WorldWideScience

Sample records for stadium kannapolis nc

  1. Stadium seating--a market analysis.

    Science.gov (United States)

    Jerry A. Sesco; Edwin Kallio

    1967-01-01

    This report describes the characteristics of stadiums and seating in six North Central States; summarizes the purchasing methods for stadium seats; presents estimates of the present and future market; and points out the increasing competition to wood stadium seating form substitute materials.

  2. Stadium Relocation in Professional Football

    DEFF Research Database (Denmark)

    Junghagen, Sven; Lillo, Gonzalo Leal

    The aim of this paper is to conceptually illustrate the tension between commercialisation and club authenticity, which is a potential consequence of stadium relocation. There is a commercial pressure for relocating a football club to new and more modern facilities, but also a pressure from...

  3. Structural design of Kaohsiung Stadium, Taiwan

    Science.gov (United States)

    Watanabe, Hideyuki; Tanno, Yoshiro; Nakai, Masayoshi; Ohshima, Takashi; Suguichi, Akihiro; Lee, William H.; Wang, Jensen

    2013-01-01

    This paper presents an outline description of the structural design of the main stadium for the World Games held in Kaohsiung City, Taiwan, in 2009. Three new design concepts, unseen in previous stadiums, were proposed and realized: “an open stadium”, “an urban park”, and “a spiral continuous form”. Based on the open stadium concept, simple cantilever trusses in the roof structure were arranged in a delicate rhythm, and a so-called oscillating hoop of steel tubes was wound around the top and bottom surfaces of a group of cantilever trusses to form a continuous spiral form. Also, at the same time by clearly grouping the structural elements of the roof structure, the dramatic effect of the urban park was highlighted by unifying the landscape and the spectator seating area to form the stadium facade. This paper specifically reports on the overview of the building, concepts of structural design, structural analysis of the roof, roof design, foundation design, and an outline of the construction.

  4. Aspects of diffusion in the stadium billiard

    Science.gov (United States)

    Lozej, Črt; Robnik, Marko

    2018-01-01

    We perform a detailed numerical study of diffusion in the ɛ stadium of Bunimovich, and propose an empirical model of the local and global diffusion for various values of ɛ with the following conclusions: (i) the diffusion is normal for all values of ɛ (≤0.3 ) and all initial conditions, (ii) the diffusion constant is a parabolic function of the momentum (i.e., we have inhomogeneous diffusion), (iii) the model describes the diffusion very well including the boundary effects, (iv) the approach to the asymptotic equilibrium steady state is exponential, (v) the so-called random model (Robnik et al., 1997) is confirmed to apply very well, (vi) the diffusion constant extracted from the distribution function in momentum space and the one derived from the second moment agree very well. The classical transport time, an important parameter in quantum chaos, is thus determined.

  5. 2010 FIFA World Cup stadium investment: Does the post-event ...

    African Journals Online (AJOL)

    This paper determines whether the substantial investments into the stadiums' infrastructure are justified by the utilisation of the stadiums after the 2010 FIFA World Cup event. A utilisation rate and a stadium usage index were used to analyse the utilisation benefits derived from the stadiums. Generally, the results suggest ...

  6. Vertical motion and ''scarred'' eigenfunctions in the stadium billiard

    International Nuclear Information System (INIS)

    Christoffel, K.M.; Brumer, P.

    1985-01-01

    A subset of pseudoregular eigenfunctions of the classically chaotic stadium billiard is shown to participate strongly in vertically directed motion, supporting the conjectures of McDonald and of Heller regarding periodic orbits and pseudoregular eigenfunctions

  7. Noise exposure, characterization, and comparison of three football stadiums.

    Science.gov (United States)

    Engard, Derek J; Sandfort, Delvin R; Gotshall, Robert W; Brazile, William J

    2010-11-01

    Personal noise exposure samples were collected from five workers at a large-sized college football stadium and five workers at a medium-sized college football stadium in northern Colorado during three home football games, for a total of 30 personal noise exposures. In addition, personal noise exposure samples were collected from five fans at a National Football League (NFL) stadium, and from two fans at each of the college stadiums during three home football games, for a total of 27 personal noise exposure samples. None of the workers' noise doses were above the Occupational Safety and Health Administration (OSHA) permissible exposure limit of 90 dBA. However, 11 of 28 (39%) workers' noise doses exceeded the OSHA action level of 85 dBA that would require enrollment in a hearing conservation program. Following ACGIH® recommendations for noise exposure limits, 27 of 28 (96%) workers would be considered overexposed. In addition, 24 of 25 fans (96%) were also overexposed according to ACGIH and World Health Organization recommendations. At the 95% confidence level, workers' and fans' noise exposures were not significantly different between the three stadiums. However, there was significant noise level variability between the games in each individual stadium (e.g., 82 dbA vs. 87 dbA mean worker OSHA noise exposure for two games at the large-sized college stadium, p=0.001). Given the personal sampling results for the stadium workers, the investigators believe that stadium management at these two universities should implement a hearing conservation program and provide hearing protection. Management should include a warning of possible loud-noise exposure during any sporting events held at the stadiums in fan guides, pamphlets, websites, or other appropriate communication tools. This information should include the health effects of loud noise exposure, namely, noise-induced hearing loss, the information should also be specifically targeted to parents of young children

  8. Alcohol control policies and practices at professional sports stadiums.

    Science.gov (United States)

    Lenk, Kathleen M; Toomey, Traci L; Erickson, Darin J; Kilian, Gunna R; Nelson, Toben F; Fabian, Lindsey E A

    2010-01-01

    Alcohol-related problems such as assaults and drinking-driving at or near professional sporting events are commonly reported in the media. An important strategy to reduce such problems may be the use of alcohol control policies at sports stadiums. The objective of this study was to examine alcohol control policies and practices at professional sports stadiums in the U.S. We conducted a telephone survey of food/beverage managers from 66 of the 100 U.S professional sports stadiums that house a professional hockey, basketball, baseball, and/or football team. The survey consisted of 18 items pertaining to policies regulating alcohol sales and consumption. Most managers indicated that their stadium had a range of alcohol control policies and practices. For example, all or nearly all reported their stadium allows no more than two alcoholic beverages per sale and their alcohol servers are required to check age identification of patrons who appear younger than age 30. In contrast, only about half prohibit servers younger than 21 years of age from selling alcohol both in seating areas and at concession booths, and approximately one-third designate sections of their stadiums as alcohol-free. Although we found that some alcohol control policies appear to be common across stadiums, others are uncommon, leaving room for potential areas of improvement in reducing or preventing alcohol-related problems at professional sporting events. The results provide an important starting point for identifying policies that can be evaluated to determine their effectiveness in reducing alcohol-related injuries and deaths at sporting events.

  9. SALTSTONE MATRIX CHARACTERIZATION AND STADIUM SIMULATION RESULTS

    Energy Technology Data Exchange (ETDEWEB)

    Langton, C.

    2009-07-30

    SIMCO Technologies, Inc. was contracted to evaluate the durability of the saltstone matrix material and to measure saltstone transport properties. This information will be used to: (1) Parameterize the STADIUM{reg_sign} service life code, (2) Predict the leach rate (degradation rate) for the saltstone matrix over 10,000 years using the STADIUM{reg_sign} concrete service life code, and (3) Validate the modeled results by conducting leaching (water immersion) tests. Saltstone durability for this evaluation is limited to changes in the matrix itself and does not include changes in the chemical speciation of the contaminants in the saltstone. This report summarized results obtained to date which include: characterization data for saltstone cured up to 365 days and characterization of saltstone cured for 137 days and immersed in water for 31 days. Chemicals for preparing simulated non-radioactive salt solution were obtained from chemical suppliers. The saltstone slurry was mixed according to directions provided by SRNL. However SIMCO Technologies Inc. personnel made a mistake in the premix proportions. The formulation SIMCO personnel used to prepare saltstone premix was not the reference mix proportions: 45 wt% slag, 45 wt% fly ash, and 10 wt% cement. SIMCO Technologies Inc. personnel used the following proportions: 21 wt% slag, 65 wt% fly ash, and 14 wt% cement. The mistake was acknowledged and new mixes have been prepared and are curing. The results presented in this report are assumed to be conservative since the excessive fly ash was used in the SIMCO saltstone. The SIMCO mixes are low in slag which is very reactive in the caustic salt solution. The impact is that the results presented in this report are expected to be conservative since the samples prepared were deficient in slag and contained excess fly ash. The hydraulic reactivity of slag is about four times that of fly ash so the amount of hydrated binder formed per unit volume in the SIMCO saltstone samples is

  10. Large Nc

    Science.gov (United States)

    Jenkins, Elizabeth E.

    2009-12-01

    The 1/Nc expansion of QCD with Nc = 3 has been successful in explaining a wide variety of QCD phenomenology. Here I focus on the contracted spin-flavor symmetry of baryons in the large-Nc limit and deviations from spin-flavor symmetry due to corrections suppressed by powers of 1/Nc. Baryon masses provide an important example of the 1/Nc expansion, and successful predictions of masses of heavy-quark baryons continue to be tested by experiment. The ground state charmed baryon masses have all been measured, and five of the eight ground state bottom baryon masses have been found. Results of the 1/Nc expansion can aid in the discovery of the remaining bottom baryons. The brand new measurement of the Ωb- mass by the CDF collaboration conflicts with the original D0 discovery value and is in excellent agreement with the prediction of the 1/Nc expansion.

  11. 2010 FIFA World Cup stadium investment: Does the post-event ...

    African Journals Online (AJOL)

    Abstract. This paper provides an ex-post analysis of the utilisation of the stadiums that were built for the 2010 FIFA World Cup. The South African government invested approximately US$1.57 billion and US$523 million into the development of new stadiums and upgrades to existing stadiums, respectively. This paper.

  12. Recognizing chaotic states in stadium billiard by calculating gyration radius

    Directory of Open Access Journals (Sweden)

    M. Barezi

    2006-12-01

    Full Text Available   Nowadays study of chaotic quantum billiards because of their relation to Nano technology. In this paper distribution of zeros of wave function on the boundary of two circular and stadium billiards are investigated. By calculating gyration radius for these points chaotic and non-chaotic states are distinguished.

  13. Integrated Brand Promotion – Advertisement for STADIUM OY

    OpenAIRE

    Mai, Tung

    2014-01-01

    This project-based thesis is an advertisement for Stadium Oy. In 23 years of leading marketing department, Stadium’s marketing manager had to say this is a pioneer time when Stadium’s outsources an advertising project to an external individual resource. The project, therefore, consists a number of business partners so that professional quality is guaranteed to deliver. STADIUM’s advertising strategy stays committed to the company’s business model and its mission. This directly affec...

  14. Typology of Retractable Roof Structures in Stadiums and Sports Halls

    Directory of Open Access Journals (Sweden)

    Andrej Mahovič

    2015-10-01

    Full Text Available Retractable roof structures are one of the four fundamental systems (in addition to the playing area, stands and facade in a stadium and sports hall. The roof protects users against various weather conditions and creates optimum circumstances for carrying out different activities. Stadiums and sports halls with retractable roof structures can host a greater variety of activities, improve the quality of their implementation and the quality of visitors’ experience, and affect the perception and experience of people using or observing such buildings. A retractable roof structure allows for natural lighting and ventilation of the venue, gives optimal conditions for grass growth on the playing field, and reduces costs of use and maintenance of the building. Different typologies of movement of roof structures (frequency of opening and closing, design of the structure, and methods of movement are categorised in terms of their architectural and structural design. Application of different retractable roof systems worldwide is indicator of their effectiveness and efficiency, and is basis for use of movement also in other fundamental systems of stadiums and sports halls. Research and identification of characteristics of retractable roof structures lead to the design of new moving systems that can with the application of the moving principle change the purpose of movable elements or assume the characteristics of other fundamental systems.

  15. Home field advantage: new stadium construction and team performance in professional sports.

    Science.gov (United States)

    Watson, Jack C; Krantz, Andrew J

    2003-12-01

    To identify the relations between new stadiums and home team performance and attendance for professional baseball (MLB) (n=14), basketball (NBA) (n=13), and football (NFL) (n=25) teams in the USA since 1950 dependent t tests assessed significance of increases in attendance in both MLB and the NBA and a significantly improved home winning percentage in MLB following the building of new stadiums. Implications include a better understanding of the rationales used by owners, fans, and players for building new stadiums.

  16. DOES THE HOME ADVANTAGE DEPEND ON CROWD SUPPORT? EVIDENCE FROM SAME-STADIUM DERBIES

    OpenAIRE

    Michela Ponzo; Vincenzo Scoppa

    2014-01-01

    We investigate to what extent crowd support contributes to the home advantage in soccer, disentangling this effect from other mechanisms such as players’ familiarity with the stadium and travel fatigue. To evaluate the relevance of crowd support in determining home advantage we analyze same-stadium derbies (matches among teams that share the same stadium) in which teams enjoy different levels of support from the crowd – the home team has many more supporters, mainly because of season ticket h...

  17. Recycling at Penn State's Beaver Stadium. "Recycle on the Go" Success Story

    Science.gov (United States)

    US Environmental Protection Agency, 2009

    2009-01-01

    With a 13-year-old recycling program, The Pennsylvania State University's (Penn State) Beaver Stadium in the past diverted nearly 30 tons of recyclables per year from local landfills. A new initiative to promote recycling in the stadium's tailgating area has helped Penn State more than triple its old recycling record, collecting 112 tons in 2008.…

  18. "We make a big effort to bring out the ladies": visual representations of women in the modern American stadium.

    Science.gov (United States)

    Lisle, Benjamin D

    2011-01-01

    Modern stadiums were constructed across the United States in the 1960s and 1970s, usually to replace old baseball parks that were run-down, inaccessible by automobile, and located near African American neighbourhoods. Sports promoters coveted affluent, white, consumption-oriented customers who had recently moved to the suburbs. To attract these customers, promoters attempted to imaginatively reconstitute stadium space - from urban, old, dirty, rambunctious, masculine places to suburban, new, clean, orderly, female-friendly spaces. The attraction of women - as signifiers of an affluent and domesticated postwar social order - was central to this strategy. Visual representations of women in new stadium spaces were essential to the imaginative reconfiguration and modernisation of stadium space. This essay examines their use, particularly in the Houston Astrodome. Stadium publications and local newspapers used photographs and illustrations of women to conceptually reinvent the stadium, extending a distinctively post-war, modern ideology privileging comfort, consumption and respectable behaviour into stadium space.

  19. Renewable Energy Initiatives at Canadian Sport Stadiums: A Content Analysis of Web-Site Communications

    Directory of Open Access Journals (Sweden)

    Chris Chard

    2013-11-01

    Full Text Available Researchers have positioned renewable energy as sustainable and able to mitigate environmental issues associated with fossil fuels. Further, sustainable initiatives have been offered as a point of differentiation for brands. In order to reap the benefits of such differentiation, managers must communicate the initiatives to relevant stakeholders. The research question guiding the current investigation thus was: What is the communication by Canadian sport stadium operators to calls for sustainable initiatives, specifically in the area of renewable energy? The examination included the 15 sport stadiums that hosted a professional team in Canada and their web-based stadium communications on renewable energy (SCORE. Understandings and competencies in renewable energy are proposed as a new function of sport stadium management; communication of these competencies is seen as a key point of differentiation and best practice.

  20. Solar energy from the roof of a stadium; Sonnenenergie vom Stadiondach

    Energy Technology Data Exchange (ETDEWEB)

    Mayer, C. M.

    2005-07-01

    This article describes the photovoltaic power generation plant installed on the roof of the new Swiss national sports-stadium 'Stade de Suisse' in Berne, Switzerland. This new complex houses not only a football stadium but also a shopping centre, offices and apartments. On the roof of the stadium, around 6,000 m{sup 2} of solar cells have been installed providing 850 kW peak power capacity. This is, at the present time, the largest photovoltaics installation in Switzerland. The article describes the multi-functional urban development which has been developed by investors from the insurance and detail trade areas. The construction of the stadium's roof and the solar installation are described, as is the visitor's centre located in a tower overlooking the stadium and the solar roof. The article also briefly describes the special football field floodlighting system. that was specially designed to meet the needs of television outside broadcasts made from the stadium.

  1. The Research on Application of Information Technology in sports Stadiums

    Science.gov (United States)

    Can, Han; Lu, Ma; Gan, Luying

    With the Olympic glory in the national fitness program planning and the smooth development of China, the public's concern for the sport continues to grow, while their physical health is also increasingly fervent desired, the country launched a modern technological construction of sports facilities. Information technology applications in the sports venues in the increasingly wide range of modern venues and facilities, including not only the intelligent application of office automation systems, intelligent systems and sports facilities, communication systems for event management, ticket access control system, contest information systems, television systems, Command and Control System, but also in action including the use of computer technology, image analysis, computer-aided training athletes, sports training system and related data entry systems, decision support systems.Using documentary data method, this paper focuses on the research on application of information technology in Sports Stadiums, and try to explore its future trends.With a view to promote the growth of China's national economyand,so as to improve the students'quality and promote the cause of Chinese sports.

  2. For a Green Stadium: Economic Feasibility of Sustainable Renewable Electricity Generation at the Jeju World Cup Venue

    OpenAIRE

    Eunil Park; Sang Jib Kwon; Angel P. del Pobil

    2016-01-01

    After the 2002 FIFA World Cup in South Korea and Japan, the local governments of South Korea were left in charge of several large-scale soccer stadiums. Although these governments have made significant efforts toward creating profits from the stadiums, it is proving to be too difficult for several administrations to cover their full operational, maintenance, and conservation costs. In order to overcome this problem, one of the governments, Seogwipo City, which owns Jeju World Cup Stadium (JWC...

  3. Evidence of a reduced home advantage when a team moves to a new stadium.

    Science.gov (United States)

    Pollard, Richard

    2002-12-01

    Home advantage is well documented for professional baseball, basketball and ice hockey in North America. One of the possible causes of this advantage is familiarity with the local playing facility. This was investigated and quantified in an analysis of 37 teams moving to new stadiums, but in the same city, from 1987 to 2001. Home advantage during the first season in a new stadium after the move was significantly less than home advantage in the final season in the old stadium (P= 0.011). The reduction was evident in all three sports. Possible confounding factors, such as crowd size and crowd density, were considered but did not appear to have an effect. It is estimated that about 24% of the advantage of playing at home maybe lost when a team relocates to a new facility.

  4. The Woodenest. Stadium by ZHA in the South-West of England

    Directory of Open Access Journals (Sweden)

    Nina Frolova

    2017-03-01

    Full Text Available The Forest Green Rovers Stadium (Stroud, UK designed by Zaha Hadid Architects will be built almost entirely of wood – the first time that will have been done anywhere in the world. The use of wood will ensure reduction of carbon dioxide emissions. Being a renewable resource, wood will also enhance the ecological characteristics of the building. The stadium’s roof is covered with a transparent membrane, which minimizes shadows and does not prevent the growth of grass on the stadium. The position of all the seats provides excellent views of the field. The first stage of building is planned for 5,000 spectators, increasing to 10,000 at the second stage. The stadium will be a part of the Eco Park development with the total area of 40 ha.

  5. The Impact of the Stadium in the Supporter’s Consumption: How Does the Frequency at The Stadium Boosts the Demand for the Clubs’

    Directory of Open Access Journals (Sweden)

    Fernando A. Fleury

    2014-12-01

    Full Text Available The aim of this study is to investigate the relationship between the presence of supporter in the stadium, which demonstrates the supporter’s involvement with his soccer club, and its influence on the purchase of official products of the 12 largest Brazilian brands of soccer clubs. In this research, it was collected information from 1,296 supporters who responded to a questionnaire with 22 questions. It was defined as involvement with their soccer club the frequency this supporter goes to the stadium. In order to determine the consumption relationship it were used variables such as frequency of purchase of official products, the annual amount spent on such products, favorite venue to purchase and assortment of the products mix. For the supporters buying preferences analysis, it was applied the technique of correspondence analysis (Anacor. As a result, we can point out that the supporters’ loyalty, driven by the relationship marketing, is one of the catalysts for increasing the soccer clubs revenue, since the higher the products and average tickets purchase frequency, the more this frequency is associated with a higher number of attendance to the stadium, as well as the variety in the mix of products acquired by the supporter. In this sense, the work points to the importance of building a long term relationship which goes beyond the emotional bond with the club, reaching the brand products consumption.

  6. Recovery of heat from the refrigeration plant at the Bjoerkaeng stadium in Huddinge

    Energy Technology Data Exchange (ETDEWEB)

    Glas, L.O.

    1984-01-01

    The report describes an investigation of heat recovery from the refrigeration plant at the ice hockey rinks outdoors and in the stadium building at the Bjoerkaeng athletics centre. Heat emitted by the refrigeration plant is utilized for heating of the stadium building and for heating water. The heat recovery was measured and analysed over the period 1.12.78-30.11.79, a net energy saving of approximately 380,000 kWh being achieved. The heat recovery analysis comprises a complete heat balance for the ice hockey rinks, the ice stadium, the water heating and the refrigeration plant. On average, test results are very near the figures produced by calculations. The calculation method described should therfore reproduce with good accuracy the possible energy savings in refrigeration plants for ice rinks both indoors and outdoors, of widely differing sizes and geographical location. For instance, the calculation takes into account the effect of the ice stadium temperature selected on the net energy saving and the recoverable quantity of heat.

