.J.E.

    2011-01-01

    In this paper, CFD simulations of the natural ventilation of a large semi-enclosed stadium in the Netherlands during summer conditions are described. The simulations are performed to assess the air exchange rate for eight wind directions. The CFD model consists of both the complex stadium geometry

  18. 27 CFR 6.53 - Advertising in ballparks, racetracks, and stadiums.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Advertising in ballparks, racetracks, and stadiums. 6.53 Section 6.53 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Advertising, Display Or Distribution Service § 6.53 Advertising in ballparks, racetracks, and stadiums. The...

  19. Aplikasi Sistem Pendukung Keputusan Stadium Penyakit Kanker Payudara Menggunakan Logika Fuzzy Berbasis Android

    Directory of Open Access Journals (Sweden)

    Rico Adrial

    2017-08-01

    Full Text Available Kanker payudara dapat lebih mudah diatasi saat masih stadium dini. Langkah awal dari pengobatan kanker payudara adalah dengan mendeteksi apakah gejala yang muncul pada tubuh pasien benar-benar merupakan sel kanker. Stadium kanker adalah hasil diagnosis dari fisikawan medis sehingga memudahkan pemahaman tentang penyakit pasien. Pada penelitian ini digunakan Fuzzy Logic sebagai metode yang membantu pada sistem pendukung keputusan dalam menentukan stadium kanker payudara. Saat ini banyak aplikasi android yang dibuat sebagai penyedia informasi di bidang kesehatan. Penggabungan ilmu di bidang kesehatan. Fuzzy logic dan android diharapkan menjadi sebuah aplikasi mutakhir dalam membuat keputusan di bidang kesehatan. Sistem pendukung keputusan stadium kanker payudara telah dirancang. Dapat disimpulkan bahwa aplikasi ini dapat mengkalkulasi berdasarkan fuzzy logic metode Sugeno dan telah di uji baik secara penghitungan pada matlab maupun manual.

  20. The Research on Application of Information Technology in sports Stadiums

    Science.gov (United States)

    Can, Han; Lu, Ma; Gan, Luying

    With the Olympic glory in the national fitness program planning and the smooth development of China, the public's concern for the sport continues to grow, while their physical health is also increasingly fervent desired, the country launched a modern technological construction of sports facilities. Information technology applications in the sports venues in the increasingly wide range of modern venues and facilities, including not only the intelligent application of office automation systems, intelligent systems and sports facilities, communication systems for event management, ticket access control system, contest information systems, television systems, Command and Control System, but also in action including the use of computer technology, image analysis, computer-aided training athletes, sports training system and related data entry systems, decision support systems.Using documentary data method, this paper focuses on the research on application of information technology in Sports Stadiums, and try to explore its future trends.With a view to promote the growth of China's national economyand,so as to improve the students'quality and promote the cause of Chinese sports.

  1. Acute cardiac events and deployment of emergency medical teams and automated external defibrillators in large football stadiums in the Netherlands.

    Science.gov (United States)

    van de Sandt, Femke; Umans, Victor

    2009-10-01

    The incidence of acute cardiac events - including out-of-hospital cardiac arrest - may be increased in visitors of large sports stadiums when compared with the general population. This study sought to investigate the incidence of acute cardiac events inside large Dutch football stadiums, as well as the emergency response systems deployed in these stadiums and the success rate for in-stadium resuscitation. Retrospective cohort study using a questionnaire sent to the 20 Dutch stadiums that hosted professional matches during the 2006-2007 and 2007-2008 football seasons. Stadium capacity ranged from 3600 to 51 600 spectators. Nearly 13 million spectators attended 686 'Eredivisie' (Honorary Division) and European football matches. All stadiums distribute multiple emergency medical teams among the spectators. Eighty-five percent of the stadiums have an ambulance standby during matches, 95% of the stadiums were equipped with automated external defibrillators (AEDs) during the study period. On an average, one AED was available for every 7576 spectators (range 1800-29 600). Ninety-three cardiac events were reported (7.3 per 1 million spectators). An AED was used 22 times (1.7 per 1 million spectators). Resuscitation was successful in 18 cases (82%, 95% confidence interval: 61-93). The incidence of out-of-hospital cardiac arrest inside large football stadiums in the Netherlands, albeit increased when compared with the general population, is low. The success rate for in-stadium resuscitation by medical teams equipped with AEDs is high. Dutch stadiums appear vigilant in regard to acute cardiac events. This report highlights the importance of adequate emergency medical response systems (including AEDs) in large sports venues.

  2. [Cardiac arrest in spectators in German football stadiums. Precautionary measures, frequency and short-term outcome].

    Science.gov (United States)

    Luiz, T; Preisegger, T; Rombach, D; Madler, C

    2014-09-01

    Provision of medical care is an important element of safety precautions for visitors of sports arenas. The organizational requirements are especially high if cardiac arrest occurs; how this scenario is managed may thus serve as the ultimate indicator of the quality of stadium medical care. The objectives of this study were to analyze the structures and the resources available for the medical care of spectators in German professional soccer stadiums and to identify the frequency and the primary resuscitation success of cardiac arrest. In 2011 a questionnaire-based survey was performed among the clubs of the first and second German soccer leagues regarding medical care of spectators during the seasons 2008/2009 and 2009/2010. The focus was on the qualifications of emergency teams, the equipment and the incidence of cardiac arrest. A total of 15 stadiums were included (38%) in the survey. The mean number of physicians and emergency medical technicians on site was 0.6/10,000 seats and 16/10,000 seats, respectively. Of the latter, a mean of 82% (minimum 20% and maximum 100%) had received training with automatic external defibrillators. In 87% of the stadiums regular advanced life support training (ALS) was required. The mean number of defibrillators per stadium was 2.8/10,000 seats (minimum 1.3 and maximum 3.8) including 1.7 automatic defibrillators (minimum 0.4 and maximum 2.8). For patient transport, a mean of 0.65 ALS ambulance vehicles per 10,000 seats (minimum 0.14 and maximum 1.46) were available on site. In all stadiums staff members were connected via mobile radio communication with the stadium medical control room. A total of 52 cardiac arrests (=0.25/100,000 spectators) were recorded of which 96% of the patients were transported to hospitals with spontaneous circulation. Cardiac arrests are not a rare occurrence in German soccer stadiums. The participating stadiums are overall well prepared for such incidents in terms of organization, staff and technology and

  3. Magnetic properties of elliptical and stadium-shaped nanoparticles: Effect of the shape anisotropy

    Energy Technology Data Exchange (ETDEWEB)

    Corona, R.M. [Departamento de Fisica, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Altbir, D. [Departamento de Fisica, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Escrig, J., E-mail: jescrigm@gmail.com [Departamento de Fisica, Universidad de Santiago de Chile (USACH), Avda. Ecuador 3493, 917-0124 Santiago (Chile); Center for the Development of Nanoscience and Nanotechnology (CEDENNA), Avda. Ecuador 3493, 917-0124 Santiago (Chile)

    2012-11-15

    Elliptical and stadium-shaped nanoparticles as a function of their geometry have been investigated using numerical simulations. The effect of the shape anisotropy of the particles on coercivity and remanence together with the angular dependence of the remanence and coercivity are addressed. Our results demonstrate that the stadium-shaped particles have many of the outstanding properties of elliptical particles, but also have unique properties, such that the coercivity and remanence remain stable for a wide range of geometry parameters, and exhibit a peculiar angular dependence in the coercivity. These properties suggest that they can be useful for applications in the area of magnetic recording systems. - Highlights: Black-Right-Pointing-Pointer Coercivity and remanence are strongly affected by the shape anisotropy of the particles. Black-Right-Pointing-Pointer Coercivities for ellipses are nearly three times the obtained for stadium-shaped particles. Black-Right-Pointing-Pointer Elliptical particles with {delta}{<=}0.6, the hystereses resemble the square loops of wires. Black-Right-Pointing-Pointer An anhisteretic behavior appears for {theta}=90 Degree-Sign for elliptical particles, which do not appear in stadium-shaped particles. Black-Right-Pointing-Pointer Stadium-shaped particles have unique properties that allow us to suggest them for applications.

  4. Magnetic properties of elliptical and stadium-shaped nanoparticles: Effect of the shape anisotropy

    International Nuclear Information System (INIS)

    Corona, R.M.; Altbir, D.; Escrig, J.

    2012-01-01

    Elliptical and stadium-shaped nanoparticles as a function of their geometry have been investigated using numerical simulations. The effect of the shape anisotropy of the particles on coercivity and remanence together with the angular dependence of the remanence and coercivity are addressed. Our results demonstrate that the stadium-shaped particles have many of the outstanding properties of elliptical particles, but also have unique properties, such that the coercivity and remanence remain stable for a wide range of geometry parameters, and exhibit a peculiar angular dependence in the coercivity. These properties suggest that they can be useful for applications in the area of magnetic recording systems. - Highlights: ► Coercivity and remanence are strongly affected by the shape anisotropy of the particles. ► Coercivities for ellipses are nearly three times the obtained for stadium-shaped particles. ►Elliptical particles with δ≤0.6, the hystereses resemble the square loops of wires. ► An anhisteretic behavior appears for θ=90° for elliptical particles, which do not appear in stadium-shaped particles. ► Stadium-shaped particles have unique properties that allow us to suggest them for applications.

  5. The Woodenest. Stadium by ZHA in the South-West of England

    Directory of Open Access Journals (Sweden)

    Nina Frolova

    2017-03-01

    Full Text Available The Forest Green Rovers Stadium (Stroud, UK designed by Zaha Hadid Architects will be built almost entirely of wood – the first time that will have been done anywhere in the world. The use of wood will ensure reduction of carbon dioxide emissions. Being a renewable resource, wood will also enhance the ecological characteristics of the building. The stadium’s roof is covered with a transparent membrane, which minimizes shadows and does not prevent the growth of grass on the stadium. The position of all the seats provides excellent views of the field. The first stage of building is planned for 5,000 spectators, increasing to 10,000 at the second stage. The stadium will be a part of the Eco Park development with the total area of 40 ha.

  6. The Effect of a Sports Stadium on Housing Rents: An Application of Geographically Weighted Regression

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Agudelo Torres

    2015-06-01

    Full Text Available Researchers have determined that real estate prices vary in continuous ways as a function of spatial characteristics.  In this study we examine whether geographically weighted regression (GWR provides different estimates of price effects around a sports stadium than more traditional regression techniques.  We find that an application of GWR with hedonic prices finds that the stadium has a negative external effect on housing rents that extends outward 560 meters, in contrast to the positive external effect on housing rents found using a conventional estimation technique.

  7. The Impact of the Stadium in the Supporter’s Consumption: How Does the Frequency at The Stadium Boosts the Demand for the Clubs’

    Directory of Open Access Journals (Sweden)

    Fernando A. Fleury

    2014-12-01

    Full Text Available The aim of this study is to investigate the relationship between the presence of supporter in the stadium, which demonstrates the supporter’s involvement with his soccer club, and its influence on the purchase of official products of the 12 largest Brazilian brands of soccer clubs. In this research, it was collected information from 1,296 supporters who responded to a questionnaire with 22 questions. It was defined as involvement with their soccer club the frequency this supporter goes to the stadium. In order to determine the consumption relationship it were used variables such as frequency of purchase of official products, the annual amount spent on such products, favorite venue to purchase and assortment of the products mix. For the supporters buying preferences analysis, it was applied the technique of correspondence analysis (Anacor. As a result, we can point out that the supporters’ loyalty, driven by the relationship marketing, is one of the catalysts for increasing the soccer clubs revenue, since the higher the products and average tickets purchase frequency, the more this frequency is associated with a higher number of attendance to the stadium, as well as the variety in the mix of products acquired by the supporter. In this sense, the work points to the importance of building a long term relationship which goes beyond the emotional bond with the club, reaching the brand products consumption.