  7. German money for Brazilian football stadiums; Deutsche Foerderung fuer brasilianische Stadien

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Cristina

    2011-07-01

    Solar energy is still a niche market in the world's fifth biggest state. According to present plants, the country intends rather to rely on hydroelectric power, bioenergy and wind power. Now, solar football stadiums for the 2014 World Cup are to get politicians and investors interested in photovoltaic conversion. They are sponsored by the KfW Entwicklungsbank and GIZ.

  8. Penanganan Kanker Prostat Stadium II Pada Penderita Berusia 70 Tahun Atau Lebih: Pengalaman Dua Rumah Sakit Tersier Di Jakarta

    OpenAIRE

    Umbas, Rainy

    2009-01-01

    Saat ini, terdapat beberapa cara pengobatan kanker prostat dan usia penderita merupakan salah satu faktor untuk menentukan pilihan pengobatan selain derajat dan stadium penyakit. Tujuan penelitian ini adalah untuk mengetahui cara dan hasil pengobatan penderita kanker prostat stadium II yang berusia 70 tahun atau lebih di rumah sakit Cipto Mangunkusumo dan rumah sakit kanker Dharmais, Jakarta. Selama periode Januari 1995 sampai dengan Desember 2007, terdapat 74 penderita kanker prostat sesuai ...

  9. A Spatial and Temporal Characterization of the Background Neutron Environment at the Navy and Marine Corps Memorial Stadium

    Science.gov (United States)

    2017-04-01

    Naval Academy Annapolis, MD Abstract This project utilized neutron detection near the Naval Academy football stadium in order to map and quantify...Introduction The Navy and Marine Corps Memorial Stadium is the U.S. Naval Academy’s football venue in Annapolis, Maryland, with a seating capacity of...16% over an eight-hour period. The temporal trends for the neutron background indicate that weather may be the driving force . There is potential

  10. Confirmatory factor analysis for indicators of perceived environmental quality of the stadium (IPEQS).

    Science.gov (United States)

    Manca, Sara; Fornara, Ferdinando

    2015-09-01

    Studies conducted in the 1980s (see Canter et al. in Football in its place. An environmental psychology of football grounds. Routledge, London, 1989) highlighted the prominent role of the spatial-physical features of football grounds in influencing users' perception of safety, comfort, and general satisfaction towards the stadium experience. In particular, the importance of fulfilling the spectators' needs of personal space (e.g. presence of an open view, proper distance between the seats) and movement opportunity was analysed. The aim of this study is to confirm the factorial structure of a set of indicators--the IPEQS--concerning the perceived quality of an array of aspects (i.e. architectural, social, functional, and safety issues) related to the stadium design. Participants (N = 255), who were selected on the basis of their stadium experience, filled in a self-report questionnaire measuring a set of indicators developed on the basis of both validated tools [i.e. the perceived residential environment quality indicators (PREQIs): Bonaiuto et al. in J Environ Psychol 19:331-352, 1999] and outcomes of semi-structured interviews. Confirmatory factor analyses (CFA) were performed for each scale, and reliability assessments were then carried out for each indicator. IPEQS' factorial structures found through the CFA procedure substantially confirm the results of exploratory factor analyses run with previous data. Outcomes of this study should provide a useful tool for managers and designers of football grounds, in order to improve the overall experience of the spectators.

  11. Locating Intermediality: Socialization by Communication and Consumption in the Popular Cultural Third Places of the Music Club and Football Stadium

    Directory of Open Access Journals (Sweden)

    Christoph Jacke

    2009-12-01

    Full Text Available Based on two different case studies in the realm of popular culture, my contribu-tion will clarify the mechanisms involved in the (symbolic production and con-sumption of space. The music club and the soccer stadium function much in the same way, as interfaces between producers and consumers of places, prompting "pro-sumption of space" (Raumprosumenten. A loss of function in such "third places" cannot be linked to the transition from informal cellar clubs to (soberly designed regional discos outside the city - or from the national-league stadium to the World Cup arena (also outside the city. Nor can it be attributed to the me-diatization of these spaces by technology. On the contrary, we find an exponentia-tion of what third places had always already been, spaces of "intermediality" (be-tween work and leisure, between seriousness and play, between young people and adults. In the World Cup stadium, unique events, experiences and communicative propensities are produced in a highly consistent manner by means of communica-tion on different levels in series. In such cases, the spectators in the stadium, just like visitors to music clubs, rarely behave as passive consumers of what is staged, yet both groups contribute by their presence and symbolic activity to the success of such productions in the stadium and the club.

  12. A family of stadium-like billiards with parabolic boundaries under scaling analysis

    Energy Technology Data Exchange (ETDEWEB)

    Livorati, Andre L P; Loskutov, Alexander; Leonel, Edson D, E-mail: andrelivorati@gmail.com [Departamento de EstatIstica, Matematica Aplicada e Computacao, Univ. Estadual Paulista, Av.24A, 1515, Bela Vista, CEP: 13506-900, Rio Claro, SP (Brazil)

    2011-04-29

    Some chaotic properties of a family of stadium-like billiards with parabolic focusing components, which is described by a two-dimensional nonlinear area-preserving map, are studied. Critical values of billiard geometric parameters corresponding to a sudden change of the maximal Lyapunov exponent are found. It is shown that the maximal Lyapunov exponent obtained for chaotic orbits of this family is scaling invariant with respect to the control parameters describing the geometry of the billiard. We also show that this behavior is observed for a generic one-parameter family of mapping with the nonlinearity given by a tangent function.

  13. A family of stadium-like billiards with parabolic boundaries under scaling analysis

    International Nuclear Information System (INIS)

    Livorati, Andre L P; Loskutov, Alexander; Leonel, Edson D

    2011-01-01

    Some chaotic properties of a family of stadium-like billiards with parabolic focusing components, which is described by a two-dimensional nonlinear area-preserving map, are studied. Critical values of billiard geometric parameters corresponding to a sudden change of the maximal Lyapunov exponent are found. It is shown that the maximal Lyapunov exponent obtained for chaotic orbits of this family is scaling invariant with respect to the control parameters describing the geometry of the billiard. We also show that this behavior is observed for a generic one-parameter family of mapping with the nonlinearity given by a tangent function.

  14. Staduim Management Information System. A Casestudy Of Dan Anyiam Stadium Owerri Nigeria

    Directory of Open Access Journals (Sweden)

    Amanze B.C

    2015-08-01

    Full Text Available ABSTRACT This paper was centered on computerized stadium information management system. It is worthy to note that the current process of information management is being operated manually and due to this procedure numerous problems are encountered especially in the management of the crowd and ticket processing. The motivation of the software is to eliminate the manual procedures in the stadium and proper auditing is carried out in ensuring that those selling the tickets are authorized personal. The objective of the system is to successfully implement the computerized procedure and to overcome the obstacle that would hinder the successful implementation of the system. Research methodology practical and objective research techniques was used to outlines the way in which research was undertaken and among other things. The new system which is the expected data provides management software and advisory services to the sports and entertainment sector the new system was designed using Microsoft visual studio 2010 Ultimate as the front end and Microsoft SQL server as the back end. This language was chosen because it is easy to read and understand. It is real time and user friendly.

  15. Identifying Risk Factors of Boot Procurement: A Case Study of Stadium Australia

    Directory of Open Access Journals (Sweden)

    Marcus Jefferies

    2012-11-01

    Full Text Available Private sector input into the procurement of public works and services is continuing to increase. This has partly arisen out of a requirement for infrastructure development to be undertaken at a rate that maintains and allows growth. This has become a major challange for the construction industry that cannot be met by government alone. The emergence of Build-Own-Operate-Transfer (BOOT schemes as a response to this challange provides a means for developing the infrastructure of a country without directly impacting on the governments budgetary constraints. The concepts of BOOT are without doubt extremely complex arrangements, which bring to the construction sector risks not experienced previously. Many of the infrastructure partnerships between public and private sector in the pastare yet to provide evidence of successful completion, since few of the concession periods have expired. This paper provides an identified list of risk factors to a case study of Stadium Australia. The most significant risk associated with Stadium Australia include the bidding process, the high level of public scrutiny, post-Olympic Games facility revenue and the complicated nature of the consortium structure.  

  16. A Study of Factors Affecting the Demand for Watching Football in Stadiums

    Directory of Open Access Journals (Sweden)

    Ehsan Javanmardi

    2011-01-01

    Full Text Available This paper is to find the factors effective on football matches watching demand in stadiums. The factors effective on the demand are divided into 4 categories; economical, environmental, appeal, and geographical / demographical factors which converted into 23 independent parameters by virtue of the device appropriate to gather related information. In this research, Iranian super league was selected as the subject of the study and We limited our study to three cities; Shiraz, Isfahan, and Tehran. Finally by virtue of estimating the regressions and estimating the Ordinary Least Square and Minitab software three equations were gained to foresee the number of the spectators. Validation of the models was conducted by lack of fit test, studies on the remnants such as Darling - Anderson test of normality, and Durbin Watson statistics for remnant independence test and the issue of their variance being fixed, and the study of lack of complex collinearity between independent variables using Variance Inflation Factor (VIF. We used step - by - step regression method and regression of all probable conditions. By virtue of the conclusions of the regression equations we found that there is a structural difference between capital and the cities and the factors creating attractions such as their recent successes, history and the quality of the teams have the most effects on the fans’ demand to attend in the stadiums.

  17. Stadium Coltan

    NARCIS (Netherlands)

    Wakenge, Claude Iguma

    2017-01-01

    In the Democratic Republic of Congo (DRC), the mining sector has the potential to play a pivotal role in post-conflict reconstruction (World Bank, 2008), and artisanal mining sustains the livelihoods of millions people in the country (PACT, 2010). However, in the last 15 years, minerals from this

  18. Stadium Coltan

    NARCIS (Netherlands)

    Wakenge, Claude Iguma

    2017-01-01

    In the Democratic Republic of Congo (DRC), the mining sector has the potential to play a pivotal role in post-conflict reconstruction (World Bank, 2008), and artisanal mining sustains the livelihoods of millions people in the country (PACT, 2010). However, in the last 15 years, minerals from this

  19. The Moses Mabhida Medical Plan: medical care planning and execution at a FIFA2010 stadium; the Durban experience

    Science.gov (United States)

    Hardcastle, Timothy C; Naidoo, Mergan; Samlal, Sanjay; Naidoo, Morgambery; Larsen, Timothy; Mabasu, Muzi; Ngema, Sibongiseni

    2010-01-01

    Aim This paper aims to outline the medical services provided at the Moses Mabhida Stadium, Durban, South Africa for the Fédération Internationale de Football Association (FIFA) 2010 Soccer World Cup and audit the clinical services delivered to persons seeking medical assistance. Methods Descriptive report of the medical facilities at the Moses Mabhida Stadium including the staff deployment. Retrospective data review of medical incident reports from the Stadium Medical Team. Results Medical staffing exceeded the local norms and was satisfactory to provide rapid intervention for all incoming patients. Senior medical presence decreased the transport to hospital rate (TTHR). A total of 316 spectators or support staff were treated during the seven matches played at the stadium. The majority of patients were male (60%), mostly of local origin, with mostly minor complaints that were treated and discharged (88.2% Green codes). The most common complaints were headache, abdominal disorders, and soft-tissue injuries. One fatality was recorded. The patient presentation rate (PPR) was 0.66/10,000 and the TTHR was overall 4.1% of all treated patients (0.027/10,000 spectators). Conclusion There was little evidence to guide medical planning for staffing from the FIFA governing body. Most patients are treated and released in accordance with international literature, leading to low TTHR rates, while PPR was in line with international experience. Headache was the most common medical complaint. The blowing of Vuvuzelas® may have influenced the high headache rate. PMID:27147844

  20. Karakteristik dan Kesintasan Penyakit Ginjal Kronik Stadium 3 dan 4 pada Anak di Departemen Ilmu Kesehatan Anak FKUI-RSCM

    Directory of Open Access Journals (Sweden)

    Swanty Chunnaedy

    2016-11-01

    Kesimpulan. Penyakit ginjal kronik stadium 3 dan 4 sedikit lebih banyak terjadi pada perempuan dengan etiologi terbanyak adalah glomerulonefritis. Komplikasi yang paling sering adalah gangguan elektrolit, anemia, perawakan pendek, gizi kurang, dan hipertensi. Median kesintasan keseluruhan adalah 57,13 bulan (IK 95 % 11,18 sampai 103,09.

  1. STRUCTURAL SAFETY ANALYSIS OF STADIUMS FOR THE 2018 FIFA WORLD CUP IN RUSSIA. FORMULATION OF PROBLEMS OF STRUCTURAL ANALYSIS

    Directory of Open Access Journals (Sweden)

    Alexander M. Belostotsky

    2018-03-01

    Full Text Available The article presents structural safety analysis of the three-dimensional long-span systems “ground base – reinforced concrete foundation structures and stands - metal structures of the coating and facades” of football stadiums for the 2018 World Cup in Russia with basic and special combinations of loads and formulation problems of future in-vestigations.

  2. For a Green Stadium: Economic Feasibility of Sustainable Renewable Electricity Generation at the Jeju World Cup Venue

    Directory of Open Access Journals (Sweden)

    Eunil Park

    2016-09-01

    Full Text Available After the 2002 FIFA World Cup in South Korea and Japan, the local governments of South Korea were left in charge of several large-scale soccer stadiums. Although these governments have made significant efforts toward creating profits from the stadiums, it is proving to be too difficult for several administrations to cover their full operational, maintenance, and conservation costs. In order to overcome this problem, one of the governments, Seogwipo City, which owns Jeju World Cup Stadium (JWCS, is attempting to provide an independent renewable electricity generation system for the operation of the stadium. The current study therefore examines potential configurations of an independent renewable electricity generation system for JWCS, using HOMER software. The simulation results yield three optimal system configurations with a renewable fraction of 1.00 and relatively low values for the cost of energy ($0.405, $0.546, and $0.692 per kWh. Through the examination of these three possible optimal configurations, the implications and limitations of the current study are presented.

  3. Decay of energy and suppression of Fermi acceleration in a dissipative driven stadium-like billiard.

    Science.gov (United States)

    Livorati, André L P; Caldas, Iberê L; Leonel, Edson D

    2012-06-01

    The behavior of the average energy for an ensemble of non-interacting particles is studied using scaling arguments in a dissipative time-dependent stadium-like billiard. The dynamics of the system is described by a four dimensional nonlinear mapping. The dissipation is introduced via inelastic collisions between the particles and the moving boundary. For different combinations of initial velocities and damping coefficients, the long time dynamics of the particles leads them to reach different states of final energy and to visit different attractors, which change as the dissipation is varied. The decay of the average energy of the particles, which is observed for a large range of restitution coefficients and different initial velocities, is described using scaling arguments. Since this system exhibits unlimited energy growth in the absence of dissipation, our results for the dissipative case give support to the principle that Fermi acceleration seems not to be a robust phenomenon.

  4. Sports betting marketing during sporting events: a stadium and broadcast census of Australian Football League matches.

    Science.gov (United States)

    Thomas, Samantha; Lewis, Sophie; Duong, Jenny; McLeod, Colin

    2012-04-01

    Using Australian Football League (AFL) matches as a case study, we investigated the frequency, length and content of marketing strategies for sports betting during two specific settings: 1) at stadiums during four live matches; and 2) during eight televised broadcasts of matches. Census of sports betting marketing during Round 12 of the 2011 AFL premiership season. Per match, there was an average of 58.5 episodes (median 49.5, s.d 27.8) and 341.1 minutes (median 324.1 minutes and s.d 44.5) of sports betting marketing at stadiums, and 50.5 episodes (median 53.5, s.d 45.2) and 4.8 minutes (median 5.0 minutes, s.d 4.0) during televised broadcasts. A diverse range of marketing techniques were used to: a) embed sports betting within the game; b) align sports betting with fans' overall experience of the game; and c) encourage individuals to bet live during the game. There were very few visible or audible messages (such as responsible gambling or Gambler's Help messages) to counter-frame the overwhelmingly positive messages that individuals received about sports betting during the match. This study raises important questions about the impacts of saturation, integrated and impulse gambling marketing strategies in sporting matches. Future research should explore: 1) how wagering industry marketing strategies may affect the attitudes and behaviours of community sub-groups (e.g. young male sports fans, and children); and 2) which public health and policy strategies, including regulation and harm minimisation messaging, will be effective in responding to wagering industry marketing strategies during sporting matches. © 2012 The Authors. ANZJPH © 2012 Public Health Association of Australia.

  5. EXPERIENCE IN APPLICATION OF THE TECHNOLOGIES OF BUILDING INFORMATION MODELING WHEN CONSTRUCTING THE OLYMPIC OBJECTS OF SOCHI-2014 AND STADIUMS OF THE FIFA WORLD CUP 2018

    Directory of Open Access Journals (Sweden)

    Shakhraman'yan Andrey Mikhaylovich

    2016-06-01

    Full Text Available The authors describe the experience in application of information modeling technologies for buildings and structures on the example of design and construction of the objects SOCHI-2014 and stadiums of FIFA World Cup 2017. According to the regulatory documents in 2014 in Sochi the automated monitoring systems of the strain state of bearing structures and engineering systems were in-stalled in all the Olympic ice stadiums and in the Central Olympic Stadium. The systems were controlled by software package SODIS Building. The main possibilities of SODIS Building are enumerated in the article.

  6. Vascular endothelial growth factor (VEGF-C - a potent risk factor in children diagnosed with stadium 4 neuroblastoma.

    Directory of Open Access Journals (Sweden)

    Bogdan Miskowiak

    2009-01-01

    Full Text Available To evaluate the immunohistochemical expression of VEGF-C, CD34 and VEGFR-2 in cancer tissue of children diagnosed with stadium 4 neuroblastoma (NB and correlate their presence with the survival rate of children diagnosed with that stage of the disease. Eighteen children assigned to stadium 4 composed the study group. Fourteen patients (allocated to stadium 3 formed a control group. VEGF-C, CD34 and VEGFR-2 expressions were evaluated by immunohistochemical assay. Consecutive slides incubated with anti-CD34 and anti-VEGFR-2 antibodies revealed that the two markers were colocalized within endothelial layer of the blood vessels. On the other hand, VEGF-C was expressed exclusively in tumour cells. As demonstrated by Fisher's exact test, the risk of NB treatment failure (progression or relapse as well as tumour related death, when all the patients were considered, was found to be significant in VEGF-C positive patients. VEGF-C expression in NB constitutes a potent risk factor and may direct future anti-angiogenic treatment strategy. The proximity of VEGF-C and CD34/VEGFR-2 of NB could be the equivalent of a potentially interesting VEGF-C fashion involving a tumour cell invasion into the blood vessels in an early phase of metastases promoting.

  7. A redundant resource: a pre-planned casualty clearing station for a FIFA 2010 Stadium in Durban.

    Science.gov (United States)

    Hardcastle, Timothy C; Samlal, Sanjay; Naidoo, Rajen; Hendrikse, Steven; Gloster, Alex; Ramlal, Melvin; Ngema, Sibongiseni; Rowe, Michael

    2012-10-01

    This report details the background, planning, and establishment of a mass-casualty management area for the Durban Moses Mabhida Stadium at the Natal Mounted Rifles base, by the Department of Health and the eThekwini Fire and Rescue Service, for the Fédération Internationale de Football Association (FIFA) 2010 Soccer World Cup. The report discusses the use of the site during the seven matches played at that stadium, and details the aspects of mass-gathering major incident site planning for football (soccer). The area also was used as a treatment area for other single patient incidents outside of the stadium, but within the exclusion perimeter, and the 22 patients treated by the Casualty Clearing Station (CCS) team are described and briefly discussed. A site-specific patient presentation rate of 0.48 per 10,000 and transport-to-hospital rate (TTHR) of 0.09/10,000 are reported. Lessons learned and implications for future event planning are discussed in the light of the existing literature.

  8. Noise disturbance caused by outdoor activities--a simulated-environment study for Ali Sami Yen Stadium, İstanbul.

    Science.gov (United States)

    Dal, Zeynep; Akdağ, Neşe Yüğrük

    2011-03-01

    Negative effects of noise on individuals, the inevitable result of urbanization, have become a significant urban problem in our day. Introduction of an approach to the noise problem on an urban-planning scale lightens the burden of measures required to be taken against noise at the stages of regional and developmental planning. Stadiums, which should be also evaluated from the point of noise problem when planning decisions are made on the urban planning scale, may cause very serious problems differing depending on the region they are located in. In this article, various dimensions of the noise problem caused by stadiums have been exemplified by making an assessment on Ali Sami Yen football stadium located in Mecidiyeköy district which is among important residential and commercial centres of İstanbul or Turkey. When the simulation results obtained for ordinary days and match days are evaluated, it has been found out that the people living in the area are exposed to noise levels substantially exceeding the acceptable values. Results of the survey conducted in the area have clearly revealed the existence of noise problem, too.

  9. Characterising the human-structure interaction effect of the Olympic Stadium in Cali, Colombia

    Directory of Open Access Journals (Sweden)

    Albert Ricardo Ortiz

    2009-01-01

    Full Text Available This paper presents the results of analysing the human-structure interaction effect of the Olympic Stadium in Cali, Colombia. Acceleration in the southern and western grandstands due to ambient vibration, free vibration and forced vibration tests were measured during football matches and musical performances. The data was processed using the power spectrum and time-fre- quency distribution, thus characterising the crowd motion for each of these events. A laboratory setup consisting of a rigid single stand was tested for characterising the jumping and damping effect of a person with regard to their posture. The loads obtained from such characterisation were incorporated into a finite element model of the southern and western grandstands to calculate the structures’ structural response. A coupling effect was observed between the loads caused by the crowd and the corresponding structural response. An increase of up to 200% in the damping of the human-structure system was observed when the structure was fully occupied by a crowd. Colombian national building code provisions for the dynamic loading of structures due to crowds are discussed

  10. The Moses Mabhida Medical Plan: medical care planning and execution at a FIFA2010 stadium; the Durban experience

    Directory of Open Access Journals (Sweden)

    Timothy C Hardcastle

    2010-12-01

    Full Text Available Timothy C Hardcastle1,2, Mergan Naidoo3,4, Sanjay Samlal5,6, Morgambery Naidoo5,6, Timothy Larsen5,6, Muzi Mabasu5,6,7, Sibongiseni Ngema6,81Inkosi Albert Luthuli Hospital, Mayville, South Africa; 2Department of Surgery, University of KwaZulu-Natal, Durban, South Africa; 3Wentworth Hospital, Durban, South Africa; 4Department of Family Medicine, University of KwaZulu-Natal, Durban, South Africa; 5Emergency Medical Rescue Service, KwaZulu-Natal, South Africa; 6Department of Health, KwaZulu-Natal, South Africa; 7EMRS 2010 Planning Committee, KwaZulu-Natal, South Africa; 8School of Public Administration and Development Management, University of KwaZulu-Natal, Durban, South AfricaAim: This paper aims to outline the medical services provided at the Moses Mabhida Stadium, Durban, South Africa for the Fédération Internationale de Football Association (FIFA 2010 Soccer World Cup and audit the clinical services delivered to persons seeking medical assistance.Methods: Descriptive report of the medical facilities at the Moses Mabhida Stadium including the staff deployment. Retrospective data review of medical incident reports from the Stadium Medical Team.Results: Medical staffing exceeded the local norms and was satisfactory to provide rapid intervention for all incoming patients. Senior medical presence decreased the transport to hospital rate (TTHR. A total of 316 spectators or support staff were treated during the seven matches played at the stadium. The majority of patients were male (60%, mostly of local origin, with mostly minor complaints that were treated and discharged (88.2% Green codes. The most common complaints were headache, abdominal disorders, and soft-tissue injuries. One fatality was recorded. The patient presentation rate (PPR was 0.66/10,000 and the TTHR was overall 4.1% of all treated patients (0.027/10,000 spectators.Conclusion: There was little evidence to guide medical planning for staffing from the FIFA governing body. Most

  11. The experience of some European Countries in the implementation of preventive measures against the phenomenon of violence and aggression at football stadiums

    Directory of Open Access Journals (Sweden)

    Samuel Uhrin

    2013-12-01

    Full Text Available The article sets forward the experience of the Slovak Republic in the field of prevention of violence and aggression in football stadiums. The text discusses initiatives aiming at dimnishing this alarming and increasing in size phenomenon. The experiences stemming from preventive measures which have been taken in this regard in other European countries, have also been brought closer in the text.

  12. 33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

  13. One-Year Monitoring PV Power Plant Installed on Rooftop of Mineirão Fifa World Cup/Olympics Football Stadium

    Directory of Open Access Journals (Sweden)

    Luís G. Monteiro

    2017-02-01

    Full Text Available This paper presents results of one-year monitoring of AC side electrical parameters and the characterization of local solar radiation at the biggest rooftop PV Power Plant, with an installed capacity of 1.42 MWp, mounted at Mineirão Football Stadium in Brazil. This stadium is one of the sport facilities that hosted 2014 FIFA World Cup and Rio 2016 Summer Olympics Games in the country. Results showed how it is important to study and characterize the solar resource in the region of interest, based on historic data, to provide the understanding of solar radiation and thus project PV power plants with better performance. Furthermore, AC electrical data show the behavior of active, reactive and apparent powers and the influence of the PV system on the power factor at the local grid utility connection point. Finally, PV power plant performance data (as annual final yield, performance ratio and capacity factor are also presented and compared with data from PVsyst software simulations. The results over the monitoring period were good considering the specificities of the stadium

  14. Spondylolysis in adolescents: the diagnostic value of MRI; Die Spondylolyse im Stadium der Entstehung: Diagnostischer Beitrag der MRT

    Energy Technology Data Exchange (ETDEWEB)

    Staebler, A.; Steinborn, M.; Matzko, M.; Reiser, M. [Klinikum Grosshadern, Muenchen (Germany). Inst. fuer Radiologische Diagnostik; Paulus, R.; Bosch, R. [Muenchen Univ. (Germany). Orthopaedische Klinik

    2000-01-01

    Purpose: To assess the value of MR imaging in demonstrating ongoing spondylolysis in adolescents. Methods: MRI was performed in 9 juvenile patients (3 female, 6 male aged 8-16 years; mean 12.5 y) with pain during hyperextension. In 6 patients a CT scan and in 5 a plain film was available. Results: In all patients bone marrow edema was found in the pars interarticularis and the pedicle, which was bilateral in 4 patients. In 7/9 cases the L5 vertebra was affected, in 2/9 cases spondylolysis was found in L4. In 3 cases the edema reached the middle third of the vertebral body and a tumor was suspected. In all CT scans a bilateral incomplete or complete cleft in the pars interarticularis was found. In 4/6 CT-scans a sclerosis was seen in the area of the bone marrow edema. Only in 1/5 pain films was there a suspicion for a spondylolysis, four examinations were completely normal. Conclusions: To eliminate underlying causal conditions of spondylolysis and to install specific therapy, early diagnosis is mandatory. MR imaging should be the first and only imaging modality in young patients with low back pain during and after exercise and pain with hyperextension. Bone scans and CT scans should be avoided due to irradiation, plain films usually do not reveal pathological findings in developing spondylolysis. (orig.) [German] Ziel: Darstellung der Wertigkeit der MR-Tomographie in der Diagnostik der Spondylolyse im Stadium der Entstehung. Methoden: 9 sportlich, aktive jugendliche Patienten im Alter von 8-16 Jahren (Durchschnitt 12,5 Jahre) mit Rueckenschmerzen bei der Hyperextension wurden MR-tomographisch untersucht. In 6 Faellen lag eine CT, in 5 Faellen Roentgenaufnahmen vor. Ergebnisse: Bei den 9 Jugendlichen wurden Knochenmarkoedeme in der Pars interarticularis und den Bogenwurzeln nachgewiesen, die in 4 Patienten beidseitig vorhanden waren. In 7/9 Faellen war LWK 5 betroffen, in 2/9 LWK 4. In 3 Faellen reichte das Oedem in die Wirbelkoerper, bei 2 Patienten bestand

  15. Plants as bioindicators for archaeological prospection: a case of study from Domitian's Stadium in the Palatine (Rome, Italy).

    Science.gov (United States)

    Ceschin, S; Caneva, G

    2013-06-01

    In this study, we analyzed the relationship between buried archaeological remains (masonries, pavements, and ancient ruins) and spontaneous vegetation growing above them. We carried out several vegetation surveys in the Domitian's Stadium at the archaeological site of the Palatine (Rome). Vegetation data were collected using the Braun-Blanquet approach and elaborated using statistical analyses (cluster analysis) to assess the similarity among surveys. Structural, chorological, and ecological features of the plant communities were analyzed. Results showed that the vegetation responds significantly to the presence of sub-emerging ancient remains. The plant bioindication of this phenomenon occurs through the following floristic-vegetation variations: phenological alterations in single individuals (reduction in height, displacement of flowering/fruiting period), increase of annual species and decrease of perennial ones, decrease of total plant coverage, reduction of maturity level of the vegetation which remains blocked at a pioneer evolutive stage. The presence of sub-surfacing ruins manifests itself through the dominant occurrence of xerophilous and not-nitrophilous species (e.g., Hypochaeris achyrophorus L., Aira elegantissima Schur, Trifolium scabrum L. ssp. scabrum, Trifolium stellatum L., Plantago lagopus L., Medicago minima (L.) L., and Catapodium rigidum (L.) C.E. Hubb. ex Dony ssp. rigidum) and in a rarefaction of more mesophilous and nitrophilous species (e.g., Plantago lanceolata L., Trifolium pratense L. ssp. pratense, Trifolium repens L. ssp. repens, and Poa trivialis L.). Therefore, the vegetation can be used as bioindicator for the detection of buried ruins, contributing in the archaeological prospection for a general, fast, and inexpensive interpretation of the underground.

  16. Pengaruh Hemodialisis terhadap Urea Reduction Ratio pada Pasien Penyakit Ginjal Kronik Stadium V di RSUP Dr. M. Djamil Padang

    Directory of Open Access Journals (Sweden)

    Wahyuni Armezya

    2016-08-01

    Full Text Available Abstrak Pravelensi pasien penyakit ginjal kronik stadium V yang mendapat terapi hemodialisis terus meningkat di dunia. Dosis hemodialisis yang diberikan kepada pasien harus mencukupi kebutuhan tubuh agar tujuan terapi dapat tercapai dengan baik. Tujuan penelitian ini adalah untuk menentukan pengaruh hemodialisis terhadap Urea Reduction Ratio (URR. Penelitian secara eksperimental kuasi dilakukan pada 55 pasien hemodialisis sejak Agustus 2013 sampai Maret 2014. Data dikumpulkan dari rekam medik dan hasil pemeriksaan ureum sebelum dan sesudah hemodialisis. Analisis bivariat menggunakan uji t berpasangan dan korelasi Pearson untuk mengetahui perbedaan ureum sebelum dan sesudah hemodialisis serta pengaruh hemodialisis terhadap URR. Berdasarkan data penelitian didapatkan hasil rerata ureum sebelum hemodialisis sebesar 100,27 mg/dl, rerata ureum sesudah hemodialisis 31,17 mg/dl dan rerata URR sebesar 68,80%. Sebanyak 62% pasien mendapatkan hemodialisis yang adekuat dan 38% pasien mendapatkan hemodialisis tidak adekuat. Uji statistik menunjukkan terdapat perbedaan signifikan ureum sebelum dan sesudah hemodialisis (p = 0,0001 dan terdapat pengaruh signifikan hemodialisis terhadap URR (p = 0,0001.Kata kunci: hemodialisis, ureum, URR AbstractThe prevalence of chronic kidney diseases stage V that receive hemodialysis therapy rise in the world. Hemodialysis doses are given to the patient must meet the body’s needs in order to make the therapeutic goals can be achieved well. The objective of this study was to determine the adequacy of hemodialysis measured by URR in hemodialysis patients in the M Djamil hospital Padang. Quasi-experimental studies performed on 55 hemodialysis patients from August 2013 to March 2014. Data were collected from medical records and the results of urea before and after hemodialysis. Bivariate analysis using a paired t test and Pearson correlation urea to know the difference between before and after hemodialysis and hemodialysis

  17. PENGARUH PEMBERIAN VITAMIN D3 (CALCITRIOL TERHADAP KADAR TGF β1 DAN IL-6 PADA PASIEN PENYAKIT GINJAL KRONIK STADIUM V

    Directory of Open Access Journals (Sweden)

    Rahma Anindita

    2017-06-01

    Full Text Available Penyebab utama morbiditas dan mortalitas pada pasien PGK adalah insiden kardiovaskuler yang didasari oleh proses aterosklerosis. Penurunan kadar TGF-β1 dan IL-6 dengan kalsifikasi vaskuler yang selanjutnya berkembang menjadi plak arteriosklerotik. Vitamin D menekan pada jalur aktivasi NF-ĸB sehingga mempunyai sifat anti inflamasi. Penelitian ini bertujuan untuk mengetahui pengaruh suplementasi vitamin D terhadap kadar TGF-β1 dan IL-6 pada pasien penyakit ginjal kronik stadium v yang menjalani hemodialisis. Penelitian ini merupakan penelitianeksperimen dengan randomisasi, sampel 30 orang, dibagi menjadi kelompok kontrol diberikan plasebo dan perlakuan diberikan calcitriol 1x0,5 μg peroral selama 4 minggu. Analisis statistik menggunakan SPSS 22for windows. Karakteristik penelitian yang berupa variabel kualitatif, uji homogenitas dilakukan menggunakan uji Chi Square. Uji beda dua rerata menggunakan uji t dengan signifikansi p <0,05. Hasil penelitian menunjukkan pemberian calcitriol 1x0,5 μg peroral jika dibandingkan placebo secara bermakna menurunkan kadarTGF-β1 (-1672,64±4217,61vs 7539,95±6435,86; p = 0,001, dan menurunkan kadar IL-6(- 1,45±3,14vs 4,20±2,83; p = 0,001. Pemberian suplementasi vitamin D dapat menurunkan kadar TGF-β1 dan menurunkan kadar IL-6 pada pasien penyakit ginjal kronik stadium V yang menjalani hemodialisis   Kata kunci: Vitamin D, TGF-β1, IL-6, Penyakit Ginjal Kronis

  18. Shea Stadium: Economics Laboratory

    Science.gov (United States)

    Norflus, David

    1977-01-01

    A secondary course uses an integrated approach to teach economic analysis through sports. The course takes a microeconomic look at one segment of the national economy, providing an in-depth analysis of the American sport scene through the eyes of an economist. Evaluation techniques are discussed and a reprint of the course outline is provided.…

  19. ORF Sequence: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006349 gi|53716750 >gi|53716750|ref|YP_105775.1| nonribosomal peptide synthetas...AIVALDAMPLTPNGKLDRAALPAPIVTGTSRRAPENRIEQQVCAMFAELLDAQTLGAEDNFFELGGDSLLAMRAINKLRQTFDVELTIRDLFSAPTVAALSMRLDAQLAARRAHADGAELPAG

  20. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176202 >gi|49176202|ref|NP_416756.3| putative aminotransferase [Escheric...QQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPDMTTADADHVITALQQLAGQ

  1. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310296 >gi|18310296|ref|NP_562230.1| muramidase [Clostridium perfri...GFGDGDYGDLFPVLDVETPTDKSLTTTELVNWIDRFRDRFEEKTRRRLMLYTGLFFIGLYDDFKVPGKGYPLSDMPLWIAMYTRIPSNPRIPPNVGGWKRWTMWQFTD

  2. Strengthening functions of NC. Windows terminal functions; NC no kino kyoka. Windows tanmatsu kino

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-01-10

    A network computer (NC) was connected to a Citrix Meta Frame server to strengthen its functions so that such Windows applications as Excel and Word can be utilized. Combination of Meta Frame with the NC made it possible to structure such unique system that the Windows applications can be used, the environment can be unified easily with that of all clients, and no installation is required for applications at the clients. Thus, the scope of NC application has been expanded. Major usage includes the followings: (1) industrial area: a site controller can utilize work report (Excel) and mails by using an NC terminal available at factory production sites; (2) public area: a large number of learning persons can utilize Excel and Word at educational institutions; and (3) general area: ordinary offices can utilize applications developed by Visual Basic and others in addition to Excel and Work. (translated by NEDO)

  3. NC10 bacteria in marine oxygen minimum zones

    DEFF Research Database (Denmark)

    Padilla, Cory; Bristow, Laura A.; Sarode, Neha

    2016-01-01

    Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic o...

  4. 78 FR 72009 - Establishment of Class E Airspace; Star, NC

    Science.gov (United States)

    2013-12-02

    ... Federal Aviation Administration 14 CFR Part 71 Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

  5. Virtual NC machine model with integrated knowledge data

    International Nuclear Information System (INIS)

    Sidorenko, Sofija; Dukovski, Vladimir

    2002-01-01

    The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

  6. A Cautionary Analysis of a Billion Dollar Athletic Expenditure: The History of the Renovation of California Memorial Stadium and the Construction of the Barclay Simpson Student Athlete High Performance Center. Research & Occasional Paper Series: CSHE.3.17

    Science.gov (United States)

    Cummins, John

    2017-01-01

    This paper is a description and analysis of the history of the renovation of Memorial Stadium and the building of the Barclay Simpson Student Athlete High Performance Center (SAHPC) on the Berkeley campus, showing how incremental changes over time result in a much riskier and financially less viable project than originally anticipated. It…

  7. PENGARUH OVARIEKTOMI TERHADAP KADAR VEGF,TGF-β, IGF, DAN CA15-3 PADA PASIEN KANKER PAYUDARA STADIUM LANJUT USIA MUDA

    Directory of Open Access Journals (Sweden)

    Rini Suswita

    2015-12-01

    Full Text Available AbstrakKanker payudara stadium lanjut pada usia muda dikaitkan dengan gambaran klinis, patologis dan prognosis yang lebih buruk dibanding usia tua. Ovariektomi merupakan terapi paliatif yang efektif pada pasien ini, dengan menurunkan kadar estradiol yang akan mempengaruhi gen yang terlibat dalam proses proliferasi, diferensiasi, metastasis, angiogenesis, invasi, dan apoptosis. Penelitian ini bertujuan untuk mengetahui pengaruh ovariektomi terhadap kadar VEGF, TGF β, IGF dan CA15-3 pada pasien kanker payudara stadium lanjut usia muda. Penelitian ini menggunakan desain pre dan post test pada 12 pasien kanker payudara stadium lanjut usia muda sebagai subyek penelitian. Pemeriksaan kadar VEGF, TGF β, IGF dan CA 15-3 dilakukan sebelum dan tiga bulan sesudah pasien dilakukan tindakan ovariektomi dengan menggunakan teknik ELISA, kemudian dilakukan analisis statistik dengan uji non parametrik. Penelitian menemukan peningkatan kadar VEGF, TGF β, IGF dan CA 15-3 dan menurun sesudah dilakukan ovariektomi. Analisis statistik menunjukkan pengaruh ovariektomi yang bermakna terhadap penurunan kadar VEGF (p=0,023, TGF β (p=0,02, dan CA 15-3 (p=0,002, tetapi tidak berpengaruh terhadap kadar IGF(p=875. Ovariektomi dapat menurunkan kadar VEGF, TGF β dan CA 15-3 serum, sehingga dapat dipertimbangkan sebagai terapi pilihan pada kanker payudara stadium lanjut usia muda.AbstractAdvanced breast cancer in young age is associated with worse clinical features, pathology and prognosis than old age. Oophorectomy may be an effective palliative therapy in these patients, by decreasing estradiol concentration which will affect genes involved in proliferation, differentiation, metastasis, angiogenesis, invasion, and apoptosis. This research aimed at examining the effect of oophorectomy on the levels of VEGF, TGF-β, IGF and CA15-3 in patients with advanced breast cancer in young age. This study used a pre and post test design in twelve patients with advanced breast cancer

  8. ncPred: ncRNA-Disease Association Prediction through Tripartite Network-Based Inference.