  8. The influence of wind direction on natural ventilation: application to a large semi-enclosed stadium

    NARCIS (Netherlands)

    Hooff, van T.A.J.; Blocken, B.J.E.

    2009-01-01

    Natural ventilation is still a commonly applied way in building engineering to ensure a healthy and comfortable indoor climate. In this paper CFD simulations of the natural ventilation of a large semi-enclosed stadium in the Netherlands during the summer are described. Simulations are performed to

  9. Baseball Stadium Design: Teaching Engineering Economics and Technical Communication in a Multi-Disciplinary Setting.

    Science.gov (United States)

    Dahm, Kevin; Newell, James

    2001-01-01

    Reports on a course at Rowan University, based on the economic design of a baseball stadium, that offers an introduction to multidisciplinary engineering design linked with formal training in technical communication. Addresses four pedagogical goals: (1) developing public speaking skills in a realistic, business setting; (2) giving students…

  10. German money for Brazilian football stadiums; Deutsche Foerderung fuer brasilianische Stadien

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Cristina

    2011-07-01

    Solar energy is still a niche market in the world's fifth biggest state. According to present plants, the country intends rather to rely on hydroelectric power, bioenergy and wind power. Now, solar football stadiums for the 2014 World Cup are to get politicians and investors interested in photovoltaic conversion. They are sponsored by the KfW Entwicklungsbank and GIZ.

  11. A Spatial and Temporal Characterization of the Background Neutron Environment at the Navy and Marine Corps Memorial Stadium

    Science.gov (United States)

    2017-04-01

    Naval Academy Annapolis, MD Abstract This project utilized neutron detection near the Naval Academy football stadium in order to map and quantify...Introduction The Navy and Marine Corps Memorial Stadium is the U.S. Naval Academy’s football venue in Annapolis, Maryland, with a seating capacity of...Ziegler and H. Puchner, SER - History , Trends and Challenges A Guide for Designing with Memory ICs, San Jose: Cypress, 2004. [7] J.D. Dirk et al

  12. Do Professional Sports Franchises And Professional Sports Stadiums Have Any Effect On Employment In A City?

    OpenAIRE

    Ortiz, Mauricio

    2002-01-01

    With the increasing involvement of state and local governments in the professional sports industry over the last quarter of a century, the debate has arisen over whether the luring of a professional sports franchise or the construction of a stadium for a professional sports franchise provides any type of significant economic stimulus to a city. There are those who have engaged in this debate who believe the potential impact of these events to be significant and positive for a city. There ar...

  13. CFD optimisation of a stadium roof geometry: a qualitative study to improve the wind microenvironment

    Directory of Open Access Journals (Sweden)

    Sofotasiou Polytimi

    2017-01-01

    Full Text Available The complexity of the built environment requires the adoption of coupled techniques to predict the flow phenomena and provide optimum design solutions. In this study, coupled computational fluid dynamics (CFD and response surface methodology (RSM optimisation tools are employed to investigate the parameters that determine the wind comfort in a two-dimensional stadium model, by optimising the roof geometry. The roof height, width and length are evaluated against the flow homogeneity at the spectator terraces and the playing field area, the roof flow rate and the average interior pressure. Based on non-parametric regression analysis, both symmetric and asymmetric configurations are considered for optimisation. The optimum design solutions revealed that it is achievable to provide an improved wind environment in both playing field area and spectator terraces, giving a further insight on the interrelations of the parameters involved. Considering the limitations of conducting a two-dimensional study, the obtained results may beneficially be used as a basis for the optimisation of a complex three-dimensional stadium structure and thus become an important design guide for stadium structures.

  14. A family of stadium-like billiards with parabolic boundaries under scaling analysis

    International Nuclear Information System (INIS)

    Livorati, Andre L P; Loskutov, Alexander; Leonel, Edson D

    2011-01-01

    Some chaotic properties of a family of stadium-like billiards with parabolic focusing components, which is described by a two-dimensional nonlinear area-preserving map, are studied. Critical values of billiard geometric parameters corresponding to a sudden change of the maximal Lyapunov exponent are found. It is shown that the maximal Lyapunov exponent obtained for chaotic orbits of this family is scaling invariant with respect to the control parameters describing the geometry of the billiard. We also show that this behavior is observed for a generic one-parameter family of mapping with the nonlinearity given by a tangent function.

  15. Stadium Coltan

    NARCIS (Netherlands)

    Wakenge, Claude Iguma

    2017-01-01

    In the Democratic Republic of Congo (DRC), the mining sector has the potential to play a pivotal role in post-conflict reconstruction (World Bank, 2008), and artisanal mining sustains the livelihoods of millions people in the country (PACT, 2010). However, in the last 15 years, minerals from this

  16. Identifying Risk Factors of Boot Procurement: A Case Study of Stadium Australia

    Directory of Open Access Journals (Sweden)

    Marcus Jefferies

    2012-11-01

    Full Text Available Private sector input into the procurement of public works and services is continuing to increase. This has partly arisen out of a requirement for infrastructure development to be undertaken at a rate that maintains and allows growth. This has become a major challange for the construction industry that cannot be met by government alone. The emergence of Build-Own-Operate-Transfer (BOOT schemes as a response to this challange provides a means for developing the infrastructure of a country without directly impacting on the governments budgetary constraints. The concepts of BOOT are without doubt extremely complex arrangements, which bring to the construction sector risks not experienced previously. Many of the infrastructure partnerships between public and private sector in the pastare yet to provide evidence of successful completion, since few of the concession periods have expired. This paper provides an identified list of risk factors to a case study of Stadium Australia. The most significant risk associated with Stadium Australia include the bidding process, the high level of public scrutiny, post-Olympic Games facility revenue and the complicated nature of the consortium structure.  

  17. Identifying Risk Factors of Boot Procurement: A Case Study of Stadium Australia

    Directory of Open Access Journals (Sweden)

    Marcus Jefferies

    2012-11-01

    Full Text Available Private sector input into the procurement of public works and services is continuing to increase. This has partly arisen out of a requirement for infrastructure development to be undertaken at a rate that maintains and allows growth. This has become a major challange for the construction industry that cannot be met by government alone. The emergence of Build-Own-Operate-Transfer (BOOT schemes as a response to this challange provides a means for developing the infrastructure of a country without directly impacting on the governments budgetary constraints. The concepts of BOOT are without doubt extremely complex arrangements, which bring to the construction sector risks not experienced previously. Many of the infrastructure partnerships between public and private sector in the pastare yet to provide evidence of successful completion, since few of the concession periods have expired. This paper provides an identified list of risk factors to a case study of Stadium Australia. The most significant risk associated with Stadium Australia include the bidding process, the high level of public scrutiny, post-Olympic Games facility revenue and the complicated nature of the consortium structure.

  18. A Study of Factors Affecting the Demand for Watching Football in Stadiums

    Directory of Open Access Journals (Sweden)

    Ehsan Javanmardi

    2011-01-01

    Full Text Available This paper is to find the factors effective on football matches watching demand in stadiums. The factors effective on the demand are divided into 4 categories; economical, environmental, appeal, and geographical / demographical factors which converted into 23 independent parameters by virtue of the device appropriate to gather related information. In this research, Iranian super league was selected as the subject of the study and We limited our study to three cities; Shiraz, Isfahan, and Tehran. Finally by virtue of estimating the regressions and estimating the Ordinary Least Square and Minitab software three equations were gained to foresee the number of the spectators. Validation of the models was conducted by lack of fit test, studies on the remnants such as Darling - Anderson test of normality, and Durbin Watson statistics for remnant independence test and the issue of their variance being fixed, and the study of lack of complex collinearity between independent variables using Variance Inflation Factor (VIF. We used step - by - step regression method and regression of all probable conditions. By virtue of the conclusions of the regression equations we found that there is a structural difference between capital and the cities and the factors creating attractions such as their recent successes, history and the quality of the teams have the most effects on the fans’ demand to attend in the stadiums.

  19. Staduim Management Information System. A Casestudy Of Dan Anyiam Stadium Owerri Nigeria

    Directory of Open Access Journals (Sweden)

    Amanze B.C

    2015-08-01

    Full Text Available ABSTRACT This paper was centered on computerized stadium information management system. It is worthy to note that the current process of information management is being operated manually and due to this procedure numerous problems are encountered especially in the management of the crowd and ticket processing. The motivation of the software is to eliminate the manual procedures in the stadium and proper auditing is carried out in ensuring that those selling the tickets are authorized personal. The objective of the system is to successfully implement the computerized procedure and to overcome the obstacle that would hinder the successful implementation of the system. Research methodology practical and objective research techniques was used to outlines the way in which research was undertaken and among other things. The new system which is the expected data provides management software and advisory services to the sports and entertainment sector the new system was designed using Microsoft visual studio 2010 Ultimate as the front end and Microsoft SQL server as the back end. This language was chosen because it is easy to read and understand. It is real time and user friendly.

  20. For a Green Stadium: Economic Feasibility of Sustainable Renewable Electricity Generation at the Jeju World Cup Venue

    Directory of Open Access Journals (Sweden)

    Eunil Park

    2016-09-01

    Full Text Available After the 2002 FIFA World Cup in South Korea and Japan, the local governments of South Korea were left in charge of several large-scale soccer stadiums. Although these governments have made significant efforts toward creating profits from the stadiums, it is proving to be too difficult for several administrations to cover their full operational, maintenance, and conservation costs. In order to overcome this problem, one of the governments, Seogwipo City, which owns Jeju World Cup Stadium (JWCS, is attempting to provide an independent renewable electricity generation system for the operation of the stadium. The current study therefore examines potential configurations of an independent renewable electricity generation system for JWCS, using HOMER software. The simulation results yield three optimal system configurations with a renewable fraction of 1.00 and relatively low values for the cost of energy ($0.405, $0.546, and $0.692 per kWh. Through the examination of these three possible optimal configurations, the implications and limitations of the current study are presented.

  1. The Moses Mabhida Medical Plan: medical care planning and execution at a FIFA2010 stadium; the Durban experience.

    Science.gov (United States)

    Hardcastle, Timothy C; Naidoo, Mergan; Samlal, Sanjay; Naidoo, Morgambery; Larsen, Timothy; Mabasu, Muzi; Ngema, Sibongiseni

    2010-01-01

    This paper aims to outline the medical services provided at the Moses Mabhida Stadium, Durban, South Africa for the Fédération Internationale de Football Association (FIFA) 2010 Soccer World Cup and audit the clinical services delivered to persons seeking medical assistance. Descriptive report of the medical facilities at the Moses Mabhida Stadium including the staff deployment. Retrospective data review of medical incident reports from the Stadium Medical Team. Medical staffing exceeded the local norms and was satisfactory to provide rapid intervention for all incoming patients. Senior medical presence decreased the transport to hospital rate (TTHR). A total of 316 spectators or support staff were treated during the seven matches played at the stadium. The majority of patients were male (60%), mostly of local origin, with mostly minor complaints that were treated and discharged (88.2% Green codes). The most common complaints were headache, abdominal disorders, and soft-tissue injuries. One fatality was recorded. The patient presentation rate (PPR) was 0.66/10,000 and the TTHR was overall 4.1% of all treated patients (0.027/10,000 spectators). There was little evidence to guide medical planning for staffing from the FIFA governing body. Most patients are treated and released in accordance with international literature, leading to low TTHR rates, while PPR was in line with international experience. Headache was the most common medical complaint. The blowing of Vuvuzelas(®) may have influenced the high headache rate.