    Science.gov (United States)

    Alaimo, Salvatore; Giugno, Rosalba; Pulvirenti, Alfredo

    2014-01-01

    Over the past few years, experimental evidence has highlighted the role of microRNAs to human diseases. miRNAs are critical for the regulation of cellular processes, and, therefore, their aberration can be among the triggering causes of pathological phenomena. They are just one member of the large class of non-coding RNAs, which include transcribed ultra-conserved regions (T-UCRs), small nucleolar RNAs (snoRNAs), PIWI-interacting RNAs (piRNAs), large intergenic non-coding RNAs (lincRNAs) and, the heterogeneous group of long non-coding RNAs (lncRNAs). Their associations with diseases are few in number, and their reliability is questionable. In literature, there is only one recent method proposed by Yang et al. (2014) to predict lncRNA-disease associations. This technique, however, lacks in prediction quality. All these elements entail the need to investigate new bioinformatics tools for the prediction of high quality ncRNA-disease associations. Here, we propose a method called ncPred for the inference of novel ncRNA-disease association based on recommendation technique. We represent our knowledge through a tripartite network, whose nodes are ncRNAs, targets, or diseases. Interactions in such a network associate each ncRNA with a disease through its targets. Our algorithm, starting from such a network, computes weights between each ncRNA-disease pair using a multi-level resource transfer technique that at each step takes into account the resource transferred in the previous one. The results of our experimental analysis show that our approach is able to predict more biologically significant associations with respect to those obtained by Yang et al. (2014), yielding an improvement in terms of the average area under the ROC curve (AUC). These results prove the ability of our approach to predict biologically significant associations, which could lead to a better understanding of the molecular processes involved in complex diseases. All the ncPred predictions together

  9. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641467 >gi|57641467|ref|YP_183945.1| SSU ribosomal protein S17P [Thermococcus kodakarae...nsis KOD1] MREIGLRVQPPAEVCNDPKCPWHGNLKIHGRYVEGIVVSDKGKKTVVVERQYYHYLKKYERYELRKSKVHAHNPECINAKVGDKVLIAETRPISKTKSWVVVAVLQRAERAEEV

  10. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827448 >gi|15827448|ref|NP_301711.1| hypothetical protein ML0938 [Mycobacterium leprae... TN] MEHFLDVSTEPRWTEAQRLVTLAAIDIVKTFFKADRDAAGAKINEYLRRIGSEGVIAGYNGLCGMLVKHVAEVTGEDPMAVVYRAEETARNVLPEEEE

  11. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640234 >gi|57640234|ref|YP_182712.1| hypothetical protein TK0299 [Thermococcus kodakarae...nsis KOD1] MEGGREKPSVRAGSEELLFEVLKEGLFWAALGRPSEVMPFLRGKLLGNGFSPKAKEELQWLLDQLEKYYSHVAASGRVEERHLRAIKSFYRDIVVVLSVERAEF

  12. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640908 >gi|57640908|ref|YP_183386.1| hypothetical protein TK0973 [Thermococcus kodakarae...nsis KOD1] MAVISVRIPDELKAKMKELDINWSEEIRKFIEERVLRAEKQKKLDEIHRLLSGGTPADEGTARKYVRDDRDSN

  13. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827020 >gi|15827020|ref|NP_301283.1| putative GTP cyclohydrolase I [Mycobacterium leprae... TN] MALLDLGLESTAVPRIRVFDQQRAEAAIRELLYAIGEDPDREGLADTPARVARACRELFSGLYTDPQTVLNTMFDEEHNELV...IVKEIPMYSTCEHHLVSFHGVAHIGYLPGADGRVTGLSKIARLVDLYAKRPQVQERLTSQIADALVSKLDPRGVIIVVEAEHLCMAMRGVRKPGAITTTSAVRGQFKTDAASRAEALGLILRK

  14. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15828228 >gi|15828228|ref|NP_302491.1| putative membrane protein [Mycobacterium leprae... TN] MSKGDRKNGVPSTLTTIPLVDPHAEPTEPSIGDLIKDATTQVSTLVRAEVELARAEIIRDVKKGLTGSVFFIAALVVLFYSTFFFF

  15. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15826974 >gi|15826974|ref|NP_301237.1| hypothetical protein ML0151 [Mycobacterium leprae... TN] MRPEPPHHENAELTEMNTEVVEAPLLTDIEELREEIDRLDAQILATVKRRAEVSQAIGKVRMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH

  16. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641662 >gi|57641662|ref|YP_184140.1| hypothetical protein TK1727 [Thermococcus kodakarae...nsis KOD1] MGKEERTVIENSPSFQYLLRFASDIGGGLKFISLEKDAYNIRENDIIVCFGDESKKRAEYLKKVLKYPIEIHSILEIIERYETNANGV

  17. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15828329 >gi|15828329|ref|NP_302592.1| possible hemagglutinin. [Mycobacterium leprae... TN] MAENPNVDDLRAPLLAALGAADLALTTVNELVGNMRERAEETRIDTRSRVEESRARVAKLQEVLPEHLSELREKFTADELRKAAEGYL...EAATNRYNELVERGEAALERLRSRPVFEDASARAEGYVDQAVELTQEALGTVASQTRAVGGRAAKLVGIELPKKAAAPARKAPAKKAPAKKAPAKKVTQK

  18. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827196 >gi|15827196|ref|NP_301459.1| putative integration host factor [Mycobacterium leprae... TN] MALPQLTDEQRAAALEKAAAARRARAELKDRLKRGGTNLTQVLKDAESDEVLGKMKVSALLEALPKVGKVKAQEIMTELDIAPTRRLRGLGERQRKALLEKFGSA

  19. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640317 >gi|57640317|ref|YP_182795.1| hypothetical protein TK0382 [Thermococcus kodakarae...nsis KOD1] MSVWGWLLGFLLLGAILSILYDILFRPWKLVREGINDLERQLKLLDGRFARLRSFIIAPWLWGDVERTRTFVSHKLALKRAELELFEKLKGGGE

  20. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827491 >gi|15827491|ref|NP_301754.1| hypothetical protein ML1018 [Mycobacterium leprae... TN] MAYDDPFMQTESTYWPTLPAGAQQYTSSTKHPVDGDRAEATVDMAGIPCRIMPQRHRNEQHSVAGYASSHR

  1. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827265 >gi|15827265|ref|NP_301528.1| putative transcriptional regul...ator [Mycobacterium leprae TN] MLTLTIPKQTLPGLPCHADTSDLWFAETPADLECTKTLCANCPIRRPCLEAAMERAEPWGVWGGEIFDRGLIVSRKRPRGRPCNDVVVV

  2. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641941 >gi|57641941|ref|YP_184419.1| hypothetical protein TK2006 [Thermococcus kodakarae...nsis KOD1] MSEAVNPKLYSIEKLLEDKDKRLLVSEVVLKLAEALGVTVEDFLGYMEWKENMGKLERAEKEAQIPESIPVEFPTEDAPEGLEEALNEIEEDIQKWQKIERRLKEMGLEL

  3. ORF Sequence: NC_002677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002677 gi|15827349 >gi|15827349|ref|NP_301612.1| hypothetical protein ML0802 [Mycobacterium leprae... TN] MAEMSGVKMAEDVRAEIVASVLEVVVSEGDQIGKGDVLVLLESMKMEIPVLAGVAGIVSKVSVSVGDVIQAGDLIAVIS

  4. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640253 >gi|57640253|ref|YP_182731.1| hypothetical protein TK0318 [Thermococcus kodakarae...nsis KOD1] MVEIPEVEELKALLNELGEEGLLERLDAFVRMNGGLESKRGEDFIKVSILGFAEGLLTVLKEKYDEPRVKELYEKIKAKRAELDEQFRKPRIPYLEEEG

  5. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640245 >gi|57640245|ref|YP_182723.1| hypothetical protein TK0310 [Thermococcus kodakarae...nsis KOD1] MLEKSEMVRSYEILDYKEGSDFYFLKIRAELIDGSVLHIREFVSNEEYNYSFQWQRDSELIIRWDNAPHHKDLPTFPHHKHVGSEKNVLPSSEITLEEVLGVISSYIQNP

  6. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640174 >gi|57640174|ref|YP_182652.1| putative tRNA-binding protein [Thermococcus kodakarae...nsis KOD1] MELYDVDEFWKFDLRVGLVKRAEKLKRTRKLIKLDVDFGGEERTVITGIADQYSPEELEGKKFVFVLNLKPKKLSGVESQGMLIVAETEDGKVYLLPVPEEVPVGTRVW

  7. ORF Sequence: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

  8. ORF Sequence: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50086493 >gi|50086493|ref|YP_048003.1| putative transthyretin-like pr...otein precursor [Acinetobacter sp. ADP1] MISTHILDTHLGKPATQVDVRLYNAKTRDLIGQGVTDQDGRIKNFGREDLEAGAYLLEYDVAPYFSQKQLKTFFPQVLIQFAIENPAEHYHVPLLISPFAYSTYRGS

  9. ORF Sequence: NC_002163 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002163 gi|15792064 >gi|15792064|ref|NP_281887.1| transthyretin-like periplasmic... protein [Campylobacter jejuni subsp. jejuni NCTC 11168] MFSIKKTLLILASVPMFLSATEYQLSTHVLDITSGQPAPKVKVELYKLEAN

  10. ORF Sequence: NC_003912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003912 gi|57237017 >gi|57237017|ref|YP_178819.1| transthyretin-like protein [Ca...mpylobacter jejuni RM1221] MFSIKKTLLILASVPMFLSATEYQLSTHVLDITSGQPAPKVKVELYKLEANQQWKKVSEEFTEENGRIGDLLPYEKAENRAFGIYKLKFFTKDYYTSHKINTFYPFVEVSFELSKDQKHYHVPITLSPFGYSTYRGS

  11. ORF Sequence: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

  12. ORF Sequence: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

  13. ORF Sequence: NC_003078 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

  14. ORF Sequence: NC_004311 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Brucella suis 1330] MKTAHRISALANQLNELQACLGRASGRPSKSVMEAQRIAAELASLLEEWHLETLHIPETERDLYRVQNPYYAAH ... NC_004311 gi|23500123 >gi|23500123|ref|NP_699563.1| hypothetical protein BRA0370 [

  15. ORF Sequence: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

  16. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26246999 >gi|26246999|ref|NP_753039.1| Hydrogenase-1 large chain [Escheric...hia coli CFT073] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALA

  17. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15830383 >gi|15830383|ref|NP_309156.1| hydrogenase-1 large subunit [Escheric...hia coli O157:H7] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVH

  18. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|38703956 >gi|38703956|ref|NP_309866.2| hypothetical protein ECs1839 [Escheric...hia coli O157:H7] MSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVD

  19. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15802802 >gi|15802802|ref|NP_288829.1| putative enzyme [Escherichia c...YQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPSLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  20. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26248641 >gi|26248641|ref|NP_754681.1| Hypothetical protein yfbE [Escheric...QQYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPTLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  1. ORF Sequence: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|38704067 >gi|38704067|ref|NP_311168.2| hypothetical protein ECs3141 [Escheric...QYQQALAALPFQPLSLPAWPHVHAWHLFIIRVDEQRCGISRDALMEALKERGIGTGLHFRAAHTQKYYRERFPSLSLPNTEWNSERICSLPLFPDMTTADADRVITALQQLAGQ

  2. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|49176093 >gi|49176093|ref|NP_415783.3| hypothetical protein b1267 [Escheric...hia coli K12] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELS

  3. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247596 >gi|26247596|ref|NP_753636.1| Protein yciO [Escherichia coli... CFT073] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNFTLMCRDLSELSTYSFVDNVAFR

  4. ORF Sequence: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26248286 >gi|26248286|ref|NP_754326.1| Putative salicyl-AMP ligase [Escheric...hia coli CFT073] MESALLRLAEVQDCAVVAAPDTLLGERICAFIIAQQVPTDYQQLRQQLTRMGLSAWKIPDQIEFLDHWPLTAVGKIDKKRLTALAVDRYRHSAQ

  5. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128939 >gi|16128939|ref|NP_415492.1| hydrogenase-1 large subunit [Escheric...hia coli K12] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERICGVCTGVHALAS

  6. ORF Sequence: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27468532 >gi|27468532|ref|NP_765169.1| hypothetical protein SE1614 [Staphylococcus epidermidis ATCC 12228] MIDQNKVSRPVLSDDQLSQLNIHLHEALQQSRPVNIKYYEEGYINFIELIVHRIDSINYEIEGTAPHSRERHKVSFLDIIDISFI

  7. ORF Sequence: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57652313 >gi|57652313|ref|YP_187383.1| hypothetical protein SACOL2592 [Stap...hylococcus aureus subsp. aureus COL] MSLNKEQRRITAEELQAHFEASTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  8. ORF Sequence: NC_003923 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003923 gi|21284226 >gi|21284226|ref|NP_647314.1| hypothetical protein MW2497 [Stap...hylococcus aureus subsp. aureus MW2] MSLNKEQRRITCEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  9. ORF Sequence: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15928156 >gi|15928156|ref|NP_375689.1| hypothetical protein SA2363 [Stap...hylococcus aureus subsp. aureus N315] MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  10. ORF Sequence: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15925567 >gi|15925567|ref|NP_373101.1| hypothetical protein SAV2577 [Stap...hylococcus aureus subsp. aureus Mu50] MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  11. ORF Sequence: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49484080 >gi|49484080|ref|YP_041304.1| hypothetical protein SAR1930 [Stap...hylococcus aureus subsp. aureus MRSA252] MKASRILFGIGVGVAAGFVVALQGRDDKSVKNNTIDRTAPTGSKSELQREFETIKQSFNDILNYGVQIKNESAEFGSSIGGEIKSLLGNFKSDINPNIERLQSHIENLQNRGEDIGNEISK

  12. ORF Sequence: NC_002953 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002953 gi|49487436 >gi|49487436|ref|YP_044657.1| hypothetical protein SAS2543 [Stap...hylococcus aureus subsp. aureus MSSA476] MRTNNHITDLDAIELSSGWNYNSKLETGKNALLSDSLLRDIKVLSSNAKGDADILETELRAVINAMSQNEGKSVDALKNSTAPLKNNLTKLKEQLDKTTH

  13. ORF Sequence: NC_002953 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002953 gi|49487356 >gi|49487356|ref|YP_044577.1| hypothetical protein SAS2463 [Stap...hylococcus aureus subsp. aureus MSSA476] MSLNKEQRRITCEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAMTAPLGIFSHQLQRFIHLVWDVRDVINDNIKGNGQTPEPYTYLKGEKEDYWFLR

  14. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available coli K12] MFVDRQRIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDNFFKLNRELHDKSLRLNLHLDQEEWSALHHAEEALATAAVCLMSGHHDCPTVITVNADKLENCLMSLTLSIQSLQKHAMLEKA ... NC_000913 gi|16128804 >gi|16128804|ref|NP_415357.1| putative receptor [Escherichia

  15. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309706 >gi|18309706|ref|NP_561640.1| spore photoproduct lyase [Clostridium perfr...SAHWQLPLLSGCVGNCQYCYLNTNLGDKPYVKINVNVEDILNQAQKYIDERKPNITIFEGSATSDPIPVEPYTNSLKRAIEFFANNDFARFRFVTKYTDVDSLLGLDH

  16. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311454 >gi|18311454|ref|NP_563388.1| probable cell-cycle protein [Clostridium perfr...LTRIIKKALFEVSSKHNNFELKHIQDIIALKDKGTGKQINITNGVIALNEYGDIRIKLVDSKKAKENKVLNLENIKDELDKNQKVVIEDDILGNYELIVEDLKKGEKFSKDRFIKSFDYDKISNIDIRFR

  17. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310148 >gi|18310148|ref|NP_562082.1| lysine specific permease [Clostridium perfr...SAFTIVFEKLGLAGAASIMNAIILTSVLSAGNSGMYASSRMLYAMAKNGMAPKIFEKTNSRGVPVNAIIITTIIASLCFLTGIYAENTVYVWLVAASGLSGFIAWLGIAICHYRFR

  18. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311446 >gi|18311446|ref|NP_563380.1| glycine-tRNA ligase [Clostridium perfr...ingens str. 13] MAVEKTMDKIVALCKNRGFIFPGSEIYGGLANSWDYGPLGVEFKNNVKRAWWKKFVQESKYNVGLDSAILMNREVWVASGHVGGFSDPLMDCKECKARFR

  19. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311510 >gi|18311510|ref|NP_563444.1| hypothetical protein CPE2528 [Clostridium perfr...LEKLQDNNEITDFHKVKEIFYESFGTDINTYFLEFSETPLASASIAQVHRAQLIDGRDVVVKVQHYKIDEKMKLDLSILRRLSKLTSSHIANTLINPVEAFKEIEEATLKELDFEKEAKNTKRFR

  20. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310876 >gi|18310876|ref|NP_562810.1| translation initiation factor IF-3 [Clostridium perfr...ingens str. 13] MADEAELDLVMISPNAKPPVCKIMDYGKFIYEQSKKEKEAKKKQKVISVKEIRVSPTIEKHDLEIKAKNAKKFLEAGDKVKITVRFRGREAEHSHVGVKILDSFLAQLEEVCSVEKPAKLEGRNMIMILAPKKA

  1. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309950 >gi|18309950|ref|NP_561884.1| hypothetical protein CPE0968 [Clostridium perfr...ingens str. 13] MRSRVNKINNRTVAALGIKSLDENLEKSIVNIINCNPEYIILGCSEIPFTERILKALNNANCPKILILPFNYRFR

  2. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311382 >gi|18311382|ref|NP_563316.1| 50S ribosomal protein L22 [Clostridium perfr...ingens str. 13] MEAKAIAKYVRMSPTKVGVVLDLIRGKNVNEAFAILKYTPRDAAEVISKVLKSAVANAENNHELDANRLFVAEAHVGHGPTLKRFRPMDHGKAFRINKRTSNITLVVKERA

  3. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310629 >gi|18310629|ref|NP_562563.1| probable lipoprotein [Clostridium perfr...GEKVKGNILGNGAIIEFDIESKKKQLYSYGIRNVKGFDLNSSGEIFAIVGGIEDEGFRPLSGDSDYIYKIEGKGTWYGWPDYSGGDPVNSPRFR

  4. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18311064 >gi|18311064|ref|NP_562998.1| probable ABC transporter [Clostridium perfr...ingens str. 13] MKSKAKKLPKEKLTMKDRMKRFRNNKELLLLTIPGAIWFLVFAYLPMFGVIVAFKRWRIHGGFFESLMNSKWVGFDNFK

  5. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309221 >gi|18309221|ref|NP_561155.1| hypothetical protein CPE0239 [Clostridium perfr...LGEEVSSEYIINDYNIRPIKELLLIDYDEKSIIKNIKNPFIKVFKINKINKNLDEETMEIQSARDEMKKISQCAQDDKLKLIRIYKLICSATNLGEAIEERFRDFIPMIQSSRLIYGDCNIEKRSYRIGNVMKCYDGIMQFLVKICETKYRSAEGKRVKYIKDSLIDEHLEELDLWKQSFNEI

  6. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310125 >gi|18310125|ref|NP_562059.1| hypothetical protein CPE1143 [Clostridium perfr...ingens str. 13] MGLFSKNKERKGYTSIDSYLKENNLDNDIKSVTNVNIFFMDGEEEDFYLEDHMLLKFKNFIENPEKDFLVLKYYSSLYSDGFSLEEITLMRHGICRFRIDSEKENILVSD

  7. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310294 >gi|18310294|ref|NP_562228.1| hypothetical protein CPE1312 [Clostridium perfr...KEVIISKDVLDENQCMDIMSICKEYKGVPSFHSRDSVYWPSRFRKYLYDIILNKKIPEKYRVKNIYVKEKEEWREVFKSNNIGKCIIIELNTKKLKKIRENLIKKGNY

  8. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18308994 >gi|18308994|ref|NP_560928.1| hypothetical protein CPE0012 [Clostridium perfr...NNSLGFMKSLKIAKEMINSISRKHVKDIFYDNHNQDRLIIDDSRKNKGYIKVMGNHYGEVTIAPAVSKIICDEIIDKLNCSLNKNFVDKRREFYRFRELSNEERNELI

  9. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310749 >gi|18310749|ref|NP_562683.1| twitching motility protein [Clostridium perfr...ingens str. 13] MQSLAELLELTVKEGASDLHLTVGISPIIKVNGKLVRLEHEILRPEDTEAYAREILQDAYEKYDAIGEYDTSYSIHGKGRFR

  10. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310630 >gi|18310630|ref|NP_562564.1| stage V sporulation protein B [Clostridium perfr...TMYGILNGLGRQNVILRNTIITEVLEVTLLFFLTAIPSINIYGYAITMLIISSLSLCLNLYEIYKNINIGLSLSNFLIYILTGVLTYICLSPLSLKLSFIDFRVQVLAVTSIATSIFIFLIIKEKFSSRFRKISLKSR

  11. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309510 >gi|18309510|ref|NP_561444.1| hypothetical protein CPE0528 [Clostridium perfr...KEFNETYLNDTNRFKDLLDLNKNSENEEIKIIFFDLFNKDANKDQLFITSFMNKLGEILKYINWDKILIIFNEEIIFNKVTNIDSRFRECSLVLNNYDVNLNEFIHIL

  12. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Clostridium perfringens str. 13] MNKVDLIGRVATKIEVKESKNKKKYVRFRIAVNSFNGREETTTFLSVITWSKSTVDFLEKFVNIGDLVSVSGEIVESRYESESGEVRYYTNIQTSNINLLNKAKEKEIS ... NC_003366 gi|18310649 >gi|18310649|ref|NP_562583.1| probable single-strand binding

  13. ORF Sequence: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18310554 >gi|18310554|ref|NP_562488.1| hypothetical protein CPE1572 [Clostridium perfr...SKENEIIKECEDFKKTYKDSLDKIFVCSKCMCVKCIRECGFNPCLSCNKTGKVNYCDKENTNLIVFKNFIKQQYNNETNENEPLEILCEVEMLDMDKRFRIIKEVLSGEQLVLEYVYNIKDGDLYNSIEDVDLFNEIIDIYESNKI

  14. ORF Sequence: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

  15. ORF Sequence: NC_003901 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available anosarcina mazei Go1] MMFATIGASFHKGWRAGPSIFMGHALVECILFMLILIGASSFLRQSIISYLSIVGGFVMVAFGLLMIKKAKEASTMDVSISASSLN... NC_003901 gi|21228124 >gi|21228124|ref|NP_634046.1| transporter, LysE family [Meth

  16. PENGARUH PEMBERIAN 1,25 DIHYDROXYVITAMIN D (CALCITRIOL TERHADAP KADAR FIBROBLAST GROWTH FACTOR-23 DAN ALBUMINURIA PADA PASIEN PENYAKIT GINJAL KRONIK STADIUM V YANG MENJALANI HEMODIALISIS

    Directory of Open Access Journals (Sweden)

    Intan Herlina

    2017-06-01

    Full Text Available Penyebab utama morbiditas dan mortalitas pada pasien Penyakit Ginjal Kronik adalah insiden kardiovaskuler yang didasari oleh proses aterosklerosis yang menyebabkan meningkatnya morbiditas dan mortalitas. Ginjal merupakan tempat utama sintesa 1,25 Dihydroxyvitamin D (Calcitriol, sehingga dengan adanya kerusakan ginjal menyebabkan defisiensi 1,25 Dihydroxyvitamin D (Calcitriol. Pada pasien Penyakit Ginjal Kronik terjadi peningkatan Fibroblast Growth Factor-23 dan Albuminuria akibat dari aktifitas Renin Angiotensin Aldosteron Sistem. Aktifitas RAAS mempengaruhi 1,25 Dihydroxy vitamin D (Calcitriol, Fibroblast Growth Factor-23 melalui Angiotensin 2 dengan cara menghambat reseptor Angiotensin I (AT1 melalui Nicotinmide Adenine Dinucleotide Phosphate Oxidase (NADPH Oksidase dan Stress Oxidativ. Beberapa penelitian menyimpulkan pemberian 1,25 Dihydroxyvitamin D (Calcitriol mempunyai efek renoprotektif, anti inflamasi dan antiproteinuric dengan cara menghambat reseptor Angoitensin I (AT1 sehingga mengakibatkan menurunnya albuminuria. Tujuan Penelitian ini adalah untuk membuktikan pemberian 1,25 Dihydroxyvitamin D (Calcitriol dapat menurunkan kadar Fibroblas Growth Factor-23 dan albuminuria pada pasien Penyakit Ginjal Kronik stadium V yang menjalani hemodialisis. Penelitian ini merupakan penelitian eksperimen dengan randomisasi, subyek penelitian 30 orang, dibagi dalam dua kelompok sampel, kelompok plasebo 15 orang dan kelompok perlakuan 15 orang. Dalam perjalanan, kelompok placebo drop out 4 pasien karena keluarga pasien tidak menyetujui untuk melanjutkan penelitian dan satu lagi mengalami perburukan, sehingga jumlah sampel menjadi 26 orang, terbagi menjadi kelompok placebo sebanyak 11 orang yang diberi placebo dan kelompok perlakuan 15 orang diberi calcitriol 1x0,5 μg peroral selama 4 minggu. Karakteristik penelitian yang berupa variabel kualitatif, uji homogenitas dilakukan menggunakan uji Chi Square. Uji beda dua Rerata menggunakan uji t pada p<0

  17. Inherent and antigen-induced airway hyperreactivity in NC mice

    Directory of Open Access Journals (Sweden)

    Tetsuto Kobayashi

    1999-01-01

    Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

  18. ncRNA consensus secondary structure derivation using grammar strings.

    Science.gov (United States)

    Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

    2011-04-01

    Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

  19. On pseudorandom generators in NC0

    DEFF Research Database (Denmark)

    Cryan, Mary; Miltersen, Peter Bro

    2001-01-01

    In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch...

  20. Energy Flexibility from Large Prosumers to Support Distribution System Operation—A Technical and Legal Case Study on the Amsterdam ArenA Stadium

    Directory of Open Access Journals (Sweden)

    Dirk Kuiken

    2018-01-01

    Full Text Available To deal with the rising integration of stochastic renewables and energy intensive distributed energy resources (DER to the electricity network, alternatives to expensive network reinforcements are increasingly needed. An alternative solution often under consideration is integrating flexibility from the consumer side to system management. However, such a solution needs to be contemplated from different angles before it can be implemented in practice. To this end, this article considers a case study of the Amsterdam ArenA stadium and its surrounding network where flexibility is expected to be available to support the network in the future. The article studies the technical aspects of using this flexibility to determine to what extent, despite the different, orthogonal goals, the available flexibility can be used by various stakeholders in scenarios with a large load from electric vehicle charging points. Furthermore, a legal study is performed to determine the feasibility of the technical solutions proposed by analysing current European Union (EU and Dutch law and focusing on the current agreements existing between the parties involved. The article shows that flexibility in the network provided by Amsterdam ArenA is able to significantly increase the number of charging points the network can accommodate. Nonetheless, while several uses of flexibility are feasible under current law, the use of flexibility provided by electric vehicles specifically faces several legal challenges in current arrangements.

  1. NC CATCH: Advancing Public Health Analytics.

    Science.gov (United States)

    Studnicki, James; Fisher, John W; Eichelberger, Christopher; Bridger, Colleen; Angelon-Gaetz, Kim; Nelson, Debi

    2010-01-01

    The North Carolina Comprehensive Assessment for Tracking Community Health (NC CATCH) is a Web-based analytical system deployed to local public health units and their community partners. The system has the following characteristics: flexible, powerful online analytic processing (OLAP) interface; multiple sources of multidimensional, event-level data fully conformed to common definitions in a data warehouse structure; enabled utilization of available decision support software tools; analytic capabilities distributed and optimized locally with centralized technical infrastructure; two levels of access differentiated by the user (anonymous versus registered) and by the analytical flexibility (Community Profile versus Design Phase); and, an emphasis on user training and feedback. The ability of local public health units to engage in outcomes-based performance measurement will be influenced by continuing access to event-level data, developments in evidence-based practice for improving population health, and the application of information technology-based analytic tools and methods.

  2. Violenze allo stadio: il caso di Filippo Raciti / Violence in football stadiums: the case of Filippo Raciti / Violences au stade: l'affaire Filippo Raciti

    Directory of Open Access Journals (Sweden)

    Ziosi M.

    2008-12-01

    Full Text Available Afin d'aborder le sujet de la violence dans les stades, j'ai avant tout analysé brièvement les épisodes les plus graves pour lesquels la chronique sportive s'est colorée de noir, pour arriver enfin au meurtre de Filippo Raciti. Par le biais des 392 articles publiés au mois de février 2007 dans les quotidiens Il Corriere della Sera, la Repubblica, Il Resto del Carlino et l’Unità, j'ai examiné cette affaire criminelle de la manière suivante: premièrement une description du déroulement des faits du 2 février 2007, dans laquelle les séquences et les dynamiques qui ont entraînés la mort de l'inspecteur Raciti emergent, a été effectuée, suivie par une analyse de contenu communicatif des articles dans le but de mettre en évidence les modalités de traitement de l'information dans la presse. Cette analyse se compose d'un volet quantitatif et d'un volet qualitatif: ce dernier a été realisé par le biais d'une fiche de collecte des données divisée en sujets. De cet examen approfondi du language journalistique découlent des réfléxions sur la délicate affaire "Filippo Raciti" et sur la ville de Catane, sur le "système football" en général et sur la situation de la sécurité dans les stades. Enfin, des propositions qui, mettant en évidence les points faibles des lois actuelles, ont pour but d'envisager des interventions pour réduire le comportement violent des supporters.AbstractIn order to deal with the problems of violence in football stadiums, I have first of all shortly analysed the most serious episodes in which have darkened the sporting world and then explained the murder of Filippo Raciti. Through the reading of the 392 articles published on the daily papers Il Corriere della Sera, la Repubblica, Il Resto del Carlino and l'Unità in the month of February 2007, the criminal case is examined in the following way: to a first description of the course of events of February 2nd 2007, in which the sequences and the

  3. ORF Sequence: NC_002505 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002505 gi|15642286 >gi|15642286|ref|NP_231919.1| hypothetical protein VC2288 [Vibrio cholerae... O1 biovar eltor str. N16961] MNTFLITFGFFLAVIAAMAVGYIFQRKVVKGSCGGLGAVGIEKVCNCPEPCDARKKREAKAAARAERLAAWEKDRIA

  4. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601079 >gi|15601079|ref|NP_232710.1| hypothetical protein VCA0314 [Vibrio cholerae... O1 biovar eltor str. N16961] MCFSEKFSQLCAYNSDVRCTMSENQKVKRAEPIETCSYKSPCVRHCCLDDKDICIGCGRTLDEICRWSSATNSEKQEILINSLARVQSRNISI

  5. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601189 >gi|15601189|ref|NP_232820.1| hypothetical protein VCA0426 [Vibrio cholerae... O1 biovar eltor str. N16961] MRCTMSENQNVKRAEPIETCSYKSPCVRHCCLDDKDICIGCGRTIDEICRWSSATNSEKQEILINCLARVQGRNIST

  6. ORF Sequence: NC_002506 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002506 gi|15601250 >gi|15601250|ref|NP_232881.1| hypothetical protein VCA0489 [Vibrio cholerae... O1 biovar eltor str. N16961] MVEIIWTELALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVSPCRVFYKYDDAKVRILFVMRAERDLRRLMLTKQ

  7. ORF Sequence: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (17.7 kD) (skr-19) [Caenorhabditis elega... NC_003284 gi|25150539 >gi|25150539|ref|NP_510193.2| SKp1 Related, ubiquitin ligase

  8. ORF Sequence: NC_003284 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (19.6 kD) (skr-20) [Caenorhabditis elega... NC_003284 gi|17569457 >gi|17569457|ref|NP_510192.1| SKp1 Related, ubiquitin ligase

  9. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (18.9 kD) (skr-12) [Caenorhabditis elega... NC_003282 gi|17542038 >gi|17542038|ref|NP_503045.1| SKp1 Related, ubiquitin ligase

  10. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available complex component, an evolutionarily conserved kinetochore protein (20.1 kD) (skr-15) [Caenorhabditis elega... NC_003280 gi|17535721 >gi|17535721|ref|NP_494662.1| SKp1 Related, ubiquitin ligase

  11. ORF Sequence: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|25155185 >gi|25155185|ref|NP_741574.1| SpermaTHecal expression STH-1,... putative cytoplasmic protein (13.5 kD) (sth-1) [Caenorhabditis elegans] MSQKSKKSIGDVVVTSKLVFPVAEFRTKWERLWPK

  12. ORF Sequence: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|32564269 >gi|32564269|ref|NP_871961.1| transthyretin-like precursor f...amily member (15.5 kD) (2F18) [Caenorhabditis elegans] MKWILAVFLLAGVAIAMRKQGVAVKGVLKCGTAFANNTKVRIVDIDTGPDPDDTLDEKRTGEDGAFALTGSTH

  13. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17557043 >gi|17557043|ref|NP_498707.1| copper (CU) Chaperonin, functi...onal, complements yeast atx1 mutant (7.6 kD) (cuc-1) [Caenorhabditis elegans] MTQYVFEMGMTCNGCANAARKVLGKLGEDKIKIDDINVETKKITVTTDLPASDVLEALKKTGKEIKQLQ

  14. ORF Sequence: NC_003279 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003279 gi|17510521 >gi|17510521|ref|NP_491035.1| protein with 11 leucine rich repeats, enri...ched in embryos (59.3 kD) (1D304) [Caenorhabditis elegans] MRPPVLILLVLVSGVISCQSGCKCPTKTTAVCKGSSLRSIPILLDPRTTVLDLSNNRI

  15. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available factor, as suggested by computational analysis of large-scale protein-protein interaction data; Ist1p [Sacch... NC_001146 gi|6324064 >gi|6324064|ref|NP_014134.1| Putative translation initiation

  16. ORF Sequence: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608466 >gi|15608466|ref|NP_215842.1| PROBABLE 1,4-ALPHA-GLUCAN BRANCHING ENZYME GLGB (GLYCOG...EN BRANCHING ENZYME) [Mycobacterium tuberculosis H37Rv] MSRSEKLTGEHLAPEPAEMARLVAGTH

  17. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25028543 >1c8kA 10 724 52 666 e-103 ... ref|YP_226324.1| ALPHA-GLUCAN PHOSPHORYLASE, GLYCOGEN...GLUCAN ... PHOSPHORYLASE, GLYCOGEN PHOSPHORYLASE [Corynebacterium ... glutamicum ATCC 13032] ...

  18. ORF Sequence: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792522 >gi|31792522|ref|NP_855015.1| PROBABLE 1,4-ALPHA-GLUCAN BRANCHING ENZYME GLGB (GLYCOG...EN BRANCHING ENZYME) [Mycobacterium bovis AF2122/97] MSRSEKLTGEHLAPEPAEMARLVAGTHHNP

  19. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|23308891 >1c8kA 10 724 52 666 e-103 ... ref|YP_226324.1| ALPHA-GLUCAN PHOSPHORYLASE, GLYCOGEN...GLUCAN ... PHOSPHORYLASE, GLYCOGEN PHOSPHORYLASE [Corynebacterium ... glutamicum ATCC 13032] ...

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965983 >1bu6Y 1 436 4 408 6e-44 ... emb|CAC46809.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386336.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  1. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965553 >1rkd0 3 268 9 275 2e-23 ... emb|CAC46379.1| PUTATIVE CARBOHYDRATE... KINASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_385906.1| PUTATIVE CARBOHYDRATE KINASE PROTEIN

  2. ORF Sequence: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available merization of 5-methylthioribose-1-phosphate to 5-methylthioribulose-1-phosphate in... NC_001148 gi|6325375 >gi|6325375|ref|NP_015443.1| Methylthioribose-1-phosphate isomerase, catalyzes the iso

  3. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erization at the 5' splice site; Prp28p [Saccharomyces cerevisiae] MARPIDVSQLIAGINK... NC_001136 gi|6320449 >gi|6320449|ref|NP_010529.1| RNA helicase in the DEAD-box family, involved in RNA isom

  4. BChPT x 1/Nc: masses and currents

    Energy Technology Data Exchange (ETDEWEB)

    Goity, Jose L. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States); Fernando, Ishara P. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Hampton Univ., Hampton, VA (United States)

    2018-04-01

    A summary of the implementation of the combined BChPT X 1/Nc expansion for three flavors is presented, along with its applications to the octet and decuplet baryon masses, SU(3) charges and axial couplings.

  5. ORF Sequence: NC_003995 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available vities [Bacillus anthracis str. A2012] MKEVLEVLPKTMKQLVESCKQYDALEEIRVRIGRPLECIAHGEV... NC_003995 gi|21402245 >gi|21402245|ref|NP_658230.1| AAA, ATPases associated with a variety of cellular acti

  6. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

  7. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available H2O2 and alkyl hydroperoxides with the use of hydrogens provided by thioredoxin, thioredoxin reductase, and ... NC_001136 gi|6320661 >gi|6320661|ref|NP_010741.1| Thioredoxin-peroxidase, reduces

  8. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

  9. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

  10. ORF Sequence: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

  11. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 142 VDAVLSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_002755 gi|15843206 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  12. ORF Alignment: NC_001264 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 237 RVSLLVQEVGGPVLSSLNTSRPLAVGSTFKLAVLGEVQAQ... NC_001264 gi|15807905 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  13. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available protein [Amycolatopsis azurea] ... Length = 288 ... Query: 156 VDAALSKTGARYSFQVAKVDNGRCDPVAGTNTGESLPLAS... NC_000962 gi|15610729 >1m40A 3 263 6 293 3e-07 ... gb|AAQ21340.1| beta-lactamase-like

  14. 76 FR 78331 - Environmental Impact Statement: Jackson County, NC

    Science.gov (United States)

    2011-12-16

    ... following purpose description: ``The purpose of this project is to relieve traffic congestion in the Sylva... that improves the NC 107 north/south vehicular mobility by increasing average speeds for through...

  15. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25028312 >1bt3A 46 337 1 298 1e-36 ... ref|NP_738366.1| putative tyrosinase... [Corynebacterium efficiens YS-314] ... dbj|BAC18566.1| putative tyrosinase [Corynebacterium ...

  16. ORF Sequence: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

  17. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

  18. ORF Sequence: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi Ty2] MSNQYQTQGYTVNDAGRRLIVDPITRIEGHMRCEVNIDEQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERIC... NC_004631 gi|29141562 >gi|29141562|ref|NP_804904.1| hydrogenase-1 large chain [Salmonella enteric

  19. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800894 >gi|15800894|ref|NP_286910.1| hydrogenase-1 large subunit [Escheric...hia coli O157:H7 EDL933] MSTQYETQGYTINNAGRRLVVDPITRIEGHMRCEVNINDQNVITNAVSCGTMFRGLEIILQGRDPRDAWAFVERIC

  20. ORF Sequence: NC_004631 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi Ty2] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERICR... NC_004631 gi|29142069 >gi|29142069|ref|NP_805411.1| hypothetical protein t1633 [Salmonella enteric

  1. ORF Sequence: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801912 >gi|15801912|ref|NP_287932.1| hypothetical protein Z2543 [Escheric...hia coli O157:H7 EDL933] MGTAAEHHREGIMSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLPDGHNF

  2. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Choleraesuis str. SC-B67] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_006905 gi|62180287 >gi|62180287|ref|YP_216704.1| putative translation factor [Salmonella enteric

  3. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413501 >gi|56413501|ref|YP_150576.1| hydrogenase-1 large subunit [Salmonella enteric...a subsp. enterica serovar Paratypi A str. ATCC 9150] MAYPYQTQGFTLDNSGRRIVVDPVTRIEGHMRCEVNID...SNNVITNAVSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGTHALTSIRAVENALGIAIPDNANCIRNMMQATLHVHDHLVHFYHLHALDWVDVVAALKADPHQTS

  4. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56414112 >gi|56414112|ref|YP_151187.1| hypothetical protein SPA1967 [Salmonella enteric...a subsp. enterica serovar Paratypi A str. ATCC 9150] MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQ...VQPMVVSPDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAGNVSVTRLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQERIC

  5. ORF Sequence: NC_003384 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi str. CT18] MVPFCHKLEEKLMTSNRCREIKTPPEHIIADYILRFMKNNKEAKLYEAMSRLESKINLFVADGHDELHIRALLNQAAHSHTKESLKQACERICN ... NC_003384 gi|18466439 >gi|18466439|ref|NP_569247.1| hypothetical protein HCM1.23c [Salmonella enteric

  6. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180125 >gi|62180125|ref|YP_216542.1| putative hydrogenase-1 large subunit [Salmonella enteri...ca subsp. enterica serovar Choleraesuis str. SC-B67] MAYPYQTQGFTLDNSGRRIVVDPVTRIEGH...MRCEVNIDSNNVITNAVSTGTMWRGLEVILKGRDPRDAWAFVERICGVCTGTHALTSIRAVENALGIAIPDNANCIRKKLPKEALFSTLGRTAARALESVWAGNTLQY

  7. ORF Sequence: NC_003198 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Typhi str. CT18] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_003198 gi|16760160 >gi|16760160|ref|NP_455777.1| hypothetical protein STY1330 [Salmonella enteric

  8. ORF Sequence: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available a subsp. enterica serovar Paratypi A str. ATCC 9150] MSQFFYIHPDNPQQRLINQAVDIVRKGGVIVYPTDSGYALGCKIEDKGAMERIC... NC_006511 gi|56413354 >gi|56413354|ref|YP_150429.1| hypothetical protein SPA1156 [Salmonella enteric

  9. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

  10. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

  11. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  13. ORF Alignment: NC_004663 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  14. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  15. ORF Alignment: NC_005139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  16. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  17. ORF Alignment: NC_006177 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  18. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  19. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  20. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  2. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  3. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  4. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  5. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

  6. Observations of NC stop nets for bottlenose dolphin takes

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — To observe the NC stop net fishery to document the entanglement of bottlenose dolphins and movement of dolphins around the nets.

  7. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

  8. ORF Sequence: NC_001138 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001138 gi|14318506 >gi|14318506|ref|NP_116640.1| Plasma membrane localized protein that protects membran...es from desiccation; induced by heat shock, oxidative stress, osmostress, stationar

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13472223 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  10. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722803 >1jjfA 1 218 44 286 9e-11 ... ref|YP_105113.1| polyhydroxybutyrate... depolymerase domain protein [Burkholderia ... mallei ATCC 23344] gb|AAU46186.1| polyhydroxybutyrate

  11. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003037 gi|16263528 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  12. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39933642 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  13. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27376010 >1fj2A 7 191 50 249 1e-07 ... emb|CAE26009.1| putative polyhydroxybutyrate... depolymerase [Rhodopseudomonas ... palustris CGA009] ref|NP_945918.1| putative ... polyhydroxybutyrate

  14. ORF Alignment: NC_006349 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006349 gi|53716646 >1jjfA 1 218 44 286 9e-11 ... ref|YP_105113.1| polyhydroxybutyrate... depolymerase domain protein [Burkholderia ... mallei ATCC 23344] gb|AAU46186.1| polyhydroxybutyrate

  15. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320036 >gi|6320036|ref|NP_010116.1| Component of the CCR4-NOT complex, which has multiple rol...es in regulating mRNA levels including regulation of transcription and destabilizin

  16. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in involved in copper (silver) tolerance [Escherichia coli K12] MKKIALIIGSMIAGGIISAAGFTWVAKAEPPAEKTSTAERKILF... NC_000913 gi|16128557 >gi|16128557|ref|NP_415106.1| outer membrane transport prote

  17. ORF Sequence: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available in involved in copper (silver) tolerance [Escherichia coli K12] MSPCKLLPFCVALALTGCSLAPDYQRPAMPVPQQFSLSQNGLVN... NC_000913 gi|16128555 >gi|16128555|ref|NP_415104.1| outer membrane transport prote

  18. ORF Sequence: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family... protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV

  19. ORF Sequence: NC_003281 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003281 gi|17552838 >gi|17552838|ref|NP_498286.1| dynamitin like, DyNactin Complex component DNC...-2 (37.2 kD) (dnc-2) [Caenorhabditis elegans] MSSIGKEDIYESDGAASQVQKSEPENDNPTHPDIELISVDVDEALK

  20. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001134 gi|6319437 >gi|6319437|ref|NP_009519.1| Component of the mitotic spindle that binds to interpol...ar microtubules via its association with beta-tubulin (Tub2p); required for interpola

  1. 77 FR 46631 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-08-06

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Final... acceptance of full power television rulemaking petitions requesting channel substitutions in May 2011, it... Subjects in 47 CFR Part 73 Television. Federal Communications Commission. Barbara A. Kreisman, Chief, Video...

  2. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ndonuclease [Thermotoga subterranea] ... Length = 143 ... Query: 17 ... AGFFDGEGSVVVRFVRDGRYRAGYRVSTKVVFVQK... NC_003551 gi|20093993 >1t9iB 13 153 2 144 3e-22 ... emb|CAD89234.1| putative homing e

  3. ORF Alignment: NC_001147 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available r membrane transporter, exports 2-oxoadipate and ... 2-oxoglutarate from the mitochondrial matrix to ... NC_001147 gi|6324796 >1okcA 2 289 8 293 2e-45 ... ref|NP_014865.1| Mitochondrial inne

  4. ORF Alignment: NC_001148 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available r membrane transporter, exports 2-oxoadipate and ... 2-oxoglutarate from the mitochondrial matrix to ... NC_001148 gi|6325123 >1okcA 1 288 6 292 4e-39 ... ref|NP_015191.1| Mitochondrial inne

  5. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

  6. ORF Sequence: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

  7. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

  8. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321481 >gi|6321481|ref|NP_011558.1| Zinc finger protein involved in control of meiosis; preve...nts meiosis by repressing IME1 expression and promotes mitosis by activating CLN2 e

  9. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  10. Synthesis, thermolysis, and sensitivities of HMX/NC energetic nanocomposites.