  2. Decay of energy and suppression of Fermi acceleration in a dissipative driven stadium-like billiard.

    Science.gov (United States)

    Livorati, André L P; Caldas, Iberê L; Leonel, Edson D

    2012-06-01

    The behavior of the average energy for an ensemble of non-interacting particles is studied using scaling arguments in a dissipative time-dependent stadium-like billiard. The dynamics of the system is described by a four dimensional nonlinear mapping. The dissipation is introduced via inelastic collisions between the particles and the moving boundary. For different combinations of initial velocities and damping coefficients, the long time dynamics of the particles leads them to reach different states of final energy and to visit different attractors, which change as the dissipation is varied. The decay of the average energy of the particles, which is observed for a large range of restitution coefficients and different initial velocities, is described using scaling arguments. Since this system exhibits unlimited energy growth in the absence of dissipation, our results for the dissipative case give support to the principle that Fermi acceleration seems not to be a robust phenomenon.

  3. Sports betting marketing during sporting events: a stadium and broadcast census of Australian Football League matches.

    Science.gov (United States)

    Thomas, Samantha; Lewis, Sophie; Duong, Jenny; McLeod, Colin

    2012-04-01

    Using Australian Football League (AFL) matches as a case study, we investigated the frequency, length and content of marketing strategies for sports betting during two specific settings: 1) at stadiums during four live matches; and 2) during eight televised broadcasts of matches. Census of sports betting marketing during Round 12 of the 2011 AFL premiership season. Per match, there was an average of 58.5 episodes (median 49.5, s.d 27.8) and 341.1 minutes (median 324.1 minutes and s.d 44.5) of sports betting marketing at stadiums, and 50.5 episodes (median 53.5, s.d 45.2) and 4.8 minutes (median 5.0 minutes, s.d 4.0) during televised broadcasts. A diverse range of marketing techniques were used to: a) embed sports betting within the game; b) align sports betting with fans' overall experience of the game; and c) encourage individuals to bet live during the game. There were very few visible or audible messages (such as responsible gambling or Gambler's Help messages) to counter-frame the overwhelmingly positive messages that individuals received about sports betting during the match. This study raises important questions about the impacts of saturation, integrated and impulse gambling marketing strategies in sporting matches. Future research should explore: 1) how wagering industry marketing strategies may affect the attitudes and behaviours of community sub-groups (e.g. young male sports fans, and children); and 2) which public health and policy strategies, including regulation and harm minimisation messaging, will be effective in responding to wagering industry marketing strategies during sporting matches. © 2012 The Authors. ANZJPH © 2012 Public Health Association of Australia.

  4. Vascular endothelial growth factor (VEGF-C - a potent risk factor in children diagnosed with stadium 4 neuroblastoma.

    Directory of Open Access Journals (Sweden)

    Bogdan Miskowiak

    2009-01-01

    Full Text Available To evaluate the immunohistochemical expression of VEGF-C, CD34 and VEGFR-2 in cancer tissue of children diagnosed with stadium 4 neuroblastoma (NB and correlate their presence with the survival rate of children diagnosed with that stage of the disease. Eighteen children assigned to stadium 4 composed the study group. Fourteen patients (allocated to stadium 3 formed a control group. VEGF-C, CD34 and VEGFR-2 expressions were evaluated by immunohistochemical assay. Consecutive slides incubated with anti-CD34 and anti-VEGFR-2 antibodies revealed that the two markers were colocalized within endothelial layer of the blood vessels. On the other hand, VEGF-C was expressed exclusively in tumour cells. As demonstrated by Fisher's exact test, the risk of NB treatment failure (progression or relapse as well as tumour related death, when all the patients were considered, was found to be significant in VEGF-C positive patients. VEGF-C expression in NB constitutes a potent risk factor and may direct future anti-angiogenic treatment strategy. The proximity of VEGF-C and CD34/VEGFR-2 of NB could be the equivalent of a potentially interesting VEGF-C fashion involving a tumour cell invasion into the blood vessels in an early phase of metastases promoting.

  5. Effect of crowd size on patient volume at a large, multipurpose, indoor stadium.

    Science.gov (United States)

    De Lorenzo, R A; Gray, B C; Bennett, P C; Lamparella, V J

    1989-01-01

    A prediction of patient volume expected at "mass gatherings" is desirable in order to provide optimal on-site emergency medical care. While several methods of predicting patient loads have been suggested, a reliable technique has not been established. This study examines the frequency of medical emergencies at the Syracuse University Carrier Dome, a 50,500-seat indoor stadium. Patient volume and level of care at collegiate basketball and football games as well as rock concerts, over a 7-year period were examined and tabulated. This information was analyzed using simple regression and nonparametric statistical methods to determine level of correlation between crowd size and patient volume. These analyses demonstrated no statistically significant increase in patient volume for increasing crowd size for basketball and football events. There was a small but statistically significant increase in patient volume for increasing crowd size for concerts. A comparison of similar crowd size for each of the three events showed that patient frequency is greatest for concerts and smallest for basketball. The study suggests that crowd size alone has only a minor influence on patient volume at any given event. Structuring medical services based solely on expected crowd size and not considering other influences such as event type and duration may give poor results.

  6. Hubungan Ekspresi NFκB dengan Respons Radiasi Kanker Serviks Stadium Lokal Lanjut

    Directory of Open Access Journals (Sweden)

    Affi A. Ratnasari

    2016-06-01

    Full Text Available Apoptosis merupakan salah satu jalur eliminasi sel kanker pada proses radiasi dan nuclear factor kappa-B (NFkB merupakan faktor transkripsi yang diduga berhubungan dengan mekanisme resistensi apoptosis suatu sel sehingga dapat memengaruhi respons pascaradiasi. Penelitian ini bertujuan untuk menilai ekspresi relatif NFkB pada kanker serviks stadium lokal lanjut dan hubungannya dengan respons radiasi. Penelitian dilakukan dengan desain kohort observasional pada bulan Januari-Oktober 2015. Jaringan biopsi pra-radiasi dari kanker serviks diperoleh dari 17 subjek dan biopsi mid-radiasi didapatkan dari 10 subjek. mRNA NFkB diekstraksi dan dianalisis menggunakan qRT-PCR. Ekspresi relatif NFkB diuji terhadap hubungannya dengan respons radiasi. Hasil penelitian menunjukkan median ekspresi relatif NFkB pra-radiasi pada kelompok subyek dengan respons negatif (0,667; SD 0,413 lebih tinggi daripada kelompok respons positif (0,315; SD 160,298, namun tidak terdapat hubungan dengan respons pascaradiasi (p=0,578. Terdapat hubungan antara perubahan ekspresi NFkB midterapi dibandingkan praterapi terhadap respons radiasi (p=0,035; RR 0,33. Disimpulkan bahwa penurunan ekspresi NFkB mid-radiasi dapat berperan dalam meningkatkan respons pascaradiasi. Kata kunci: NFkB, respons radioterapi, kanker serviks stadium lanjut lokal Expression of NFkB in Locally Advanced Cervical Cancer and Its Relation to Radiotherapy Response Abstract One of the expected elimination pathways of cancer cells in the process of radiation is apoptosis. Nuclear factor kappa-B (NFkB is a transcription factor related to the mechanism of apoptosis resistance of a cell, which can affect the post-radiation response. The aim of this study is to assess the relative expression of NFkB in locally advanced cervical cancer and its relation to radiotherapy response. The study was conducted with observational cohort design on January-October 2015. Pre-radiotherapy cervical biopsy specimen was collected from

  7. The Moses Mabhida Medical Plan: medical care planning and execution at a FIFA2010 stadium; the Durban experience

    Directory of Open Access Journals (Sweden)

    Timothy C Hardcastle

    2010-12-01

    Full Text Available Timothy C Hardcastle1,2, Mergan Naidoo3,4, Sanjay Samlal5,6, Morgambery Naidoo5,6, Timothy Larsen5,6, Muzi Mabasu5,6,7, Sibongiseni Ngema6,81Inkosi Albert Luthuli Hospital, Mayville, South Africa; 2Department of Surgery, University of KwaZulu-Natal, Durban, South Africa; 3Wentworth Hospital, Durban, South Africa; 4Department of Family Medicine, University of KwaZulu-Natal, Durban, South Africa; 5Emergency Medical Rescue Service, KwaZulu-Natal, South Africa; 6Department of Health, KwaZulu-Natal, South Africa; 7EMRS 2010 Planning Committee, KwaZulu-Natal, South Africa; 8School of Public Administration and Development Management, University of KwaZulu-Natal, Durban, South AfricaAim: This paper aims to outline the medical services provided at the Moses Mabhida Stadium, Durban, South Africa for the Fédération Internationale de Football Association (FIFA 2010 Soccer World Cup and audit the clinical services delivered to persons seeking medical assistance.Methods: Descriptive report of the medical facilities at the Moses Mabhida Stadium including the staff deployment. Retrospective data review of medical incident reports from the Stadium Medical Team.Results: Medical staffing exceeded the local norms and was satisfactory to provide rapid intervention for all incoming patients. Senior medical presence decreased the transport to hospital rate (TTHR. A total of 316 spectators or support staff were treated during the seven matches played at the stadium. The majority of patients were male (60%, mostly of local origin, with mostly minor complaints that were treated and discharged (88.2% Green codes. The most common complaints were headache, abdominal disorders, and soft-tissue injuries. One fatality was recorded. The patient presentation rate (PPR was 0.66/10,000 and the TTHR was overall 4.1% of all treated patients (0.027/10,000 spectators.Conclusion: There was little evidence to guide medical planning for staffing from the FIFA governing body. Most

  8. Intra-system reliability of SICS: video-tracking system (Digital.Stadium®) for performance analysis in football.

    Science.gov (United States)

    Beato, Marco; Jamil, Mikael

    2017-05-09

    The correct evaluation of external load parameters is a key factor in professional football. The instrumentations usually utilised to quantify the external load parameters during official matches are Video-Tracking Systems (VTS). VTS is a technology that records two- dimensional position data (x and y) at high sampling rates (over 25 Hz). The aim of this study was to evaluate the intra-system reliability of Digital.Stadium® VTS. 28 professional male football players taking part in the Italian Serie A (age 24 ± 6 years, body mass 79.5 ± 7.8 kg, stature 1.83 ± 0.05 m) during the 2015/16 season were enrolled in this study (Team A and Team B). Video-analysis was done during an official match and data analysis was performed immediately after the game ended and then replicated a week later. This study reported a near perfect relationship between the initial analysis (analysis 1) and the replicated analysis undertaken a week later (analysis 2). R2 coefficients were highly significant for each of the performance parameters, p power of 9.65 ± 1.64 w kg-1 and 9.58 ± 1.61 w kg-1, in analysis 1 and analysis 2, respectively. The findings reported in this study underlined that all data reported by Digital.Stadium® VTS showed high levels of absolute and relative reliability.

  9. Nutrition in pregnancy: the argument for including a source of choline

    OpenAIRE

    Zeisel, Steven H

    2013-01-01

    Steven H Zeisel Nutrition Research Institute at Kannapolis, Department of Nutrition, University of North Carolina at Chapel Hill, Kannapolis, NC, USA Abstract: Women, during pregnancy and lactation, should eat foods that contain adequate amounts of choline. A mother delivers large amounts of choline across the placenta to the fetus, and after birth she delivers large amounts of choline in milk to the infant; this greatly increases the demand on the choline stores of the mother. Adequate inta...