    Science.gov (United States)

    Wang, Yi; Song, Xiaolan; Song, Dan; Liang, Li; An, Chongwei; Wang, Jingyu

    2016-07-15

    1,3,5,7-Tetranittro-1,3,5,7-tetrazocane/nitrocellulose (HMX/NC) nanocomposites were successfully synthesized by an improved sol-gel-supercritical method. NC nanoparticles with a size of ∼30nm were cross-linked to form a network structure, and HMX nanoparticles were imbedded in the nano-NC matrix. The key factors, i.e., the selection of catalyst and solvent, were probed. No phase transformation of the HMX occurred before or after fabrication, and the molecular structures of the HMX and NC did not change. Thermal analyses were performed, and the kinetic and thermodynamic parameters, such as activation energy (EK), per-exponent factor (lnAK), rate constant (k), activation heat (ΔH(≠)), activation free energy (ΔG(≠)), activation entropy (ΔS(≠)), critical temperature of thermal explosion (Tb), and critical heating rate of thermal explosion (dT/dt)Tb, were calculated. The results indicate that HMX/NC presented a much lower activation energy (165.03kJ/mol) than raw HMX (282.5kJ/mol) or raw NC (175.51kJ/mol). The chemical potential (ΔG(≠)) for the thermal decomposition of HMX/NC has a positive value, which means that the activation of the molecules would not proceed spontaneously. The significantly lower ΔH(≠) value of HMX/NC, which represents the heat needed to be absorbed by an explosive molecule to change it from its initial state to an activated state, implies that the molecules of HMX/NC are much easier to be activated than those of raw HMX. Similarly, the HMX/NC presented a much lower Tb (168.2°C) than raw HMX (283.2°C). From the results of the sensitivity tests, the impact and friction sensitivities of HMX/NC were significantly decreased compared with those of raw HMX, but the thermal sensitivity was distinctly higher. The activation of the particles under external stimulation was simulated, and the mechanism was found to be crucial. Combining the thermodynamic parameters, the mechanism as determined from the results of the sensitivity tests was

  11. Enhanced Surveillance during the Democratic National Convention, Charlotte, NC

    OpenAIRE

    Deyneka, Lana; Ising, Amy; Li, Meichun

    2013-01-01

    Objective To describe how the existing state syndromic surveillance system (NC DETECT) was enhanced to facilitate surveillance conducted at the Democratic National Convention in Charlotte, North Carolina from August 31, 2012 to September 10, 2012. Introduction North Carolina hosted the 2012 Democratic National Convention, September 3?6, 2012. The NC Epidemiology and Surveillance Team was created to facilitate enhanced surveillance for injuries and illnesses, early detection of outbreaks durin...

  12. precision deburring using NC and robot equipment. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Gillespie, L.K.

    1980-05-01

    Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

  13. Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

    Science.gov (United States)

    Das, Debajyoti; Kar, Debjit

    2017-12-01

    A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

  14. Enhanced Surveillance during the Democratic National Convention, Charlotte, NC

    Science.gov (United States)

    Deyneka, Lana; Ising, Amy; Li, Meichun

    2013-01-01

    Objective To describe how the existing state syndromic surveillance system (NC DETECT) was enhanced to facilitate surveillance conducted at the Democratic National Convention in Charlotte, North Carolina from August 31, 2012 to September 10, 2012. Introduction North Carolina hosted the 2012 Democratic National Convention, September 3–6, 2012. The NC Epidemiology and Surveillance Team was created to facilitate enhanced surveillance for injuries and illnesses, early detection of outbreaks during the DNC, assist local public health with epidemiologic investigations and response, and produce daily surveillance reports for internal and external stakeholders. Surveillane data were collected from several data sources, including North Carolina Electronic Disease Surveillance System (NC EDSS), triage stations, and the North Carolina Disease Event Tracking and Epidemiologic Collection Tool (NC DETECT). NC DETECT was created by the North Carolina Division of Public Health (NC DPH) in 2004 in collaboration with the Carolina Center for Health Informatics (CCHI) in the UNC Department of Emergency Medicine to address the need for early event detection and timely public health surveillance in North Carolina using a variety of secondary data sources. The data from emergency departments, the Carolinas Poison Center, the Pre-hospital Medical Information System (PreMIS) and selected Urgent Care Centers were available for monitoring by authorized users during the DNC. Methods Within NC DETECT, new dashboards were created that allowed epidemiologists to monitor ED visits and calls to the poison center in the Charlotte area, the greater Cities Readiness Initiative region and the entire state for infectious disease signs and symptoms, injuries and any mention of bioterrorism agents. The dashboards also included a section to view user comments on the information presented in NC DETECT. Data processing changes were also made to improve the timeliness of the EMS data received from Pre

  15. Synthesis, thermolysis, and sensitivities of HMX/NC energetic nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yi, E-mail: wangyi528528@aliyun.com [School of Materials Science and Engineering, North University of China, Taiyuan 030051 (China); Song, Xiaolan, E-mail: songxiaolan00@126.com [School of Chemical Engineering and Environment, North University of China, Taiyuan 030051 (China); Song, Dan [China Ordnance Institute of Science and Technology, Beijing 100089 (China); Liang, Li; An, Chongwei; Wang, Jingyu [School of Chemical Engineering and Environment, North University of China, Taiyuan 030051 (China)

    2016-07-15

    Highlights: • A novel energetic nanocomposite (i.e., HMX/NC nanocomposites) was fabricated in which nano-HMX imbedded in nano-NC matrix. • The usage of catalysts and solvent, which dominated the fabrication, was discussed. • Thermodynamic and kinetic parameters were calculated to probe the thermal decomposition of HMX/NC. • Decomposition products were detected by DSC-IR analysis. • Friction, impact, and thermal sensitivity tests were performed and the mechanism about the results was discussed. - Abstract: 1,3,5,7-Tetranittro-1,3,5,7-tetrazocane/nitrocellulose (HMX/NC) nanocomposites were successfully synthesized by an improved sol-gel-supercritical method. NC nanoparticles with a size of ∼30 nm were cross-linked to form a network structure, and HMX nanoparticles were imbedded in the nano-NC matrix. The key factors, i.e., the selection of catalyst and solvent, were probed. No phase transformation of the HMX occurred before or after fabrication, and the molecular structures of the HMX and NC did not change. Thermal analyses were performed, and the kinetic and thermodynamic parameters, such as activation energy (E{sub K}), per-exponent factor (lnA{sub K}), rate constant (k), activation heat (ΔH{sup ≠}), activation free energy (ΔG{sup ≠}), activation entropy (ΔS{sup ≠}), critical temperature of thermal explosion (T{sub b}), and critical heating rate of thermal explosion (dT/dt){sub Tb}, were calculated. The results indicate that HMX/NC presented a much lower activation energy (165.03 kJ/mol) than raw HMX (282.5 kJ/mol) or raw NC (175.51 kJ/mol). The chemical potential (ΔG{sup ≠}) for the thermal decomposition of HMX/NC has a positive value, which means that the activation of the molecules would not proceed spontaneously. The significantly lower ΔH{sup ≠} value of HMX/NC, which represents the heat needed to be absorbed by an explosive molecule to change it from its initial state to an activated state, implies that the molecules of HMX/NC are

  16. Improving Earth Science Metadata: Modernizing ncISO

    Science.gov (United States)

    O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

    2016-12-01

    ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

  17. Characterization of the Neospora caninum NcROP40 and NcROP2Fam-1 rhoptry proteins during the tachyzoite lytic cycle.

    Science.gov (United States)

    Pastor-Fernández, Iván; Regidor-Cerrillo, Javier; Jiménez-Ruiz, Elena; Álvarez-García, Gema; Marugán-Hernández, Virginia; Hemphill, Andrew; Ortega-Mora, Luis M

    2016-01-01

    Virulence factors from the ROP2-family have been extensively studied in Toxoplasma gondii, but in the closely related Neospora caninum only NcROP2Fam-1 has been partially characterized to date. NcROP40 is a member of this family and was found to be more abundantly expressed in virulent isolates. Both NcROP2Fam-1 and NcROP40 were evaluated as vaccine candidates and exerted a synergistic effect in terms of protection against vertical transmission in mouse models, which suggests that they may be relevant for parasite pathogenicity. NcROP40 is localized in the rhoptry bulbs of tachyzoites and bradyzoites, but in contrast to NcROP2Fam-1, the protein does not associate with the parasitophorous vacuole membrane due to the lack of arginine-rich amphipathic helix in its sequence. Similarly to NcROP2Fam-1, NcROP40 mRNA levels are highly increased during tachyzoite egress and invasion. However, NcROP40 up-regulation does not appear to be linked to the mechanisms triggering egress. In contrast to NcROP2Fam-1, phosphorylation of NcROP40 was not observed during egress. Besides, NcROP40 secretion into the host cell was not successfully detected by immunofluorescence techniques. These findings indicate that NcROP40 and NcROP2Fam-1 carry out different functions, and highlight the need to elucidate the role of NcROP40 within the lytic cycle and to explain its relative abundance in tachyzoites.

  18. An overview on STEP-NC compliant controller development

    Science.gov (United States)

    Othman, M. A.; Minhat, M.; Jamaludin, Z.

    2017-10-01

    The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

  19. KAJlAN EKONOMI PEMANFAATAN KAWASAN STADION KRIDOSONO SEBAGAI RUANG HIJAU KOTA YOGYAKARTA (Economic Study for Utilization of Kridosono Stadium Area as An Urban Green Space of Yogyakarta Municipality

    Directory of Open Access Journals (Sweden)

    Amiluhur Soeroso

    2010-07-01

    Objective of the study is measuring economy feasibility of Kridosono urban park as a public goods that expected directly addresses the issues of natural environmental quality. Data were obtained from interviews toward local resident of Yogyakarta municipality. Hereafter, willingness to pay (WTP toward demand models were estimated by contingent valuation method (CVM and used to derive total consumer surplus. The results indicate that economic value of Kridosono Stadium land is about US$ 27 million (IDR 257 billion per annum, more than its market price i.e. amount US$ 7.8 million or IDR 74 billion. Thus, the study gives stakeholders knowledge of decision making for managing, funding and alocating resources. Utilization part of Kridosono Stadium land as urban park will give bigger benefit than it would be this for commercial interest. Auspicious is hanging on the urban park, because it will help eliminate greenhouse gases i.e. Carbon dioxide, Methane, Nitrous oxide, Hydro-fluorocarbons, Perflurocarbon and Sulfur hexafluoride which is produced by motor vehicle.

  20. Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

    Science.gov (United States)

    Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

    2017-11-01

    TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

  1. Design and evaluation of the ReKon : an integrated detection and assessment perimeter system.

    Energy Technology Data Exchange (ETDEWEB)

    Dabling, Jeffrey Glenn; Andersen, Jason Jann; McLaughlin, James O. [Stonewater Control Systems, Inc., Kannapolis, NC

    2013-02-01

    Kontek Industries (Kannapolis, NC) and their subsidiary, Stonewater Control Systems (Kannapolis, NC), have entered into a cooperative research and development agreement with Sandia to jointly develop and evaluate an integrated perimeter security system solution, one that couples access delay with detection and assessment. This novel perimeter solution was designed to be configurable for use at facilities ranging from high-security military sites to commercial power plants, to petro/chemical facilities of various kinds. A prototype section of the perimeter has been produced and installed at the Sandia Test and Evaluation Center in Albuquerque, NM. This prototype system integrated fiber optic break sensors, active infrared sensors, fence disturbance sensors, video motion detection, and ground sensors. This report documents the design, testing, and performance evaluation of the developed ReKon system. The ability of the system to properly detect pedestrian or vehicle attempts to bypass, breach, or otherwise defeat the system is characterized, as well as the Nuisance Alarm Rate.

  2. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004757 gi|30250333 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_002488 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002488 gi|15837680 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  4. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54293610 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  5. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842381 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  6. ORF Alignment: NC_002946 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002946 gi|59800726 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  7. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21242823 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  8. ORF Alignment: NC_003112 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003112 gi|15676600 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  9. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53803220 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  10. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21231567 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  11. ORF Alignment: NC_004551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004551 gi|28572541 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  12. ORF Alignment: NC_004572 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004572 gi|28493349 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  13. ORF Alignment: NC_003869 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003869 gi|20807422 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  14. ORF Alignment: NC_003116 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003116 gi|15793872 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  15. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54296649 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  16. ORF Alignment: NC_004556 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004556 gi|28198275 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  17. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52840863 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  18. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085709 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  19. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495926 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  20. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15598180 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  1. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006513 gi|56478742 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  2. ORF Alignment: NC_006834 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006834 gi|58581923 >2bc2A 10 205 522 711 9e-06 ... ref|NP_842403.1| DNA internalization...-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19718] emb|CAD86320.1| DNA ... internalizat...ion-related competence protein ComEC/Rec2 ... [Nitrosomonas europaea ATCC 19

  3. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990072 >1uzbA 37 513 3 472 6e-68 ... ref|NP_745497.1| vanillin dehydro...genase [Pseudomonas putida KT2440] gb|AAN68961.1| ... vanillin dehydrogenase [Pseudomonas putida KT24

  4. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

  5. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

  6. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126641 >1uzbA 58 515 12 462 8e-77 ... ref|NP_421205.1| vanillin dehydr...ogenase [Caulobacter crescentus CB15] gb|AAK24373.1| ... vanillin dehydrogenase [Caulobacter crescent...us CB15] ... pir||A87547 vanillin dehydrogenase [imported] - ... Caulobacter crescentus ...

  7. ORF Alignment: NC_005955 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005955 gi|49474347 >1k0iA 1 388 1 408 7e-30 ... ref|YP_032389.1| Salicylate hydrox...ylase [Bartonella quintana str. Toulouse] ... emb|CAF26245.1| Salicylate hydroxylase [Bartonella ...

  8. ORF Alignment: NC_005956 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005956 gi|49475734 >1k0iA 6 384 6 406 2e-28 ... ref|YP_033775.1| Salicylate hydrox...ylase [Bartonella henselae str. Houston-1] ... emb|CAF27777.1| Salicylate hydroxylase [Bartonella ...

  9. ORF Alignment: NC_006142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006142 gi|51473766 >1xvqA 17 163 40 196 7e-07 ... ref|YP_067523.1| Sco2-like prote...in [Rickettsia typhi str. Wilmington] gb|AAU04041.1| ... Sco2-like protein [Rickettsia typhi str. Wil

  10. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604438 >1xvqA 17 163 47 203 4e-07 ... ref|NP_220956.1| SCO2 PROTEIN PRECURSOR (sco2...) [Rickettsia prowazekii str. Madrid E] ... emb|CAA15032.1| SCO2 PROTEIN PRECURSOR (sco2...) ... [Rickettsia prowazekii] pir||F71663 sco2 protein ... precursor (sco2) RP587 - Rickettsia

  11. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17546835 >1f86A 3 109 4 113 5e-28 ... emb|CAD15823.1| PUTATIVE TRANSTHYR...ETIN-LIKE PROTEIN PRECURSOR [Ralstonia ... solanacearum] ref|NP_520237.1| PUTATIVE ... TRANSTH...YRETIN-LIKE PROTEIN PRECURSOR [Ralstonia ... solanacearum GMI1000] sp|Q8XXJ7|YL16_RALSO Hypothetical ... transth

  12. ORF Alignment: NC_003030 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003030 gi|15895740 >1w3oA 13 174 5 153 2e-30 ... ref|NP_349089.1| Possible 5-Nitroimidazole antibiotics... ... gb|AAK80429.1| Possible 5-Nitroimidazole antibiotics ... resistance protein, NimA-family [Clost...ridium ... acetobutylicum ATCC 824] pir||B97205 probable ... 5-Nitroimidazole antibiotics

  13. ORF Alignment: NC_002607 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002607 gi|15790649 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp ...

  14. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094872 >1b22A 10 70 5 63 2e-10 ... pdb|1XU4|A Chain A, Atpase In Compl...ex With Amp-Pnp, Magnesium And Potassium ... Co-F pdb|1T4G|A Chain A, Atpase In Complex With Amp-Pnp

  15. ORF Alignment: NC_000918 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000918 gi|15606868 >1tg6E 33 200 25 196 8e-08 ... ref|NP_214248.1| nodulation competitiveness... protein NfeD [Aquifex aeolicus VF5] ... gb|AAC07639.1| nodulation competitiveness protein... NfeD ... [Aquifex aeolicus VF5] pir||H70456 nodulation ... competitiveness protein NfeD - Aqu

  16. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42572131 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  17. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|42563264 >1ig6A 3 105 144 247 2e-18 ... ref|NP_177777.3| ARID/BRIGHT DNA...-binding domain-containing protein [Arabidopsis ... thaliana] ref|NP_974156.1| ARID/BRIGHT DNA-bindin

  18. ORF Alignment: NC_005835 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available he Bacterial Chromosome Segregation Protein ... Soj pdb|1WCV|1 Chain 1, Structure Of The Bacterial ... Chromosome Segre...gation Protein Soj ... Length = 243 ... Query: 5 ... KVRRIALANQKGGVGKTTTAINLAAYLA... NC_005835 gi|46199907 >1wcv1 1 243 5 247 3e-93 ... pdb|2BEJ|A Chain A, Structure Of T

  19. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006361 gi|54027007 >1amuA 4 512 1501 2031 9e-92 ... ref|YP_083722.1| nonribosomal ...peptide synthetase [Bacillus cereus ZK] gb|AAU18126.1| ... nonribosomal peptide synthetase [Bacillus... cereus ZK] ... Length = 531 ... Query: 8405 ERDLVLRAWNTPGVEVPEVTMVDLXXXXXXXXXXXXXXXFGDTALSFGEMQRRANRIAR

  20. ORF Alignment: NC_006366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006366 gi|54292957 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  1. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54295748 >2bjvA 9 226 34 249 5e-52 ... gb|AAC36805.1| HrpS [Pantoea stewartii subsp. stewart...ii] pir||S36185 wtsA protein ... - Erwinia stewartii sp|P36219|WTSA_ERWST Pathoge

  2. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601919 >1n62B 44 802 1 748 0.0 ... ref|NP_148464.1| nicotine dehydroge...nase chain C [Aeropyrum pernix K1] ... dbj|BAA81228.1| 750aa long hypothetical nicotine ... de...hydrogenase chain C [Aeropyrum pernix K1] pir||D72530 ... probable nicotine dehydrogenase chain C APE

  3. ORF Alignment: NC_000854 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000854 gi|14601920 >1n62C 1 286 1 287 2e-71 ... ref|NP_148465.1| nicotine dehydrog...enase chain A [Aeropyrum pernix K1] ... dbj|BAA81231.1| 292aa long hypothetical nicotine ... d...ehydrogenase chain A [Aeropyrum pernix K1] pir||G72530 ... probable nicotine dehydrogenase chain A AP

  4. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003106 gi|15922820 >1n62B 24 793 4 684 e-115 ... ref|NP_378489.1| hypothetical nicotine... dehydrogenase subunit C [Sulfolobus tokodaii ... str. 7] dbj|BAB67598.1| 685aa long hypothetical nicotine

  5. ORF Alignment: NC_006509 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006509 gi|56410456 >1n62C 1 286 1 287 4e-70 ... ref|YP_145830.1| nicotine dehydrog...enase chain A [Geobacillus kaustophilus HTA426] ... dbj|BAD74262.1| nicotine dehydrogenase chain A ...

  6. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56419966 >1ofdA 1 1500 22 1473 0.0 ... ref|YP_147284.1| glutamate synthasel...arge subunit [Geobacillus kaustophilus HTA426] ... dbj|BAD75716.1| glutamate synthaselarge subuni

  7. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56421196 >1q6zA 7 522 41 566 e-133 ... ref|YP_148514.1| acetolactate synthasel...arge subunit [Geobacillus kaustophilus ... HTA426] dbj|BAD76946.1| acetolactate synthaselarge ...

  8. ORF Alignment: NC_006510 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006510 gi|56418908 >1q6zA 2 522 9 531 e-114 ... ref|YP_146226.1| acetolactate synthasel...arge subunit [Geobacillus kaustophilus ... HTA426] dbj|BAD74658.1| acetolactate synthaselarge ...

  9. ORF Alignment: NC_001140 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available es cerevisiae] sp|P38699|STB5_YEAST STB5 protein ... gb|AAB68023.1| Stb5p: SIN3 binding protein ... ... NC_001140 gi|6321972 >1pyiA 4 86 21 101 4e-06 ... ref|NP_012048.1| Stb5p [Saccharomyc

  10. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475930 >1el5A 6 379 7 420 7e-42 ... ref|NP_107500.1| AgaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53286.1| AgaE

  11. ORF Alignment: NC_002679 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002679 gi|13488188 >1el5A 4 377 26 437 3e-36 ... ref|NP_085608.1| agaE(conversion of agropini...c acid to mannopinic acid) ... [Mesorhizobium loti MAFF303099] dbj|BAB54449.1| AgaE ...

  12. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13475854 >1el5A 4 378 18 430 4e-33 ... ref|NP_107424.1| agaE protein, conversion of agropini...c acid to mannopinic acid ... [Mesorhizobium loti MAFF303099] dbj|BAB53210.1| Aga

  13. ORF Alignment: NC_003551 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003551 gi|20094874 >1fdr0 4 243 2 220 3e-16 ... ref|NP_421197.1| vanillate O-demet...hylase, reductase subunit [Caulobacter crescentus ... CB15] gb|AAK24365.1| vanillate O-demethylase, r...eductase ... subunit [Caulobacter crescentus CB15] pir||A87546 ... vanillate O-demethylase, re

  14. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27377501 >1rfs0 15 126 14 141 2e-05 ... ref|NP_769030.1| vanillate O-dem...ethylase oxygenase subunit [Bradyrhizobium japonicum ... USDA 110] dbj|BAC47655.1| vanillate O-demeth

  15. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002947 gi|26990443 >1rfs0 13 126 12 126 3e-05 ... gb|AAN69332.1| vanillate demethy...lase A [Pseudomonas putida KT2440] ... ref|NP_745868.1| vanillate demethylase A [Pseudomonas ...

  16. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15600098 >2pia0 10 321 3 317 6e-83 ... ref|NP_253592.1| vanillate O-deme...thylase oxidoreductase [Pseudomonas aeruginosa ... PAO1] gb|AAG08290.1| vanillate O-demethylase ... ... ... oxidoreductase [Pseudomonas aeruginosa PAO1] pir||G83033 ... vanillate O-demethylase oxidoreduc

  17. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21241137 >1vm9A 1 108 12 123 1e-14 ... gb|AAM35255.1| vanillate O-demeth...ylase oxygenase subunit [Xanthomonas axonopodis ... pv. citri str. 306] ref|NP_640719.1| vanillate ...

  18. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50083706 >1vm9A 2 98 30 133 5e-15 ... ref|YP_045216.1| putative vanillat...e O-demethylase oxygenase subunit [Acinetobacter ... sp. ADP1] emb|CAG67394.1| putative vanillate ...

  19. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084192 >1vm9A 2 106 26 138 2e-15 ... ref|YP_045702.1| putative vanilla...te O-demethylase oxygenase subunit (VanA-like) ... [Acinetobacter sp. ADP1] emb|CAG67880.1| putative ... vanilla

  20. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084184 >1vm9A 1 102 6 110 3e-17 ... ref|YP_045694.1| vanillate O-demet...hylase oxygenase subunit ... (4-hydroxy-3-methoxybenzoate demethylase) [Acinetobacter ... sp. ADP1] emb|CAG67872.1| van...illate O-demethylase ... oxygenase subunit (4-hydroxy-3-methoxybenzoate ...

  1. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21241085 >1vm9A 2 101 26 130 1e-13 ... gb|AAM35203.1| vanillate O-demeth...ylase oxygenase subunit [Xanthomonas axonopodis ... pv. citri str. 306] ref|NP_640667.1| vanillate ...

  2. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16126632 >1rfs0 13 126 17 131 3e-05 ... ref|NP_421196.1| vanillate O-dem...ethylase oxygenase, subunit A [Caulobacter ... crescentus CB15] gb|AAK24364.1| vanillate O-demethylas...e ... oxygenase, subunit A [Caulobacter crescentus CB15] ... pir||H87545 vanillate O-demethyla

  3. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936681 >1rfs0 15 126 14 141 2e-05 ... ref|NP_769030.1| vanillate O-dem...ethylase oxygenase subunit [Bradyrhizobium japonicum ... USDA 110] dbj|BAC47655.1| vanillate O-demeth

  4. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229841 >1vm9A 1 108 12 123 3e-14 ... ref|NP_635758.1| vanillate O-deme...thylase oxygenase subunit [Xanthomonas campestris ... pv. campestris str. ATCC 33913] gb|AAM39682.1| vanilla

  5. ORF Alignment: NC_002516 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002516 gi|15600097 >1vm9A 1 108 6 116 4e-20 ... ref|NP_253591.1| vanillate O-demet...hylase oxygenase subunit [Pseudomonas aeruginosa ... PAO1] gb|AAG08289.1| vanillate O-demethylase oxy...genase ... subunit [Pseudomonas aeruginosa PAO1] pir||F83033 ... vanillate O-demethylase oxyge

  6. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28870083 >1vm9A 1 108 6 116 3e-17 ... ref|NP_792702.1| vanillate O-demet...hylase, oxygenase subunit [Pseudomonas syringae ... pv. tomato str. DC3000] gb|AAO56397.1| vanillate

  7. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003902 gi|21229775 >1vm9A 2 101 26 130 7e-13 ... ref|NP_635692.1| vanillate O-deme...thylase oxygenase subunit [Xanthomonas campestris ... pv. campestris str. ATCC 33913] gb|AAM39616.1| vanilla

  8. ORF Alignment: NC_006526 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006526 gi|56551352 >1czpA 7 89 20 102 3e-08 ... gb|AAV89080.1| vanillate O-demethy...lase oxidoreductase [Zymomonas mobilis subsp. ... mobilis ZM4] ref|YP_162191.1| vanillate O-demethyla

  9. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180177 >1s7fA 1 176 1 176 3e-74 ... ref|YP_216594.1| acetyl transferase, modifies... ... enterica serovar Choleraesuis str. SC-B67] ... gb|AAX65513.1| acetyl transferase, modifies

  10. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s; ... ATP-dependent adenylate transferase, modifies MoaD ... [Escherichia coli K12] dbj|BAA35...nylate transferase, modifies MoaD [Escherichia ... coli K12] gb|AAC73913.1| molybdopterin biosynthesi... NC_000913 gi|16128794 >1jw9B 1 247 2 248 9e-96 ... ref|NP_415347.1| ATP-dependent ade

  11. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30019013 >1t5bA 1 183 1 166 4e-19 ... ref|NP_830644.1| Modulator of drug... activity B [Bacillus cereus ATCC 14579] ... gb|AAP07845.1| Modulator of drug activity B [Bacillus ...

  12. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359051 >1vpbA 3 420 7 430 1e-73 ... ref|NP_988608.1| Modulator of DNA ...gyrase [Methanococcus maripaludis S2] ... emb|CAF31044.1| Modulator of DNA gyrase [Methanococcus ...

  13. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359088 >1vpbA 2 433 1 416 2e-52 ... ref|NP_988645.1| Modulator of DNA ...gyrase [Methanococcus maripaludis S2] ... emb|CAF31081.1| Modulator of DNA gyrase [Methanococcus ...

  14. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557929 >1kmoA 12 661 39 664 3e-52 ... ref|NP_907744.1| RECEPTOR PRECURSOR-Most...ly Fe transport [Wolinella succinogenes DSM ... 1740] emb|CAE10644.1| RECEPTOR PRECURSOR-Most

  15. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26250902 >2tpsA 22 224 5 224 1e-09 ... ref|NP_756942.1| D-allulose-6-pho...sphate 3-epimerase [Escherichia coli CFT073] ... gb|AAN83516.1| D-allulose-6-phosphate 3-epimerase ...

  16. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966596 >1c8kA 12 814 20 819 0.0 ... emb|CAC47422.1| PROBABLE GLYCOGEN ...PHOSPHORYLASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386949.1| PROBABLE GLYCOGEN PHOSPHORYLASE P

  17. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548463 >1rzuB 1 478 3 482 1e-72 ... ref|NP_521803.1| PROBABLE GLYCOGEN... SYNTHASE PROTEIN [Ralstonia solanacearum GMI1000] ... emb|CAD17393.1| PROBABLE GLYCOGEN SYNTHASE PRO

  18. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17548459 >1g5aA 110 625 187 666 2e-15 ... ref|NP_521799.1| PROBABLE GLYCOGEN... OPERON PROTEIN GLGX [Ralstonia solanacearum ... GMI1000] emb|CAD17389.1| PROBABLE GLYCOGEN OPERO

  19. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792524 >1c8kA 43 797 82 763 e-107 ... ref|NP_855017.1| PROBABLE GLYCOGEN... PHOSPHORYLASE GLGP [Mycobacterium bovis ... AF2122/97] emb|CAD94224.1| PROBABLE GLYCOGEN ...

  20. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15966599 >1rzuB 1 478 1 479 e-145 ... emb|CAC47425.1| PROBABLE GLYCOGEN ...SYNTHASE (STARCH [BACTERIAL GLYCOGEN] SYNTHASE) ... PROTEIN [Sinorhizobium meliloti] ref|NP_386952.1| ... PROBABLE GLYC...OGEN SYNTHASE (STARCH [BACTERIAL GLYCOGEN] ... SYNTHASE) PROTEIN [Sinorhizob

  1. ORF Alignment: NC_003450 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003450 gi|19552527 >1c8kA 22 818 15 790 0.0 ... ref|YP_225593.1| PUTATIVE GLYCOGEN... ... [Corynebacterium glutamicum ATCC 13032] emb|CAF20007.1| ... PUTATIVE GLYCOGEN PHOSPHORYLASE [C

  2. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840783 >1c8kA 43 797 82 763 e-107 ... ref|NP_215844.1| PROBABLE GLYCOGEN...ase - ... Mycobacterium tuberculosis (strain H37RV) ... emb|CAA98092.1| PROBABLE GLYCOGEN PHOS

  3. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608468 >1c8kA 43 797 82 763 e-107 ... ref|NP_215844.1| PROBABLE GLYCOGEN...ase - ... Mycobacterium tuberculosis (strain H37RV) ... emb|CAA98092.1| PROBABLE GLYCOGEN PHOS

  4. ORF Alignment: NC_005823 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005823 gi|45656251 >1v04A 13 339 27 348 2e-65 ... ref|YP_000337.1| paraoxonase [Le...ptospira interrogans serovar Copenhageni str. ... Fiocruz L1-130] gb|AAS68974.1| paraoxonase [Leptosp

  5. ORF Alignment: NC_004342 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004342 gi|24213099 >1v04A 13 339 27 348 5e-66 ... ref|NP_710580.1| paraoxonase 3-l...ike protein [Leptospira interrogans serovar Lai str. ... 56601] gb|AAN47598.1| paraoxonase 3-like pro

  6. ORF Alignment: NC_003283 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003283 gi|17561408 >1bor0 2 53 282 342 3e-04 ... ref|NP_757385.1| synoviolin 1 iso...form b [Homo sapiens] gb|AAH30530.1| Synoviolin 1, ... isoform b [Homo sapiens] ... Length = 61

  7. ORF Alignment: NC_000117 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000117 gi|15605324 >1jgmA 39 326 7 260 4e-33 ... ref|NP_220110.1| PHP superfamily hydrolase [Chlamydia trachomatis D/UW-3/CX] ... gb|AAC68196.1| PHP... ... trachomatis D/UW-3/CX] pir||G71494 probable php ... hydrolase - Chlamydia trachomatis (sero

  8. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180303 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  9. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1tx4A 1 170 679 853 1e-24 ... gb|AAN38752.1| axon identity spe...form b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  10. ORF Alignment: NC_003280 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003280 gi|25149956 >1qauA 5 99 56 151 2e-04 ... gb|AAN38752.1| axon identity speci...rm b ... [Caenorhabditis elegans] ref|NP_495592.2| SYnapse ... Defective SYD-1, axon identity

  11. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34495619 >1t06A 1 193 1 205 2e-24 ... gb|AAQ57843.1| DNA alkylation repa...ir enzyme [Chromobacterium violaceum ATCC 12472] ... ref|NP_899834.1| DNA alkylation repair enzyme ...

  12. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23466169 >1u94A 19 326 67 387 5e-28 ... ref|NP_696772.1| alkylation dama...ge repair protein [Bifidobacterium longum NCC2705] ... gb|AAN25408.1| alkylation damage repair protei

  13. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955643 >1u94A 24 325 68 337 3e-32 ... ref|YP_062931.1| alkylation dama...ge DNA repair protein [Leifsonia xyli subsp. xyli ... str. CTCB07] gb|AAT89826.1| alkylation damage D

  14. ORF Alignment: NC_005027 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005027 gi|32477023 >1t06A 1 191 9 220 1e-24 ... ref|NP_870017.1| probable DNA alkylation... repair enzyme [Rhodopirellula baltica SH 1] ... emb|CAD79170.1| probable DNA alkylation repair

  15. ORF Alignment: NC_004350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004350 gi|24378587 >1t06A 1 191 11 210 3e-32 ... gb|AAN57848.1| DNA alkylation rep...air enzyme [Streptococcus mutans UA159] ... ref|NP_720542.1| DNA alkylation repair enzyme ...

  16. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006576 gi|56751418 >1kgsA 3 222 4 231 2e-39 ... ref|YP_172119.1| two-component response regulator for energ... ... PCC 6301] dbj|BAD79599.1| two-component response ... regulator for energy transfer from ph

  17. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39997794 >1atg0 2 225 27 256 3e-20 ... ref|NP_953745.1| tungstate ABC tr...ansporter, periplasmic tungstate-binding protein, ... putative [Geobacter sulfurreducens PCA] gb|AAR36072.1| ... tung...state ABC transporter, periplasmic tungstate-binding ... protein, putative [Ge

  18. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n with ... localized conservation [Sinorhizobium meliloti 1021] ... pir||B95312 hypothetical p...rvation [Sinorhizobium ... meliloti 1021] gb|AAK65060.1| hypothetical protei... NC_003037 gi|16262858 >1i0rB 4 152 13 156 2e-27 ... ref|NP_435648.1| hypothetical protein with localized conse

  19. ORF Alignment: NC_003037 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n with ... localized conservation [Sinorhizobium meliloti 1021] ... pir||B95312 hypothetical p...rvation [Sinorhizobium ... meliloti 1021] gb|AAK65060.1| hypothetical protei... NC_003037 gi|16262855 >1i0rB 4 152 13 156 2e-27 ... ref|NP_435648.1| hypothetical protein with localized conse

  20. ORF Sequence: NC_001146 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during aerobic growth while its isoform Vb (Cox5Bp) is expressed during anaerobic growth; Cox5ap ... NC_001146 gi|6324276 >gi|6324276|ref|NP_014346.1| Subunit Va of cytochrome c oxidase, which is the term

  1. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inal member of the mitochondrial inner membrane electron transport chain; predominantly express...ed during anaerobic growth while its isoform Va (Cox5Ap) is expressed during aerobic growth; Cox5bp ... NC_001141 gi|6322080 >gi|6322080|ref|NP_012155.1| Subunit Vb of cytochrome c oxidase, which is the term

  2. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669589 >1vhtA 3 200 2 186 2e-14 ... ref|NP_248402.1| alignment in /usr/local/projects...408.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R584_orf2.nr ... [Me

  3. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45359158 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  4. ORF Alignment: NC_000909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000909 gi|15669211 >1q7hA 13 141 446 567 8e-09 ... ref|NP_248016.1| alignment in /usr/local/projects...B99026.1| ... alignment in ... /usr/local/projects/ARG/Intergenic/ARG_R428_orf1.nr ...

  5. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  6. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

  7. ORF Alignment: NC_002929 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002929 gi|33592330 >1uynX 1 299 352 647 5e-40 ... ref|NP_879974.1| tracheal colonization... factor precursor [Bordetella pertussis Tohama ... I] emb|CAA08832.2| tracheal colonization fac...tor ... [Bordetella pertussis] emb|CAE41497.1| tracheal ... colonization factor precursor [Bor

  8. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30021261 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  9. ORF Alignment: NC_007530 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_007530 gi|47528487 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  10. ORF Alignment: NC_004722 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004722 gi|30022695 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  11. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42782260 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  12. ORF Alignment: NC_003997 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003997 gi|30263128 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  13. ORF Alignment: NC_003909 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003909 gi|42781970 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  14. ORF Alignment: NC_003995 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003995 gi|21401081 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  15. ORF Alignment: NC_005957 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005957 gi|49479519 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  16. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142345 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  17. ORF Alignment: NC_005945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005945 gi|49185975 >1y9wA 2 118 130 246 1e-04 ... ref|NP_834326.1| Zwittermicin A ...resistance protein zmaR [Bacillus cereus ATCC 14579] ... gb|AAP11527.1| Zwittermicin A resistance pro

  18. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29831905 >1bt3A 46 334 1 287 4e-31 ... dbj|BAC73074.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69182.1| putative tyrosinase [Streptomyces ... ... ... avermitilis] ref|NP_826539.1| putative tyrosinase ... [Streptomyces avermitilis MA-4680] ...

  19. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29827678 >1bt3A 46 336 1 274 3e-43 ... dbj|BAC68847.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69175.1| tyrosinase [Streptomyces avermitilis] ... ... ... ref|NP_822312.1| putative tyrosinase [Streptomyces ... avermitilis MA-4680] ... Length =

  20. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696289 >1bt3A 48 336 4 309 2e-36 ... gb|AAV94692.1| tyrosinase domain ...protein [Silicibacter pomeroyi DSS-3] ... ref|YP_166646.1| tyrosinase domain protein [Silicibacter ...

  1. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21221155 >1bt3A 46 334 1 287 4e-31 ... dbj|BAC73074.1| putative tyrosinase... [Streptomyces avermitilis MA-4680] ... dbj|BAB69182.1| putative tyrosinase [Streptomyces ... ... ... avermitilis] ref|NP_826539.1| putative tyrosinase ... [Streptomyces avermitilis MA-4680] ...

  2. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

  3. ORF Alignment: NC_003282 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003282 gi|17540144 >1n0rA 2 124 89 212 5e-26 ... gb|AAA96093.1| Feminization of xx and xo animals... ... homolog a, FEMinization of XX and XO animals FEM-1 ... (fem-1) [Caenorhabditis elegans] pir||

  4. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25027294 >1on3E 2 519 12 542 e-148 ... ref|NP_737348.1| detergent sensit...ivity rescuer DtsR [Corynebacterium efficiens ... YS-314] dbj|BAC17548.1| detergent sensitivity rescu

  5. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004369 gi|25027293 >1on3E 8 519 12 536 e-154 ... ref|NP_737347.1| detergent sensit...ivity rescuer DtsR homolog [Corynebacterium ... efficiens YS-314] dbj|BAC17547.1| detergent sensitivi

  6. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45443303 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LNECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  7. ORF Alignment: NC_006155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006155 gi|51597427 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LSECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  8. ORF Alignment: NC_004556 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004556 gi|28198631 >1agjA 29 228 1 200 3e-25 ... pir||A56338 venom proteinase (EC 3.4.21.-) - Americ...an common bumblebee ... Length = 200 ... Query: 609 WLDVLTLSVLRQGKESPEWQ-------EHEALTERIC

  9. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16121178 >1v74B 1 87 1 87 6e-27 ... emb|CAA71434.1| Colicin D-157 immunity protein [Escheric...LNECLSSIFCLADLYN 61 ... + ++++AK F+ ... +++A ... F+ ... E ... +ER + ... +KD + ... + ... C ... +F ... A+ + ... Sbjct: 4 ... MAMIDLAKLFLASKITAIEFS----ERICVERRRLYGVKDLSPNILNCGEELFMAAERFE 59 ...

  10. ORF Alignment: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|6321679 >3pfk0 2 307 206 549 2e-83 ... ref|NP_011756.1| Alpha subunit of heterooctameric...EGLLRGGKYLKKMAWEDVRG 60 ... Query: 326 VDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERIC...EMVDYIDAT 385 ... VDELVAEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDAT Sbjct: 121 VDELV...AEGRFTKEEVAPYKNLSIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDAT 180 ... Query: 446 RRNNTIIVAEGALDDQLNPVTANDVKDALIELGLDT

  11. ORF Sequence: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180869 >gi|62180869|ref|YP_217286.1| putative DegT/DnrJ/EryC1/StrS family [Salmonella enteri...ca subsp. enterica serovar Choleraesuis str. SC-B67] MSDFLPFSRPAMGAEELAAVKTVLDSGWIT...SGGRAPQAEVLAPGYKYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAMADLPFQPLSLPSWEHIHAWHLFIIRVDEARCGITRDALMASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNSERICSLPLFPDMTESDFDRVITALHQIAGQ

  12. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003366 gi|18309122 >1qhhB 31 259 333 567 1e-16 ... gb|AAQ19135.1| putative UvrD/REP helicase [Escheric...NNGSLEFITGDFSEITNKILELKNQG--YENK--------DILILAATERICK 485 ... + ... L ... G ... E ... + ... ++ ... E + ... E +

  13. ORF Alignment: NC_003923 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003923 gi|21283614 >2sak0 1 121 43 163 1e-41 ... dbj|BAB95750.1| STAPHYLOKINASE PRECURSOR [Stap...hylococcus aureus subsp. aureus MW2] ... ref|NP_646702.1| STAPHYLOKINASE PRECURSOR ... [Stap...hylococcus aureus subsp. aureus MW2] ... sp|Q8NVR2|SAK_STAAW Staphylokinase precursor ...

  14. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483221 >1pwgA 4 329 74 373 1e-38 ... ref|YP_040445.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG40034.1| autolysis

  15. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

  16. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26247437 >1j9iA 1 68 1 68 7e-21 ... ref|NP_753477.1| Prophage Qin DNA packaging... protein NU1 homolog [Escherichia coli ... CFT073] gb|AAN80037.1| Prophage Qin DNA packaging ... ...teriophage ... 21] pir||A49849 DNA-packaging protein Nu1 - phage 21 ...