  10. Air pollutant dispersion from a large semi-enclosed stadium in an urban area: high-resolution CFD modeling versus full-scale measurements

    NARCIS (Netherlands)

    Hooff, van T.A.J.; Blocken, B.J.E.; Seppelt, R.; Voinov, A.A.; Lange, S.; Bankamp, D.

    2012-01-01

    Abstract: High-resolution CFD simulations and full-scale measurements have been performed to assess the dispersion of air pollutants (CO2) from the large semi-enclosed Amsterdam ArenA football stadium. The dispersion process is driven by natural ventilation by the urban wind flow and by buoyancy,

  11. The experience of some European Countries in the implementation of preventive measures against the phenomenon of violence and aggression at football stadiums

    Directory of Open Access Journals (Sweden)

    Samuel Uhrin

    2013-12-01

    Full Text Available The article sets forward the experience of the Slovak Republic in the field of prevention of violence and aggression in football stadiums. The text discusses initiatives aiming at dimnishing this alarming and increasing in size phenomenon. The experiences stemming from preventive measures which have been taken in this regard in other European countries, have also been brought closer in the text.

  12. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  13. One-Year Monitoring PV Power Plant Installed on Rooftop of Mineirão Fifa World Cup/Olympics Football Stadium

    Directory of Open Access Journals (Sweden)

    Luís G. Monteiro

    2017-02-01

    Full Text Available This paper presents results of one-year monitoring of AC side electrical parameters and the characterization of local solar radiation at the biggest rooftop PV Power Plant, with an installed capacity of 1.42 MWp, mounted at Mineirão Football Stadium in Brazil. This stadium is one of the sport facilities that hosted 2014 FIFA World Cup and Rio 2016 Summer Olympics Games in the country. Results showed how it is important to study and characterize the solar resource in the region of interest, based on historic data, to provide the understanding of solar radiation and thus project PV power plants with better performance. Furthermore, AC electrical data show the behavior of active, reactive and apparent powers and the influence of the PV system on the power factor at the local grid utility connection point. Finally, PV power plant performance data (as annual final yield, performance ratio and capacity factor are also presented and compared with data from PVsyst software simulations. The results over the monitoring period were good considering the specificities of the stadium

  14. Spondylolysis in adolescents: the diagnostic value of MRI; Die Spondylolyse im Stadium der Entstehung: Diagnostischer Beitrag der MRT

    Energy Technology Data Exchange (ETDEWEB)

    Staebler, A.; Steinborn, M.; Matzko, M.; Reiser, M. [Klinikum Grosshadern, Muenchen (Germany). Inst. fuer Radiologische Diagnostik; Paulus, R.; Bosch, R. [Muenchen Univ. (Germany). Orthopaedische Klinik

    2000-01-01

    Purpose: To assess the value of MR imaging in demonstrating ongoing spondylolysis in adolescents. Methods: MRI was performed in 9 juvenile patients (3 female, 6 male aged 8-16 years; mean 12.5 y) with pain during hyperextension. In 6 patients a CT scan and in 5 a plain film was available. Results: In all patients bone marrow edema was found in the pars interarticularis and the pedicle, which was bilateral in 4 patients. In 7/9 cases the L5 vertebra was affected, in 2/9 cases spondylolysis was found in L4. In 3 cases the edema reached the middle third of the vertebral body and a tumor was suspected. In all CT scans a bilateral incomplete or complete cleft in the pars interarticularis was found. In 4/6 CT-scans a sclerosis was seen in the area of the bone marrow edema. Only in 1/5 pain films was there a suspicion for a spondylolysis, four examinations were completely normal. Conclusions: To eliminate underlying causal conditions of spondylolysis and to install specific therapy, early diagnosis is mandatory. MR imaging should be the first and only imaging modality in young patients with low back pain during and after exercise and pain with hyperextension. Bone scans and CT scans should be avoided due to irradiation, plain films usually do not reveal pathological findings in developing spondylolysis. (orig.) [German] Ziel: Darstellung der Wertigkeit der MR-Tomographie in der Diagnostik der Spondylolyse im Stadium der Entstehung. Methoden: 9 sportlich, aktive jugendliche Patienten im Alter von 8-16 Jahren (Durchschnitt 12,5 Jahre) mit Rueckenschmerzen bei der Hyperextension wurden MR-tomographisch untersucht. In 6 Faellen lag eine CT, in 5 Faellen Roentgenaufnahmen vor. Ergebnisse: Bei den 9 Jugendlichen wurden Knochenmarkoedeme in der Pars interarticularis und den Bogenwurzeln nachgewiesen, die in 4 Patienten beidseitig vorhanden waren. In 7/9 Faellen war LWK 5 betroffen, in 2/9 LWK 4. In 3 Faellen reichte das Oedem in die Wirbelkoerper, bei 2 Patienten bestand

  15. EnviroAtlas - Durham, NC - Demo (Parent)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

  16. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

  17. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

  18. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

  19. ORF Sequence: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

  20. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

  1. 78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

    Science.gov (United States)

    2013-04-24

    ... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

  2. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  3. A Cautionary Analysis of a Billion Dollar Athletic Expenditure: The History of the Renovation of California Memorial Stadium and the Construction of the Barclay Simpson Student Athlete High Performance Center. Research & Occasional Paper Series: CSHE.3.17

    Science.gov (United States)

    Cummins, John

    2017-01-01

    This paper is a description and analysis of the history of the renovation of Memorial Stadium and the building of the Barclay Simpson Student Athlete High Performance Center (SAHPC) on the Berkeley campus, showing how incremental changes over time result in a much riskier and financially less viable project than originally anticipated. It…

  4. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  5. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory C; Bristow, Laura A; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

  6. 76 FR 72409 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2011-11-23

    ... NVO Service. Pink City Logistics USA LLC (NVO & OFF), 7 Emily Road, Manalapan, NJ 07726; Officers... at (202) 523-5843 or by email at [email protected] . AE Eagle Logistics Inc. (NVO & OFF), 765 Route 83... License. Daybreak Logistics, Inc. (NVO & OFF), 2804 N. Cannon Blvd., Kannapolis, NC 28083; Officers...

  7. Non-leptonic kaon decays at large Nc

    Science.gov (United States)

    Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

    2018-03-01

    We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

  8. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  9. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  10. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  11. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  12. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  13. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

  14. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  15. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

  16. ORF Sequence: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

  17. ORF Sequence: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  18. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

  19. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

  20. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

  1. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

  2. Energy Flexibility from Large Prosumers to Support Distribution System Operation—A Technical and Legal Case Study on the Amsterdam ArenA Stadium

    Directory of Open Access Journals (Sweden)

    Dirk Kuiken

    2018-01-01

    Full Text Available To deal with the rising integration of stochastic renewables and energy intensive distributed energy resources (DER to the electricity network, alternatives to expensive network reinforcements are increasingly needed. An alternative solution often under consideration is integrating flexibility from the consumer side to system management. However, such a solution needs to be contemplated from different angles before it can be implemented in practice. To this end, this article considers a case study of the Amsterdam ArenA stadium and its surrounding network where flexibility is expected to be available to support the network in the future. The article studies the technical aspects of using this flexibility to determine to what extent, despite the different, orthogonal goals, the available flexibility can be used by various stakeholders in scenarios with a large load from electric vehicle charging points. Furthermore, a legal study is performed to determine the feasibility of the technical solutions proposed by analysing current European Union (EU and Dutch law and focusing on the current agreements existing between the parties involved. The article shows that flexibility in the network provided by Amsterdam ArenA is able to significantly increase the number of charging points the network can accommodate. Nonetheless, while several uses of flexibility are feasible under current law, the use of flexibility provided by electric vehicles specifically faces several legal challenges in current arrangements.

  3. 76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-05-23

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

  4. 76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-05

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  5. 76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-06-29

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

  6. 76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

    Science.gov (United States)

    2011-04-26

    ...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

  7. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  8. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  9. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

  10. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  11. Violenze allo stadio: il caso di Filippo Raciti / Violence in football stadiums: the case of Filippo Raciti / Violences au stade: l'affaire Filippo Raciti

    Directory of Open Access Journals (Sweden)

    Ziosi M.

    2008-12-01

    Full Text Available Afin d'aborder le sujet de la violence dans les stades, j'ai avant tout analysé brièvement les épisodes les plus graves pour lesquels la chronique sportive s'est colorée de noir, pour arriver enfin au meurtre de Filippo Raciti. Par le biais des 392 articles publiés au mois de février 2007 dans les quotidiens Il Corriere della Sera, la Repubblica, Il Resto del Carlino et l’Unità, j'ai examiné cette affaire criminelle de la manière suivante: premièrement une description du déroulement des faits du 2 février 2007, dans laquelle les séquences et les dynamiques qui ont entraînés la mort de l'inspecteur Raciti emergent, a été effectuée, suivie par une analyse de contenu communicatif des articles dans le but de mettre en évidence les modalités de traitement de l'information dans la presse. Cette analyse se compose d'un volet quantitatif et d'un volet qualitatif: ce dernier a été realisé par le biais d'une fiche de collecte des données divisée en sujets. De cet examen approfondi du language journalistique découlent des réfléxions sur la délicate affaire "Filippo Raciti" et sur la ville de Catane, sur le "système football" en général et sur la situation de la sécurité dans les stades. Enfin, des propositions qui, mettant en évidence les points faibles des lois actuelles, ont pour but d'envisager des interventions pour réduire le comportement violent des supporters.AbstractIn order to deal with the problems of violence in football stadiums, I have first of all shortly analysed the most serious episodes in which have darkened the sporting world and then explained the murder of Filippo Raciti. Through the reading of the 392 articles published on the daily papers Il Corriere della Sera, la Repubblica, Il Resto del Carlino and l'Unità in the month of February 2007, the criminal case is examined in the following way: to a first description of the course of events of February 2nd 2007, in which the sequences and the

  12. Inherent and antigen-induced airway hyperreactivity in NC mice

    OpenAIRE

    Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

    1999-01-01

    In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

  13. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  7. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  8. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  9. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  10. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  11. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  12. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  13. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

  14. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  15. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

  16. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  18. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

  19. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  20. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

  1. ORF Alignment: NC_006569 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

  2. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  3. Explorations of the extended ncKP hierarchy

    International Nuclear Information System (INIS)

    Dimakis, Aristophanes; Mueller-Hoissen, Folkert

    2004-01-01

    A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

  4. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

  5. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  6. ORF Alignment: NC_006371 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  7. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

  8. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

  9. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

  11. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  12. ORF Sequence: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

  13. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

  14. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  15. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

  16. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

  17. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  18. ORF Sequence: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

  19. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

  20. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

  2. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  3. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

  4. ORF Alignment: NC_003064 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

  5. ORF Sequence: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

  6. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  7. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  8. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  9. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  10. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  11. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

  12. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

  13. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

  14. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

  15. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

  16. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  17. Cold power creates artificial ice for the ice hockey championship. Football arena is used as an ice stadium; Kaeltepower schafft Kunsteis fuer Eishockey-WM. Fussballarena wird zum Eisstadion

    Energy Technology Data Exchange (ETDEWEB)

    Hoffmann, Franz

    2010-11-15

    On 7th May 2010, the Veltins arena in Gelsenkirchen (Federal Republic of Germany) became the greatest ice hockey stadium of the world. There, the opening play of the world championship between the host Germany and the USA took place. Germany as a clear outsider won 2:1 against the US-Boys. However, before this historical victory extensive building operations had to be realized 'Auf Schalke' in order to convert the lawn into a complete ice hockey court.

  18. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  19. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  20. KAJlAN EKONOMI PEMANFAATAN KAWASAN STADION KRIDOSONO SEBAGAI RUANG HIJAU KOTA YOGYAKARTA (Economic Study for Utilization of Kridosono Stadium Area as An Urban Green Space of Yogyakarta Municipality

    Directory of Open Access Journals (Sweden)

    Amiluhur Soeroso

    2010-07-01

    Objective of the study is measuring economy feasibility of Kridosono urban park as a public goods that expected directly addresses the issues of natural environmental quality. Data were obtained from interviews toward local resident of Yogyakarta municipality. Hereafter, willingness to pay (WTP toward demand models were estimated by contingent valuation method (CVM and used to derive total consumer surplus. The results indicate that economic value of Kridosono Stadium land is about US$ 27 million (IDR 257 billion per annum, more than its market price i.e. amount US$ 7.8 million or IDR 74 billion. Thus, the study gives stakeholders knowledge of decision making for managing, funding and alocating resources. Utilization part of Kridosono Stadium land as urban park will give bigger benefit than it would be this for commercial interest. Auspicious is hanging on the urban park, because it will help eliminate greenhouse gases i.e. Carbon dioxide, Methane, Nitrous oxide, Hydro-fluorocarbons, Perflurocarbon and Sulfur hexafluoride which is produced by motor vehicle.

  1. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  2. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  3. Comparative Evaluation of Ultrafiltration/Microfiltration Membranes for Removal of Nitrocellulose (NC) Fines from Wastewater

    National Research Council Canada - National Science Library

    Kim, Byung

    1997-01-01

    .... In Phase II, a pilot-scale crossflow membrane filtration system was constructed to: (1) investigate the concentration polarization and fouling mechanism caused by NC fines during crossflow filtration of NC wastewater, (2...

  4. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

  5. ORF Alignment: NC_002570 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

  6. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  7. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  8. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902282 >1in4A 3 311 20 328 5e-98 ... ref|NP_357832.1| Branch migration of Holliday structures... [Streptococcus pneumoniae ... R6] gb|AAK99042.1| Branch migration of Holliday ... structures... [Streptococcus pneumoniae R6] pir||F97901 ... branch migration of Holliday structures

  9. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  10. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  11. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  12. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  13. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  14. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  15. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  16. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  17. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

  18. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  19. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  20. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  1. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18397761 >1wocC 2 96 2 97 5e-15 ... ref|YP_063428.1| ssb1 [Campylobacter... ... gb|EAL55921.1| single-strand binding protein, putative ... [Campylobacter coli RM2228] gb|AAR29517.1| ssb1

  2. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|30692533 >3ullA 5 115 1 104 8e-18 ... ref|YP_063478.1| ssb1 [Campylobact...er jejuni] gb|AAR29567.1| ssb1 [Campylobacter ... jejuni] ... Length = 104 ... Query: 31 ... GQDSDVS

  3. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  4. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900808 >1l3wA 6 536 1265 1798 3e-11 ... ref|NP_800463.1| putative biofilm...-associated surface protein [Vibrio parahaemolyticus ... RIMD 2210633] dbj|BAC62296.1| putative biofilm

  5. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

  6. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|15221381 >1bq00 2 77 15 90 4e-20 ... ref|NP_177004.1| gravity-responsive... protein / altered response to gravity protein ... (ARG1) [Arabidopsis thaliana] gb|AAD13758.1| Altere

  7. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  8. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1ii8A 3 194 4 202 2e-10 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  9. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1gxlA 2 204 475 685 1e-34 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  10. ORF Alignment: NC_003237 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003237 gi|19075000 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

  11. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669839 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus jannaschii ... DSM 2661] gb|AAB99663.1| chromosome segreta

  12. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  13. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  14. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  15. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  16. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  17. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  18. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  19. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498546 >1yozA 1 116 1 116 6e-47 ... pdb|1YOZ|B Chain B, Predicted Coding... Region Af0941 From Archaeoglobus Fulgidus ... pdb|1YOZ|A Chain A, Predicted Coding Region Af0941 F

  20. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  1. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

  2. ORF Alignment: NC_003228 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

  3. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  4. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  5. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56698151 >1wy2A 3 347 27 396 7e-44 ... gb|AAV96554.1| creatinase [Silici...bacter pomeroyi DSS-3] ref|YP_168523.1| ... creatinase [Silicibacter pomeroyi DSS-3] ... Length

  6. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309739 >1v7zA 1 255 3 250 3e-61 ... dbj|BAB80463.1| creatinase [Clostr...idium perfringens str. 13] ref|NP_561673.1| ... creatinase [Clostridium perfringens str. 13] ...

  7. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990378 >1wy2A 3 347 23 393 2e-45 ... ref|NP_745803.1| creatinase [Pseu...domonas putida KT2440] gb|AAN69267.1| creatinase ... [Pseudomonas putida KT2440] ... Length = 3

  8. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  9. ORF Alignment: NC_000964 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

  10. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264213 >1ub4C 1 63 1 63 4e-10 ... gb|AAM39232.1| plasmid stable inheritance... protein I [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644714.1| plasmid stable ... inheritance

  11. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800954 >1ub4B 4 109 2 113 3e-22 ... ref|YP_207666.1| putative plasmid stable inheritance... ... gb|AAW89254.1| putative plasmid stable inheritance ... protein putative phage associated prote

  12. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pothetical stbA Plasmid stable inheritance protein ... [Photobacterium profundum] ... Length = ... NC_006370 gi|54307287 >1mwmA 2 317 24 344 3e-96 ... ref|YP_128307.1| Hypothetical stbA Plasmid stable inherita...nce protein ... [Photobacterium profundum SS9] emb|CAG18505.1| ... Hy

  13. ORF Alignment: NC_003921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003921 gi|21264212 >1m1fA 1 109 2 110 1e-34 ... gb|AAM39231.1| plasmid stable inheritance... protein K [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_644713.1| plasmid stable ... inheritance

  14. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  15. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121646 >1kmoA 14 661 37 705 8e-56 ... ref|YP_050813.1| exogenous ferri...c siderophore TonB-dependent receptor [Erwinia ... carotovora subsp. atroseptica SCRI1043] emb|CAG75622.1| ... exogenou

  16. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937619 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  17. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15891046 >1kmoA 2 661 49 702 6e-54 ... ref|NP_534408.1| exogenous ferric... siderophore receptor [Agrobacterium tumefaciens ... str. C58] gb|AAL44724.1| exogenous ferric sidero...phore ... receptor [Agrobacterium tumefaciens str. C58] ... pir||AF3038 exogenous ferric sider

  18. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33603734 >1kmoA 3 661 60 754 2e-50 ... ref|NP_891294.1| exogenous ferric... siderophore receptor [Bordetella bronchiseptica ... RB50] gb|AAB51774.1| exogenous ferric siderophor...e ... receptor emb|CAE35124.1| exogenous ferric siderophore ... receptor [Bordetella bronchise

  19. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

  20. ORF Alignment: NC_005861 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005861 gi|46446610 >1f39A 5 95 55 141 1e-16 ... ref|YP_007975.1| probable SOS mutagenesis... and repair protein UmuD [Parachlamydia sp. ... UWE25] emb|CAF23700.1| probable SOS mutagenesis

  1. ORF Alignment: NC_005070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005070 gi|33865578 >1f39A 4 97 54 143 4e-22 ... ref|NP_897137.1| putative SOS mutagenesis... protein UmuD [Synechococcus sp. WH 8102] ... emb|CAE07559.1| putative SOS mutagenesis protein

  2. ORF Alignment: NC_003233 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003233 gi|19074284 >1ltlE 10 233 29 251 7e-31 ... emb|CAD25394.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM5 ... [Encephalitozoon cuniculi GB-M1] ref|NP_585790.1| DNA ... REPLICATION

  3. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1ewiA 5 113 54 161 1e-18 ... emb|CAD25779.1| DNA REPLICATION F...ACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PROT

  4. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173253 >1a5t0 17 316 29 298 4e-25 ... emb|CAD27104.1| REPLICATION FACT...OR C (ACTIVATOR 1) 37kDa SUBUNIT [Encephalitozoon ... cuniculi GB-M1] ref|NP_597056.1| REPLICATION FA

  5. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  6. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31791180 >1ii8A 1 187 1 168 2e-14 ... ref|NP_853673.1| DNA REPLICATION A...D92865.1| ... DNA REPLICATION AND REPAIR PROTEIN RECF (SINGLE-STRAND ... DNA BINDING PROTEIN)

  7. ORF Alignment: NC_003238 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003238 gi|19173256 >1ltlE 44 240 100 302 2e-23 ... emb|CAD27107.1| DNA REPLICATION... LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  8. ORF Alignment: NC_003364 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003364 gi|18312259 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  9. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1jmcA 1 238 213 445 1e-62 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  10. ORF Alignment: NC_005787 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005787 gi|45198873 >1g8pA 7 311 329 597 1e-04 ... emb|CAD27107.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY MCM7 ... [Encephalitozoon cuniculi GB-M1] ref|NP_597059.1| DNA ... REPLICATION

  11. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15791012 >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION ...LICENSING FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING

  12. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987645 >1j1vA 4 94 20 109 8e-10 ... gb|AAL52543.1| CHROMOSOMAL REPLICATION... INITIATOR PROTEIN DNAA [Brucella melitensis ... 16M] ref|NP_540279.1| CHROMOSOMAL REPLICATION IN

  13. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19074034 >1ltlE 2 242 49 290 7e-40 ... emb|CAD25144.1| DNA REPLICATION L...ICENSING FACTOR OF THE MCM FAMILY (MCM4) ... [Encephalitozoon cuniculi GB-M1] ref|NP_584640.1| DNA ... REPLICATION

  14. ORF Alignment: NC_003236 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003236 gi|19074669 >1l1oC 2 175 456 623 1e-43 ... emb|CAD25779.1| DNA REPLICATION ...FACTOR A PROTEIN 1 [Encephalitozoon cuniculi GB-M1] ... ref|NP_586175.1| DNA REPLICATION FACTOR A PRO

  15. ORF Alignment: NC_003229 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003229 gi|19073988 >1a5t0 2 324 6 283 2e-17 ... emb|CAD25098.1| DNA REPLICATION FA...CTOR (ACTIVATOR 1) 36 kDa SUBUNIT ... [Encephalitozoon cuniculi GB-M1] ref|NP_584594.1| DNA ... REPLICATION

  16. ORF Alignment: NC_003232 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003232 gi|19173617 >1ltlE 7 224 22 242 3e-38 ... ref|NP_597420.1| DNA REPLICATION ...LICENSING FACTOR OF THE MCM FAMILY (MCM6) ... [Encephalitozoon cuniculi] emb|CAD26597.1| DNA ... REPLICATION

  17. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  18. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  19. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229523 >1p6rA 5 81 4 80 4e-10 ... ref|NP_635440.1| methicillin resista...nce protein [Xanthomonas campestris pv. ... campestris str. ATCC 33913] gb|AAM39364.1| methicillin ...

  20. ORF Alignment: NC_006582 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006582 gi|56962048 >1sd4A 2 99 6 103 1e-24 ... ref|YP_173770.1| methicillin resist...ance regulatory protein MecI [Bacillus clausii ... KSM-K16] dbj|BAD62809.1| methicillin resistance ...

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21240843 >1p6rA 5 81 4 80 8e-10 ... gb|AAM34961.1| methicillin resistanc...e protein [Xanthomonas axonopodis pv. citri ... str. 306] ref|NP_640425.1| methicillin resistance ...

  2. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472874 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  3. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006177 gi|51893967 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  4. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002967 gi|42528039 >1b4uB 49 289 86 299 5e-14 ... ref|NP_104441.1| encapsulation p...rotein CapA [Mesorhizobium loti MAFF303099] ... dbj|BAB50227.1| encapsulation protein; CapA ...

  5. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  6. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  7. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  8. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  9. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  10. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  11. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  12. ORF Alignment: NC_004331 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004331 gi|23619306 >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putativ

  13. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|18403860 >1rl1A 4 90 215 300 7e-09 ... ref|NP_705268.1| nuclear movement... protein, putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative

  14. Large-Nc quantum chromodynamics and harmonic sums

    Indian Academy of Sciences (India)

    2012-06-08

    Jun 8, 2012 ... This has led us to consider a class of analytic number theory .... The self-energy function LR(Q2) in the chiral limit vanishes order by order in QCD ... the 1/Nc expansion, the Goldstone loop corrections are subleading and, ...

  15. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502014 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  16. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987131 >1y7mA 26 161 48 214 1e-16 ... gb|AAL52029.1| PROBABLE CARNITINE... OPERON OXIDOREDUCTASE CAIA [Brucella melitensis ... 16M] ref|NP_539765.1| PROBABLE CARNITINE OPERON

  17. ORF Alignment: NC_002771 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002771 gi|15829246 >1nm8A 15 579 43 592 3e-82 ... ref|NP_326606.1| CARNITINE O-ACE...TYLTRANSFERASE [Mycoplasma pulmonis UAB CTIP] ... emb|CAC13948.1| CARNITINE O-ACETYLTRANSFERASE ...

  18. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002655 gi|15803232 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  19. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310050 >1r0wC 43 281 30 288 6e-50 ... ref|YP_131070.1| putative ABC-type oligopeptide transport...putative ... ABC-type oligopeptide transportsystem, ATPase component ... [Photobacterium profu

  20. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310056 >1r0wC 45 273 39 283 1e-54 ... ref|YP_131076.1| putative ABC-type metal ion transports...ative ... ABC-type metal ion transportsystem, ATPase component ... [Photobacterium profundum

  1. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_000913 gi|49176263 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  2. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available f|NP_289264.1| PTS system enzyme II ABC (asc), ... cryptic, transports specific beta-glucosides ... ...ABC (asc), cryptic, transports specific ... beta-glucosides [Escherichia coli O157:H7 EDL933] ... ... NC_002695 gi|15832825 >1iba0 1 77 8 85 7e-10 ... gb|AAG57822.1| PTS system enzyme II

  3. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54022220 >1y7yA 7 68 12 73 3e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

  4. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923033 >1sd4A 3 117 7 121 9e-28 ... dbj|BAB56205.1| methicillin resist...ance regulatory protein [Staphylococcus aureus ... subsp. aureus Mu50] sp|Q932L5|MECI_STAAM Methicill...in ... resistance regulatory protein mecI ref|NP_370567.1| ... methicillin resistance regulato

  5. ORF Alignment: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15600953 >1cqxA 1 398 1 388 e-107 ... gb|AAF96096.1| ferrisiderophore re...ductase [Vibrio cholerae O1 biovar eltor str. ... N16961] ref|NP_232583.1| ferrisiderophore reductase... ... [Vibrio cholerae O1 biovar eltor str. N16961] ... pir||F82491 ferrisiderophore reductase

  6. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available outer ... membrane receptor for iron transport; outer membrane ... porin protein, putative ferris...porin protein, putative ferrisiderophore receptor ... [Escherichia coli K12] gb|AAC73892.1| putative ... NC_000913 gi|16128773 >1kmoA 12 661 63 760 6e-50 ... ref|NP_415326.1| outer membrane

  7. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

  8. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

  9. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121259 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  10. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039110 >1kmoA 11 661 79 730 2e-52 ... ref|YP_191074.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60418.1| Hydroxamate-type ferrisid

  11. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15890948 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  12. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45443224 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  13. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

  14. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004088 gi|22127219 >1kmoA 5 661 44 699 5e-70 ... emb|CAC89799.1| putative hydroxamate-type ferris...iderophore receptor [Yersinia ... pestis CO92] ref|NP_404572.1| putative hydroxamate-type ... ferris...iderophore receptor [Yersinia pestis CO92] ... pir||AD0117 probable hydroxamate-type ferris

  15. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039006 >1kmoA 12 661 92 773 1e-43 ... ref|YP_190970.1| Hydroxamate-type ferris...iderophore receptor [Gluconobacter oxydans ... 621H] gb|AAW60314.1| Hydroxamate-type ferrisid

  16. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17937718 >1kmoA 11 661 74 716 3e-76 ... ref|NP_534507.1| hydroxamate-type ferris...iderophore receptor [Agrobacterium ... tumefaciens str. C58] gb|AAL44823.1| hydroxamate-type ... ferris...iderophore receptor [Agrobacterium tumefaciens ... str. C58] pir||AI3050 hydroxamate-type ferris

  17. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  18. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

  19. ORF Alignment: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003284 gi|17551448 >1rw3A 32 443 156 555 3e-25 ... gb|AAF64414.1| Pol [equine foam...y virus] ref|NP_054716.1| Pol [equine foamy virus] ... Length = 400 ... Query: 980 ... KLRIVLD--ASSPPGPEPSL

  20. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800390 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  1. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062138 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  2. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26246664 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  3. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829972 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  4. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479698 >1j3eA 1 115 2 116 2e-47 ... pdb|1IU3|F Chain F, Crystal Structure Of The E.Coli... ... Structure Of The E.Coli Seqa Protein Complexed With ... Hemimethylated Dna ... Length = ... Seqa Protein Complexed ... With Hemimethylated Dna pdb|1IU3|C Chain C, Crystal ...

  5. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24115225 >1e94E 1 443 7 449 e-162 ... pdb|1E94|F Chain F, Hslv-Hslu From E.Coli... pdb|1E94|E Chain E, Hslv-Hslu From ... E.Coli pdb|1HQY|F Chain F, Nucleotide-Dependent ...

  6. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56480239 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  7. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176300 >1us0A 2 305 26 295 5e-61 ... pdb|1MZR|B Chain B, Structure Of Dkga From E.Coli...re ... Of Dkga From E.Coli At 2.13 A Resolution Solved By ... Molecular Replacement ...

  8. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  9. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  10. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  11. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  12. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  13. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53726196 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  14. ORF Alignment: NC_000907 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000907 gi|16272918 >1etoB 1 97 1 98 9e-28 ... ref|ZP_00320663.1| COG2901: Factor for inversion... ... ref|ZP_00156839.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator [Hae

  15. ORF Alignment: NC_002528 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002528 gi|15617004 >1etoB 1 98 1 98 1e-23 ... ref|NP_240217.1| factor-for-inversion... ... DNA-binding protein fis dbj|BAB13103.1| ... factor-for-inversion stimulation protein [Buchnera ... ... aphidicola str. APS (Acyrthosiphon pisum)] pir||G84976 ... factor-for-inversion

  16. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004459 gi|27364633 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  17. ORF Alignment: NC_004603 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004603 gi|28899659 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  18. ORF Alignment: NC_004061 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004061 gi|21672661 >1etoB 1 98 1 99 3e-23 ... ref|NP_660728.1| factor-for-inversion... stimulation protein [Buchnera aphidicola ... str. Sg (Schizaphis graminum)] gb|AAM67939.1| ... factor-for-inversion

  19. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006512 gi|56461389 >1etoB 1 98 1 97 7e-25 ... ref|YP_156670.1| Factor for inversion... stimulation Fis, transcriptional activator ... [Idiomarina loihiensis L2TR] gb|AAV83121.1| Factor for ... inversion

  20. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720503 >1umqA 5 59 22 76 8e-06 ... ref|ZP_00216666.1| COG2901: Factor for inversion...ef|ZP_00221526.1| COG2901: Factor for inversion ... stimulation Fis, transcriptional activator ...

  1. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005139 gi|37681323 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  2. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006370 gi|54310477 >1etoB 1 98 1 98 7e-29 ... ref|YP_131497.1| putative factor-for-inversion... stimulation protein [Photobacterium ... profundum SS9] emb|CAG21695.1| putative ... factor-for-inversion

  3. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56414667 >1hcrA 1 48 25 72 5e-05 ... ref|YP_151742.1| inversion of adjac... ... 9150] gb|AAV78430.1| inversion of adjacent DNA; at ... locus of e14 element [Salmonella ent

  4. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  5. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  6. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30021592 >1vkpA 12 368 2 333 2e-83 ... ref|NP_833223.1| Agmatine deimina...se [Bacillus cereus ATCC 14579] gb|AAP10424.1| ... Agmatine deiminase [Bacillus cereus ATCC 14579] ...

  7. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  8. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  9. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

  10. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  11. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  12. ORF Alignment: NC_000918 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  14. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  15. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  16. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  17. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  18. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  19. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  20. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  1. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  2. ORF Alignment: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  3. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  4. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  5. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  6. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42522087 >3ncmA 2 92 125 205 3e-07 ... gb|AAQ14642.1| HK97 major tail subunit [Bacteriophage Feli...x 01] ref|NP_944848.1| ... HK97 major tail subunit [Bacteriophage Felix 01

  7. ORF Alignment: NC_000917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000917 gi|11498586 >1b0uA 5 258 11 250 4e-55 ... ref|NP_069814.1| osmoprotection p...rotein (proV) [Archaeoglobus fulgidus DSM 4304] ... gb|AAB90260.1| osmoprotection protein (proV) ... ... ... [Archaeoglobus fulgidus DSM 4304] pir||E69372 ... osmoprotection protein (proV) homolog - Arch

  8. ORF Alignment: NC_000915 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000915 gi|15645437 >1r9lA 6 291 286 549 7e-39 ... gb|AAD07866.1| osmoprotection pr...otein (proWX) [Helicobacter pylori 26695] ... pir||B64622 osmoprotection protein - Helicobacter pylor...i ... (strain 26695) ref|NP_207611.1| osmoprotection protein ... (proWX) [Helicobacter pylori

  9. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  10. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  11. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  12. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

  13. ORF Alignment: NC_000912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000912 gi|13507986 >1txoB 6 236 9 257 6e-28 ... gb|AAB96233.1| protein phoshatase ...iae ... M129] pir||S73911 protein phoshatase 2C homolog ptc1 - ... Mycoplasma pneumoniae (stra... ... ref|NP_109935.1| protein phoshatase 2C homolog; similar ... to Swiss-Prot Accession Number P3518

  14. ORF Alignment: NC_003304 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003304 gi|17934663 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  15. ORF Alignment: NC_003062 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003062 gi|15888096 >1k4iA 3 216 7 208 1e-70 ... ref|NP_531453.1| 3,4-dihydroxy-2-butanone-4-phosha...9.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclo... ... 3,4-dihydroxy-2-butanone-4-phoshate synthase (AJ000053) ... [imported] - Agrobacterium tumefaci

  16. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377726 >1k4iA 2 216 3 205 5e-67 ... ref|NP_769255.1| 3,4-dihydroxy-2-butanone-4-phosha...0.1| ... 3,4-dihydroxy-2-butanone-4-phoshate synthase/GTP ... cyclohydrolase II [Bradyrhizobiu

  17. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005126 gi|37527217 >1b12A 1 247 78 326 7e-74 ... ref|NP_930561.1| Signal peptidase I (SPase I) (Leader...| ... Signal peptidase I (SPase I) (Leader peptidase I) ... [Photorhabdus luminescens subsp. l

  18. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ASE AND NICOTINAMIDASE ... HYDROLASE (NICOTINE DEAMIDASE) [Ralstonia solanac...earum] ... ref|NP_519881.1| PROBABLE BIFUNCTIONAL PROTEIN: ... PYRAZINAMIDASE AND NICOTINAMIDAS...E HYDROLASE (NICOTINE ... DEAMIDASE) [Ralstonia solanacearum GMI1000] ... ... NC_003295 gi|17546479 >1j2rA 11 186 9 209 4e-27 ... emb|CAD15462.1| PROBABLE BIFUNCTIONAL PROTEIN: PYRAZINAMID

  19. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830716 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  20. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801201 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  1. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003197 gi|16764541 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  2. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413828 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  3. ORF Alignment: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003198 gi|16760062 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  4. ORF Alignment: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004631 gi|29142167 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  5. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16129047 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  6. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062618 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  7. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179702 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  8. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|56479819 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  9. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247224 >1smxA 1 87 39 125 1e-33 ... gb|AAG55830.1| RNase E, membrane attachment, mRNA turnover...train RIMD ... 0509952) ref|NP_287218.1| RNase E, membrane attachment, ... mRNA turnover, matu

  10. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  11. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  12. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  13. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  14. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  15. ORF Alignment: NC_006509 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  16. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605507 >2bjiA 3 266 5 313 9e-29 ... ref|NP_220293.1| Sulfite Synthesis.../biphosphate phosphatase [Chlamydia trachomatis ... D/UW-3/CX] gb|AAC68369.1| Sulfite Synthesis/bipho

  17. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605545 >1u7nA 1 327 4 316 2e-67 ... ref|NP_220331.1| FA/Phospholipid Synthesis... Protein [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68407.1| FA/Phospholipid Synthesis Prote

  18. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  19. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  20. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

  1. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556965 >1mzbA 1 134 1 130 7e-21 ... ref|NP_906780.1| PEROXIDE STRESS R...EGULATOR [Wolinella succinogenes DSM 1740] ... emb|CAE09680.1| PEROXIDE STRESS REGULATOR [Wolinella ...

  3. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

  4. ORF Alignment: NC_003075 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

  5. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675767 >1g5aA 89 627 2 535 3e-86 ... gb|AAK34662.1| dextran glucosidas...e [Streptococcus pyogenes M1 GAS] ... ref|NP_269941.1| dextran glucosidase [Streptococcus ...

  6. ORF Alignment: NC_003485 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003485 gi|19746879 >1g5aA 89 627 2 535 1e-86 ... gb|AAL98514.1| putative dextran g...lucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608015.1| putative dextran glucosidase ...

  7. ORF Alignment: NC_003485 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003485 gi|19746967 >1g5aA 98 625 11 538 6e-94 ... gb|AAL98602.1| putative dextran ...glucosidase [Streptococcus pyogenes MGAS8232] ... ref|NP_608103.1| putative dextran glucosidase ...

  8. ORF Alignment: NC_002737 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002737 gi|15675852 >1g5aA 98 625 11 538 9e-95 ... gb|AAK34747.1| putative dextran ...glucosidase [Streptococcus pyogenes M1 GAS] ... ref|NP_270026.1| putative dextran glucosidase ...

  9. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24379337 >1g5aA 90 627 3 535 7e-83 ... gb|AAN58598.1| dextran glucosidas...e DexB [Streptococcus mutans UA159] ... ref|NP_721292.1| dextran glucosidase DexB [Streptococcus ... ... ... (Exo-1,6-alpha-glucosidase) (Glucodextranase) ... Length = 533 ... Que

  10. ORF Alignment: NC_004310 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004310 gi|23502301 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  11. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52842820 >1p3dA 3 461 10 467 e-125 ... ref|YP_096619.1| UDP-N-acetylmuramate:L-alanine ligase Mur...28672.1| ... UDP-N-acetylmuramate:L-alanine ligase MurC [Legionella ... pneumophila subsp. pne

  12. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006300 gi|52425721 >1p3dA 1 463 15 477 e-153 ... ref|YP_088858.1| MurC protein [Ma...nnheimia succiniciproducens MBEL55E] gb|AAU38273.1| ... MurC protein [Mannheimia succiniciproducens M

  13. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002944 gi|41407994 >4uagA 7 413 12 470 1e-38 ... ref|NP_960830.1| MurC [Mycobacter... ... ligase (UDP-N-acetylmuramoyl-L-alanine synthetase) ... gb|AAS04213.1| MurC [Mycobacterium

  14. ORF Alignment: NC_006300 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006300 gi|52425669 >4uagA 6 428 2 453 3e-46 ... ref|YP_088806.1| MurC protein [Man...nheimia succiniciproducens MBEL55E] gb|AAU38221.1| ... MurC protein [Mannheimia succiniciproducens MB

  15. ORF Alignment: NC_002663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002663 gi|15602008 >1p3dA 1 463 17 479 e-156 ... ref|NP_245080.1| MurC [Pasteurell...a multocida subsp. multocida str. Pm70] ... gb|AAK02227.1| MurC [Pasteurella multocida subsp. ...

  16. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17986863 >1p3dA 28 461 27 463 e-121 ... ref|YP_222116.1| MurC, UDP-N-ace...tylmuramate--alanine ligase [Brucella abortus biovar ... 1 str. 9-941] gb|AAX74755.1| MurC, ...

  17. ORF Alignment: NC_006322 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006322 gi|52786856 >4uagA 8 419 4 423 5e-47 ... ref|YP_092685.1| MurC [Bacillus li...cheniformis ATCC 14580] gb|AAU41992.1| MurC ... [Bacillus licheniformis DSM 13] sp|Q65G22|MURC_BACLD

  18. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  19. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  20. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  1. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  2. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  3. ORF Alignment: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  4. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  5. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  6. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  7. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  8. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  9. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  11. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  12. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  13. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  14. ORF Alignment: NC_002679 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  15. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  16. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  17. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  18. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  19. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  20. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  1. ORF Alignment: NC_004088 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004088 gi|22125929 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  2. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  3. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  4. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  5. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  6. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  7. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  8. ORF Alignment: NC_003197 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003197 gi|16765081 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  9. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56698296 >1eljA 1 332 19 332 1e-06 ... gb|AAV96699.1| polyamine ABC trasnporte...snporter, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi D...r, periplasmic polyamine-binding protein ... [Silicibacter pomeroyi DSS-3] ref|YP_168669.1| polyamine ... ABC tra

  10. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_004572 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_003112 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56476897 >1r0wC 2 267 324 600 2e-59 ... ref|YP_158486.1| putative composite... ATP-binding transmembrane ABC transporter ... protein [Azoarcus sp. EbN1] emb|CAI07585.1| putative ... composite

  9. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21218662 >1cxqA 5 133 141 282 2e-06 ... ref|NP_624441.1| putative noncomposite... transposon transposase [Streptomyces ... coelicolor A3(2)] emb|CAB52910.1| putative noncomposite... ... transposon transposase [Streptomyces coelicolor A3(2)] ... pir||T36996 probable noncomposite

  10. ORF Sequence: NC_001135 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available h Lrs4p, located in the nucleolus; Lrs4p-Csm1p heterodimer binds to Mam1p at kinetochores during meiosis I t... NC_001135 gi|6319928 >gi|6319928|ref|NP_010009.1| Protein that forms a complex wit

  11. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179485 >1iwlA 1 182 23 204 2e-69 ... ref|YP_215902.1| periplasmic protein effects...ica ... subsp. enterica serovar Choleraesuis str. SC-B67] ... gb|AAX64821.1| periplasmic protein effects

  12. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376664 >1v7zA 1 249 5 243 8e-44 ... ref|YP_134515.1| creatinine amidoh...ydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV44809.1| creatinine amidohydrolase [Haloarcula

  13. ORF Alignment: NC_002927 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002927 gi|33600518 >1v7zA 3 253 1 251 1e-39 ... ref|NP_888078.1| putative creatini...ne amidohydrolase [Bordetella bronchiseptica RB50] ... emb|CAE32030.1| putative creatinine amidohydro

  14. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  15. ORF Alignment: NC_000853 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000853 gi|15643179 >1v7zA 3 256 7 270 9e-43 ... ref|NP_228223.1| creatinine amidoh...ydrolase, putative [Thermotoga maritima MSB8] ... gb|AAD35498.1| creatinine amidohydrolase, putative

  16. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

  17. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933548 >1v7zA 10 254 14 256 2e-44 ... emb|CAE25915.1| putative creatin...e amidohydrolase [Rhodopseudomonas palustris ... CGA009] ref|NP_945824.1| putative creatine ...

  18. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  19. ORF Alignment: NC_002928 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002928 gi|33596750 >1v7zA 3 253 1 251 8e-40 ... ref|NP_884393.1| putative creatini...ne amidohydrolase [Bordetella parapertussis 12822] ... emb|CAE37436.1| putative creatinine amidohydro

  20. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23464642 >1v7zA 5 255 7 250 1e-55 ... ref|NP_695245.1| creatinine amidohydrolase; creatin...inase [Bifidobacterium longum ... NCC2705] gb|AAN23881.1| creatinine amidohydrolase; ... creatin

  1. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56750058 >1v7zA 4 251 11 256 7e-49 ... ref|YP_170759.1| creatinine amido...hydrolase [Synechococcus elongatus PCC 6301] ... dbj|BAD78239.1| creatinine amidohydrolase [Synechoco

  2. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003318 gi|17988654 >1v7zA 9 254 21 263 2e-44 ... ref|NP_541287.1| creatininase [Br...ucella melitensis 16M] gb|AAL53551.1| creatininase ... [Brucella melitensis 16M] pir||AD3548 creatini

  3. ORF Alignment: NC_006395 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006395 gi|55376890 >1v7zA 5 250 13 257 5e-37 ... ref|YP_134741.1| creatinine amido...hydrolase [Haloarcula marismortui ATCC 43049] ... gb|AAV45035.1| creatinine amidohydrolase [Haloarcul

  4. ORF Alignment: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004311 gi|23500710 >1v7zA 10 254 1 242 2e-43 ... gb|AAN34155.1| creatinine amidohy...drolase, putative [Brucella suis 1330] ... ref|NP_700150.1| creatinine amidohydrolase, putative ...

  5. ORF Alignment: NC_004557 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004557 gi|28211518 >1v7zA 1 255 3 250 2e-62 ... ref|NP_782462.1| creatininase [Clo...stridium tetani E88] gb|AAO36399.1| creatininase ... [Clostridium tetani E88] ... Length = 248

  6. 33 CFR 117.822 - Beaufort Channel, NC.

    Science.gov (United States)

    2010-07-01

    ... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

  7. ORF Alignment: NC_005364 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... emb|CAE77440.1| phosphoglycerate mutase ... (2,3-diphosphoglycerate-independent) [Mycoplasma ... NC_005364 gi|42561347 >1o98A 2 508 4 528 e-163 ... ref|NP_975798.1| phosphoglycerate mutase (2,3-diphosphoglyc...erate-independent) ... [Mycoplasma mycoides subsp. mycoides SC str. PG1] ...

  8. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001146 gi|6324141 >gi|6324141|ref|NP_014211.1| Essential protein involved in karyoga...he spindle pole body, interacts with Spc72p during karyogamy, also interacts with Cdc31p; Kar1p [Saccharomyc

  9. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955733 >1exqA 11 145 176 318 6e-09 ... ref|YP_063021.1| transposase, undefined... [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89916.1| transposase, undefined [Leifsoni

  10. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003037 gi|16263035 >1nyoA 11 162 8 158 4e-30 ... ref|NP_435828.1| Nex18 Symbiotica...lly induced conserved protein [Sinorhizobium ... meliloti 1021] gb|AAK65240.1| Nex18 Symbiotically ... ... ... induced conserved protein [Sinorhizobium meliloti 1021] ... pir||F95334 Nex18 Symbiotically

  11. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51596443 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  12. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29376585 >1pq4B 1 288 29 305 1e-52 ... ref|NP_815739.1| endocarditis spe...cific antigen [Enterococcus faecalis V583] ... gb|AAO81809.1| endocarditis specific antigen ...

  13. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

  14. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

  15. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358092 >6mhtA 61 323 7 298 3e-31 ... ref|NP_078366.1| cytosine-specifi...ic ... methyltransferase [Ureaplasma parvum serovar 3 str. ATCC ... 700970] pir||D82880 cytosi...ne-specific methyltransferase ... UU528 [imported] - Ureaplasma urealyticu...FGMKKGSGTRSGLLWEIERILFDLQKLNQ 60 ... Query: 127 LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNY...KIEKYYQEAYLAQPNRTFSRIKYV 186 ... LNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYKIEKYYQEAYLAQPNRTFSRIKYV Sbjct: 121 LNYDGLIDSNGNILDLEAP

  16. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... antitermination factor [Ureaplasma parvum serovar 3 str. ... ATCC 700970] pir||A82874 tran...scription antitermination ... factor UU581 [imported] - Ureaplasma urealyt...icum ... Length = 137 ... Query: 24 ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLXXXXXXXXXXXXYEPSEAPRSMKN 83 ... ... ... HQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDL ... YEPSEAPRSMKN Sbjct: 1 ... HQWYIVTVVSGNEQKVIENIKDKLNGYG... NC_002162 gi|13358146 >1nz8A 2 112 24 160 9e-13 ... ref|NP_078420.1| transcription an

  17. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [imported] - ... Ureaplasma urealyticum ... Length = 313 ... Query: 8... NC_002162 gi|13357852 >1esc0 2 302 87 399 2e-29 ... ref|NP_078126.1| hypothetical protein UU292 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30701.1| conserved hypothetical ... [Ureap...7 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 146 ... KINYLAIGDSITAGFNSELGWEAPGRYDP...ITNKISGLSFPSFIAQYINKVEPNRLASYEN Sbjct: 1 ... KINYLAIGDSITAGFNSELGWEAPGRYDPITNKISGLSFPSFIAQYINKVEPNRLASYEN 60 ...

  18. ORF Alignment: NC_002162 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002162 gi|13358063 >1t71A 5 267 1 262 2e-78 ... ref|NP_078337.1| hypothetical protein UU500 [Ureap...lasma parvum serovar 3 str. ATCC ... 700970] gb|AAF30912.1| conserved hypothetical ... [Ureap...[imported] - ... Ureaplasma urealyticum ... Length = 262 ... Query: 1 ...ery: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT 180 ... ... ... GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKLSLVYGTHT Sbjct: 121 GNSIDMKGLQTNPFESLDKIIAFNEAPIHIVD

  19. 77 FR 33997 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-06-08

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Proposed... freeze on the acceptance of rulemaking petitions by full power television stations requesting channel... filed by full power television stations seeking to relocate from channel 51 pursuant to a voluntary...

  20. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

  1. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...

  2. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

  3. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

  4. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

  5. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  6. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

  7. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

  8. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

  9. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

  10. ORF Alignment: NC_003318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003318 gi|17988713 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  11. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

  12. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

  13. ORF Alignment: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004311 gi|23500656 >1gkpA 3 425 8 405 2e-19 ... ref|NP_541346.1| IMIDAZOLONEPROPIONASE / HISTIDINE AMMONIA...-LYASE [Brucella ... melitensis 16M] gb|AAL53610.1| IMIDAZOLONEPROPIONASE / ... HISTIDINE AMMON...IA-LYASE [Brucella melitensis 16M] ... pir||AG3555 histidine ammonia-lyase (

  14. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

  15. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

  16. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17987610 >1v4aA 20 435 2 420 e-106 ... gb|AAL52508.1| GLUTAMATE-AMMONIA-...LIGASE ADENYLYLTRANSFERASE [Brucella melitensis ... 16M] ref|NP_540244.1| GLUTAMATE-AMMONIA-LIGASE ...

  17. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

  18. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003317 gi|17986393 >1vdkA 1 459 12 469 e-123 ... gb|AAL51291.1| ASPARTATE AMMONIA-...LYASE [Brucella melitensis 16M] ref|NP_539027.1| ... ASPARTATE AMMONIA-LYASE [Brucella melitensis 16M

  19. ORF Alignment: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17554732 >1yovB 5 426 11 433 e-114 ... ref|NP_498534.1| UBiquitin Activating enzme related, ectop...ic membrane RuFfLes in ... embryo RFL-1, CYtoKinesis defect CYK-5 (rfl-1) ...

  20. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005126 gi|37525549 >1iwlA 1 182 22 203 4e-57 ... ref|NP_928893.1| outer-membrane lipoproteins... ... emb|CAE13895.1| outer-membrane lipoproteins carrier ... protein precursor (P20) [Photorhabdus

  1. ORF Alignment: NC_004603 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004603 gi|28897880 >1iwlA 4 181 30 207 4e-54 ... ref|NP_797485.1| outer membrane lipoproteins... carrier protein [Vibrio ... parahaemolyticus RIMD 2210633] dbj|BAC59369.1| outer ... membrane lipoproteins

  2. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58582167 >1iwlA 2 180 70 254 2e-49 ... ref|YP_201183.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas oryzae pv. oryzae KAC... carrier protein precursor [Xanthomonas ... oryzae pv. oryzae KACC10331] gb|AAW75798.1| ...

  3. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085964 >1iwlA 2 180 37 230 6e-44 ... ref|YP_047474.1| outer-membrane lipoproteins... carrier protein [Acinetobacter sp. ... ADP1] emb|CAG69652.1| outer-membrane lipoproteins

  4. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53726032 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  5. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004547 gi|50121570 >1iwlA 1 182 22 203 1e-59 ... ref|YP_050737.1| outer-membrane lipoproteins...oproteins carrier protein [Erwinia ... carotovora subsp. atroseptica SCRI104... carrier protein [Erwinia carotovora ... subsp. atroseptica SCRI1043] emb|CAG75546.1| ... outer-membrane lip

  6. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005139 gi|37679507 >1iwlA 4 181 20 197 6e-54 ... ref|NP_934116.1| outer membrane lipoproteins...tein ... carrier protein precursor dbj|BAC94087.1| outer membrane ... lipoproteins carrier pro

  7. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

  8. ORF Alignment: NC_004917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004917 gi|32265815 >1iwlA 11 178 23 174 4e-23 ... gb|AAP76913.1| outer membrane lipoproteins... carrier protein LolA [Helicobacter ... hepaticus ATCC 51449] ref|NP_859847.1| outer membrane ... lipoprotein

  9. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59711513 >1iwlA 4 181 21 198 9e-49 ... ref|YP_204289.1| outer-membrane lipoproteins... carrier protein [Vibrio fischeri ES114] ... gb|AAW85401.1| outer-membrane lipoproteins ca

  10. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34497069 >1iwlA 2 178 25 203 1e-46 ... gb|AAQ59290.1| outer membrane lipoproteins... carrier protein [Chromobacterium ... violaceum ATCC 12472] ref|NP_901284.1| outer membrane ... lipoproteins

  11. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720213 >1iwlA 3 178 47 236 2e-42 ... ref|YP_109199.1| probable outer-membrane lipoproteins... ATCC 23344] ... emb|CAH36611.1| probable outer-membrane lipoproteins ... carrier protein [Bur

  12. 78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-09-04

    ...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

  13. A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

    Science.gov (United States)

    Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

    2015-01-30

    Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Design and evaluation of the ReKon : an integrated detection and assessment perimeter system.

    Energy Technology Data Exchange (ETDEWEB)

    Dabling, Jeffrey Glenn; Andersen, Jason Jann; McLaughlin, James O. [Stonewater Control Systems, Inc., Kannapolis, NC

    2013-02-01

    Kontek Industries (Kannapolis, NC) and their subsidiary, Stonewater Control Systems (Kannapolis, NC), have entered into a cooperative research and development agreement with Sandia to jointly develop and evaluate an integrated perimeter security system solution, one that couples access delay with detection and assessment. This novel perimeter solution was designed to be configurable for use at facilities ranging from high-security military sites to commercial power plants, to petro/chemical facilities of various kinds. A prototype section of the perimeter has been produced and installed at the Sandia Test and Evaluation Center in Albuquerque, NM. This prototype system integrated fiber optic break sensors, active infrared sensors, fence disturbance sensors, video motion detection, and ground sensors. This report documents the design, testing, and performance evaluation of the developed ReKon system. The ability of the system to properly detect pedestrian or vehicle attempts to bypass, breach, or otherwise defeat the system is characterized, as well as the Nuisance Alarm Rate.

  15. Software module for geometric product modeling and NC tool path generation

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2003-01-01

    The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

  16. Large Nc from Seiberg–Witten curve and localization

    Directory of Open Access Journals (Sweden)

    Jorge G. Russo

    2015-09-01

    Full Text Available When N=2 gauge theories are compactified on S4, the large Nc limit then selects a unique vacuum of the theory determined by saddle-point equations, which remains determined even in the flat-theory limit. We show that exactly the same equations can be reproduced purely from Seiberg–Witten theory, describing a vacuum where magnetically charged particles become massless, and corresponding to a specific degenerating limit of the Seiberg–Witten spectral curve where 2Nc−2 branch points join pairwise giving aDn=0, n=1,…,Nc−1. We consider the specific case of N=2 SU(Nc SQCD coupled with 2Nf massive fundamental flavors. We show that the theory exhibits a quantum phase transition where the critical point describes a particular Argyres–Douglas point of the Riemann surface.

  17. ORF Alignment: NC_003304 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003304 gi|17935259 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

  18. ORF Alignment: NC_003062 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003062 gi|15888685 >1tjlA 17 141 10 134 5e-37 ... ref|NP_532049.1| dnaK deletion s...uppressor protein [Agrobacterium tumefaciens str. ... C58] gb|AAL42365.1| dnaK deletion suppressor pr...otein ... [Agrobacterium tumefaciens str. C58] pir||AG2743 dnaK ... deletion suppressor protei

  19. ORF Alignment: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002505 gi|15640858 >1atg0 1 226 25 253 1e-12 ... gb|AAF94004.1| accessory colonization... factor AcfC [Vibrio cholerae O1 biovar eltor ... str. N16961] ref|NP_230489.1| accessory colonization... ... factor AcfC [Vibrio cholerae O1 biovar eltor str. ... N16961] pir||F82273 accessory colonization

  20. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30248965 >1fgjA 1 499 25 523 0.0 ... ref|NP_842336.1| hydroxylamine oxid...oreductase [Nitrosomonas europaea ATCC 19718] ... ref|NP_842054.1| hydroxylamine oxidoreductase ... ... ... [Nitrosomonas europaea ATCC 19718] ref|NP_841035.1| ... hydroxylamine oxidoreductase [Nitrosomo...nas europaea ATCC ... 19718] emb|CAD85955.1| hydroxylamine oxidoreductase ... ... [Nitrosomonas europaea ATCC 19718] emb|CAD84873.1| ... hydroxylamine oxidoreductase [Nitro