  17. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62179784 >1j9iA 1 68 1 68 5e-21 ... ref|YP_216201.1| Gifsy-1 prophage DNA packaging... ... gb|AAX65120.1| Gifsy-1 prophage DNA packaging protein ... [Phage Gifsy-1] ... Length = 68 ... Q

  18. ORF Alignment: NC_005363 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005363 gi|42524871 >1tjlA 27 144 16 133 6e-10 ... ref|NP_970251.1| dnaK deletion s...uppressor protein [Bdellovibrio bacteriovorus HD100] ... emb|CAE78310.1| dnaK deletion suppressor pro

  19. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro

  20. ORF Alignment: NC_003317 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_003317 gi|17988031 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  1. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... regulator, internal deletion [Caulobacter crescentus ... CB15] pir||A87693 transcription regulato... NC_002696 gi|16127809 >1etoB 1 97 211 307 4e-07 ... ref|NP_422373.1| transcriptional regulator, internal delet...r, internal ... deletion [imported] - Caulobacter crescentus ... Len...ion [Caulobacter ... crescentus CB15] gb|AAK25541.1| transcriptional ...

  2. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1mgtA 4 167 79 239 2e-25 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletio...n [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  3. ORF Alignment: NC_002696 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002696 gi|16124962 >1adn0 1 76 1 75 1e-17 ... ref|NP_419526.1| ada regulatory protein, internal deletion... [Caulobacter crescentus ... CB15] gb|AAK22694.1| ada regulatory protein, internal ... deletion... [Caulobacter crescentus CB15] pir||B87337 ada ... regulatory protein, internal deletion

  4. ORF Alignment: NC_002689 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002689 gi|13541621 >1e1hD 9 166 248 399 1e-33 ... emb|CAA43999.1| botulinum neurotoxin... type E [Clostridium botulinum] ... sp|Q00496|BXE_CLOBO Botulinum neurotoxin type E ... pr

  5. ORF Alignment: NC_003070 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003070 gi|18407028 >1n1bB 40 536 280 782 5e-81 ... gb|AAL24105.1| putative S-linalool... ... [Arabidopsis thaliana] gb|AAN71959.1| putative ... S-linalool synthase [Arabidopsis thaliana

  6. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084737 >1jfbA 14 398 24 409 2e-72 ... ref|YP_046247.1| linalool 8-mono...oxygenase (Cytochrome P450 111) (Cytochrome P450lin) ... [Acinetobacter sp. ADP1] emb|CAG68425.1| linalool

  7. Stepping Motor - Hydraulic Motor Servo Drives for an NC Milling ...

    African Journals Online (AJOL)

    In this paper the retrofit design of the control system of an NC milling machine with a stepping motor and stepping motor - actuated hydraulic motor servo mechanism on the machines X-axis is described. The servo designed in the course of this study was tested practically and shown to be linear - the velocity following errors ...

  8. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002936 gi|57234191 >1e0gA 2 45 443 490 1e-04 ... ref|YP_181785.1| endolysin, putat...ive [Dehalococcoides ethenogenes 195] ... gb|AAW39696.1| endolysin, putative [Dehalococcoides ...

  9. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|18398317 >1e0gA 4 45 339 382 4e-05 ... ref|NP_814147.1| endolysin, putat...ive [Enterococcus faecalis V583] gb|AAO80218.1| ... endolysin, putative [Enterococcus faecalis V583

  10. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15801268 >1xjuA 9 154 30 175 1e-24 ... gb|AAG55897.1| putative endolysin... of prophage CP-933N [Escherichia coli O157:H7 ... EDL933] pir||E85679 probable endolysin of prophage..._287285.1| putative ... endolysin of prophage CP-933N [Escherichia coli O1

  11. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29376513 >1e0gA 4 45 319 362 2e-04 ... ref|NP_815667.1| endolysin [Enter...ococcus faecalis V583] gb|AAO81737.1| endolysin ... [Enterococcus faecalis V583] ... Length = 4

  12. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29374994 >1e0gA 4 45 339 382 4e-05 ... ref|NP_814147.1| endolysin, putat...ive [Enterococcus faecalis V583] gb|AAO80218.1| ... endolysin, putative [Enterococcus faecalis V583

  13. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15834216 >1swyA 6 155 29 161 2e-20 ... dbj|BAB38385.1| putative endolysin... [Escherichia coli O157:H7] ref|NP_312989.1| ... putative endolysin [Escherichia coli O157:H7] ... ... ... pir||B91249 probable endolysin [imported] - Escherichia ... coli (strain O157:H7, substrain RIM

  14. ORF Alignment: NC_004668 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004668 gi|29377273 >1e0gA 3 45 338 382 3e-05 ... ref|NP_816427.1| endolysin [Enter...ococcus faecalis V583] gb|AAO82497.1| endolysin ... [Enterococcus faecalis V583] ... Length = 4

  15. ORF Sequence: NC_001145 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ions in rot1 cause cell wall defects, suppress tor2 mutations, and are synthetically lethal with rot2 mutati... NC_001145 gi|6323856 >gi|6323856|ref|NP_013927.1| Protein that may be involved in cell wall function; mutat...ons; Rot1p [Saccharomyces cerevisiae] MWSKKFTLKKLILGGYLFAQKVYCEDESNSIYGTWSSKSNQVFTG

  16. ORF Alignment: NC_001142 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001142 gi|6322362 >1na3A 1 86 6 91 2e-23 ... pdb|1NA0|B Chain B, Design Of Stable ...Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  17. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996556 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ... A

  18. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829492 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  19. ORF Alignment: NC_006156 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006156 gi|51598497 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  20. ORF Alignment: NC_006833 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006833 gi|58584782 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ... A

  1. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085213 >1na0A 1 119 7 125 3e-30 ... pdb|1NA0|B Chain B, Design Of Stab...le Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  2. ORF Alignment: NC_000919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000919 gi|15639412 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  3. ORF Alignment: NC_001318 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001318 gi|15594581 >1na3A 1 86 6 91 6e-23 ... pdb|1NA3|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA3|A Chain A, Design Of Stable ...

  4. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15799918 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  5. ORF Alignment: NC_004431 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004431 gi|26249530 >1hxiA 10 111 3 104 8e-17 ... pdb|1NA0|B Chain B, Design Of Sta...ble Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  6. ORF Alignment: NC_003103 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003103 gi|15892341 >1na3A 1 86 6 91 2e-23 ... pdb|1NA0|B Chain B, Design Of Stable... Alpha-Helical Arrays From An Idealized ... Tpr Motif pdb|1NA0|A Chain A, Design Of Stable ...

  7. ORF Sequence: NC_001134 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001134 gi|6319554 >gi|6319554|ref|NP_009636.1| ATPase required for the release of Sec17p during the 'pri...ming' step in homotypic vacuole fusion and for ER to Golgi transport; homolog of th

  8. ORF Alignment: NC_006055 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006055 gi|50364899 >1e0jA 7 282 163 444 6e-57 ... ref|YP_053324.1| DNA replication priming... helicase [Mesoplasma florum L1] ... gb|AAT75440.1| DNA replication priming helicase ...

  9. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004337 gi|24111904 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  10. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004741 gi|30062018 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  11. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002695 gi|15829852 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  12. ORF Alignment: NC_000913 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000913 gi|16128549 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  13. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002655 gi|15800273 >1bl0A 6 107 149 249 7e-08 ... ref|NP_415098.1| envelope protein; thermoregulation...ion of porin biosynthesis; transcriptional ... activator of envelope proteins, thermoregulation... of porin biosynthesis ... [Escherichia coli K12] gb|AAC73667.1| envelope protein; ... thermoregulat

  14. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50086621 >1nz0D 14 109 22 118 7e-12 ... ref|YP_048131.1| RNase P, protein C5 component, processes... ... protein C5 component, processes tRNA, 4.5S RNA ... [Acinetobacter sp. ADP1] sp|Q6F6K8|RNPA_ACIAD

  15. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62180380 >1vk0A 18 203 2 166 1e-28 ... ref|YP_216797.1| RNase D, processes... ... gb|AAX65716.1| RNase D, processes tRNA precursor ... [Salmonella enterica subsp. enterica serovar

  16. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50085406 >1vk0A 40 206 33 185 2e-14 ... ref|YP_046916.1| ribonuclease D, processes... tRNA [Acinetobacter sp. ADP1] ... emb|CAG69094.1| ribonuclease D, processes tRNA ...

  17. ORF Alignment: NC_006087 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006087 gi|50955146 >1rq2B 19 306 17 304 7e-96 ... ref|YP_062434.1| cell divison pr...otein [Leifsonia xyli subsp. xyli str. CTCB07] ... gb|AAT89329.1| cell divison protein [Leifsonia xyl

  18. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59713627 >1vf7E 3 251 113 339 1e-21 ... ref|YP_206402.1| copper/silver r...esistance periplasmic protein [Vibrio fischeri ... ES114] gb|AAW87514.1| copper/silver resistance ...

  19. ORF Alignment: NC_003296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003296 gi|17549147 >1ek9A 2 398 35 411 9e-11 ... ref|YP_145666.1| outer membrane silver...otein ... [Ralstonia metallidurans CH34] emb|CAI11315.1| outer ... membrane silver efflux prot

  20. ORF Alignment: NC_006841 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006841 gi|59713626 >1ek9A 1 381 30 404 2e-06 ... ref|YP_206401.1| copper/silver re...sistance outer membrane protein [Vibrio fischeri ... ES114] gb|AAW87513.1| copper/silver resistance o

  1. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006905 gi|62181104 >1fpoA 1 171 1 171 2e-41 ... ref|YP_217521.1| co-chaperone protein Hsc20, believe...ica ... serovar Choleraesuis str. SC-B67] gb|AAX66440.1| ... co-chaperone protein Hsc20, believe

  2. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084580 >1su0B 5 135 3 119 1e-30 ... ref|YP_046090.1| iron-binding protein believe... ... emb|CAG68268.1| iron-binding protein believed to be ... involved in Fe-S protein formation or repa

  3. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available sp. ... ADP1] emb|CAG68267.1| iron-binding protein , putative ... regulator believed to be invol...n , putative regulator believed to be involved ... in Fe-S protein formation or repair [Acinetobacter ... NC_005966 gi|50084579 >1r94A 3 96 2 95 8e-27 ... ref|YP_046089.1| iron-binding protei

  4. ORF Alignment: NC_005966 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005966 gi|50084578 >1fpoA 1 167 1 158 3e-23 ... ref|YP_046088.1| co-chaperone protein (Hsc20), believe... ... emb|CAG68266.1| co-chaperone protein (Hsc20), believed ... to be involved in assembly of Fe-S cl

  5. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39936538 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  6. ORF Alignment: NC_005810 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005810 gi|45441793 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  7. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39935198 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  8. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002940 gi|33151562 >1u07A 8 84 201 279 1e-08 ... gb|AAP95304.1| TobB energy transd...ucing protein [Haemophilus ducreyi 35000HP] ... ref|NP_872915.1| TobB energy transducing protein ...

  9. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  10. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004463 gi|27379019 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  11. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13471241 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris ... CGA009] ref|NP_948814.1| possible energy transducer ...

  12. ORF Alignment: NC_003143 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003143 gi|16122423 >1u07A 1 89 164 251 4e-26 ... ref|NP_669352.1| energy transduce...] ... ref|NP_993332.1| TonB protein [Yersinia pestis biovar ... Medievalis str. 91001] gb|AAM85603.1| energy

  13. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39996799 >1u07A 9 88 204 283 1e-12 ... emb|CAE27570.1| possible energy t...ransducer TonB, C-terminal region ... [Rhodopseudomonas palustris CGA009] ref|NP_947474.1| ... possible energy

  14. ORF Alignment: NC_002939 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002939 gi|39995137 >1u07A 13 88 186 259 1e-09 ... emb|CAE28917.1| possible energy ...transducer TonB [Rhodopseudomonas palustris CGA009] ... ref|NP_948814.1| possible energy transducer T

  15. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004578 gi|28871348 >1dlwA 1 114 25 138 3e-25 ... ref|NP_793967.1| protozoan/cyanob...acterial globin family protein [Pseudomonas ... syringae pv. tomato str. DC3000] gb|AAO57662.1| ... protozoa

  16. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

  17. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

  18. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53725407 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  19. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53718816 >1dlwA 1 115 25 145 1e-19 ... ref|YP_103467.1| protozoan/cyanob...acterial globin family protein [Burkholderia mallei ... ATCC 23344] gb|AAU49423.1| protozoan/cyanobac

  20. ORF Alignment: NC_002952 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002952 gi|49483165 >1dlwA 19 115 21 120 3e-19 ... ref|YP_040389.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus MRSA252] emb|CAG39975.1| ... protozoa

  1. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002976 gi|57866545 >1dlwA 19 115 47 146 6e-19 ... ref|YP_188173.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... epidermidis RP62A] gb|AAW53991.1| ... protozoa

  2. ORF Alignment: NC_002951 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002951 gi|57650195 >1dlwA 19 115 21 120 3e-19 ... ref|YP_185875.1| protozoan/cyano...bacterial globin family protein [Staphylococcus ... aureus subsp. aureus COL] gb|AAW36475.1| ... protozoa

  3. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604553 >1n0qB 4 92 10 98 2e-14 ... ref|NP_221071.1| ANKYRIN, BRAIN VAR...IANT 2 (ank2) [Rickettsia prowazekii str. ... Madrid E] emb|CAA15147.1| ANKYRIN, BRAIN VARIANT 2 ...

  4. Large-Nc quantum chromodynamics and harmonic sums

    Indian Academy of Sciences (India)

    2012-06-08

    Jun 8, 2012 ... Abstract. In the large-Nc limit of QCD, two-point functions of local operators become harmonic sums. I review some properties which follow from this fact and which are relevant for phenomeno- logical applications. This has led us to consider a class of analytic number theory functions as toy models of ...

  5. ORF Alignment: NC_003028 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003028 gi|15900440 >1jbeA 9 123 8 119 2e-18 ... pdb|1KRX|A Chain A, Solution Structure Of Beryllofluoride... ... Site Contacts pdb|1KRW|A Chain A, Solution Structure And ... Backbone Dynamics Of Beryllofluoride...rage ... Structure Of Beryllofluoride-Activated Ntrc Receiver ... Domain: Model Structure Inco

  6. ORF Alignment: NC_003098 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003098 gi|15902507 >1jbeA 9 123 8 119 2e-18 ... pdb|1KRX|A Chain A, Solution Structure Of Beryllofluoride... ... Site Contacts pdb|1KRW|A Chain A, Solution Structure And ... Backbone Dynamics Of Beryllofluoride...rage ... Structure Of Beryllofluoride-Activated Ntrc Receiver ... Domain: Model Structure Inco

  7. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604233 >1uf5A 4 265 215 450 3e-21 ... ref|NP_220749.1| APOLIPOPROTEIN N-ACYLTRANSFERASE (lnt... ... N-ACYLTRANSFERASE (lnt) [Rickettsia prowazekii] ... pir||G71693 apolipoprotein n-acyltransferase (lnt...) RP366 ... - Rickettsia prowazekii sp|Q9ZDG3|LNT_RICPR ...

  8. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31792055 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  9. ORF Alignment: NC_002945 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002945 gi|31793631 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  10. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15841974 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  11. ORF Alignment: NC_002755 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002755 gi|15840280 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  12. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15609587 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  13. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29830077 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  14. ORF Alignment: NC_000962 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000962 gi|15608007 >1xsfA 15 102 29 115 2e-23 ... ref|NP_215382.1| POSSIBLE RESUSCITATION...hypothetical protein Rv0867c - Mycobacterium ... tuberculosis (strain H37RV) emb|CAA17673.1| POSSIBLE ... RESUSCITATION

  15. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21220505 >1chkA 2 236 70 304 9e-83 ... ref|NP_626284.1| putative chitosan...ase (putative secreted protein) [Streptomyces ... coelicolor A3(2)] emb|CAB52859.1| putative chitosan...ase ... (putative secreted protein) [Streptomyces coelicolor ... A3(2)] pir||T34867 probable chitosan

  16. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

  17. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

  18. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

  19. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142820 >1kwfA 3 362 53 435 5e-85 ... ref|YP_084010.1| chitosanase; gly...cosyl hydrolases family 8; endoglucanase [Bacillus ... cereus ZK] gb|AAU17839.1| chitosanase; glycosy

  20. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005085 gi|34499386 >1qgiA 1 259 102 360 4e-95 ... gb|AAQ61593.1| probable chitosan...ase A [Chromobacterium violaceum ATCC 12472] ... ref|NP_903601.1| probable chitosanase A [Chromobacte

  1. ORF Alignment: NC_006512 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006512 gi|56460843 >1vkpA 13 372 9 346 3e-73 ... ref|YP_156124.1| Peptidyl-arginine... deiminase related enzyme [Idiomarina loihiensis ... L2TR] gb|AAV82575.1| Peptidyl-arginine deiminas

  2. ORF Alignment: NC_003912 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003912 gi|57237777 >1vkpA 13 370 6 323 3e-87 ... ref|YP_179025.1| peptidyl-arginine... deiminase family protein [Campylobacter jejuni ... RM1221] gb|AAW35360.1| peptidyl-arginine deimina

  3. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003911 gi|56697815 >1vkpA 1 369 4 337 5e-75 ... gb|AAV96218.1| porphyromonas-type peptidyl-arginine... ... porphyromonas-type peptidyl-arginine deiminase family ... protein [Silicibacter pomeroyi DSS-3] ...

  4. ORF Alignment: NC_006369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006369 gi|54295805 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  5. ORF Alignment: NC_006368 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006368 gi|54298970 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  6. ORF Alignment: NC_002942 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002942 gi|52843159 >1xvqA 17 164 3 161 4e-27 ... ref|YP_096958.1| peroxynitrite re...28220.1| ... alkyl hydroperoxide reductase [Legionella pneumophila ... str. Lens] gb|AAU29011.1| peroxynitrite...bsp. ... pneumophila str. Philadelphia 1] gb|AAM00601.1| ... peroxynitrite reductase [Legionel

  7. ORF Alignment: NC_004565 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004565 gi|28373188 >1epwA 1 1289 2 1313 0.0 ... ref|NP_783831.1| tetanus toxin tet...X [Clostridium tetani] emb|CAA28033.1| tetanus toxin ... precursor (AA 1-1315) [Clostridium tetani] ... ... emb|CAA29564.1| unnamed protein product [Clostridium ... tetani] gb|AAO37454.1| tetanus

  8. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005296 gi|39937869 >1gxeA 9 128 1 106 4e-48 ... gb|AAW68944.1| anti-tetanus toxoid... immunoglobulin light chain variable region ... [Homo sapiens] gb|AAW68902.1| anti-tetanus toxoid ...

  9. ORF Sequence: NC_001139 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001139 gi|50593217 >gi|50593217|ref|NP_011747.2| Subunit of the prohibitin complex (Phb1p-Phb2p...sized proteins; determinant of replicative life span; involved in mitochondrial segregation; Phb2p [Saccharo

  10. ORF Alignment: NC_006511 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006511 gi|56413338 >1u07A 2 90 193 281 2e-32 ... ref|YP_216720.1| energy transduce...terica ... serovar Choleraesuis str. SC-B67] gb|AAX65639.1| energy ... transducer; uptake of i

  11. 77 FR 33997 - Television Broadcasting Services; Greenville, NC

    Science.gov (United States)

    2012-06-08

    ...] Television Broadcasting Services; Greenville, NC AGENCY: Federal Communications Commission. ACTION: Proposed... freeze on the acceptance of rulemaking petitions by full power television stations requesting channel... filed by full power television stations seeking to relocate from channel 51 pursuant to a voluntary...

  12. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003413 gi|18977962 >1ktgA 3 131 38 166 2e-11 ... ref|NP_579319.1| mutt putative [P...yrococcus furiosus DSM 3638] gb|AAL81714.1| mutt ... putative [Pyrococcus furiosus DSM 3638] ...

  13. ORF Alignment: NC_005791 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005791 gi|45358156 >1wcv1 4 241 4 235 5e-21 ... ref|NP_987713.1| walker type ATPas...e [Methanococcus maripaludis S2] emb|CAF30149.1| ... walker type ATPase [Methanococcus maripaludis S2

  14. ORF Alignment: NC_006348 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006348 gi|53724326 >1g8eA 1 97 1 98 8e-23 ... ref|YP_109907.1| flagellar regulon master...|CAH37324.1| flagellar regulon master regulator ... subunit FlhD [Burkholderia pseudomallei K96243] ...

  15. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006350 gi|53720921 >1g8eA 1 97 1 98 8e-23 ... ref|YP_109907.1| flagellar regulon master...|CAH37324.1| flagellar regulon master regulator ... subunit FlhD [Burkholderia pseudomallei K96243] ...

  16. ORF Alignment: NC_001137 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ograde regulon which ... consists of genes whose expression is stimulated by... NC_001137 gi|6320764 >1wvfA 13 508 29 496 1e-67 ... ref|NP_010843.1| D-lactate dehydrogenase, part of the retr

  17. ORF Sequence: NC_001136 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001136 gi|6320230 >gi|6320230|ref|NP_010310.1| Component of the GARP (Golgi-associated retrograde... protein) complex, Vps51p-Vps52p-Vps53p-Vps54p, which is required for retrograde transport

  18. ORF Sequence: NC_001141 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_001141 gi|6322114 >gi|6322114|ref|NP_012189.1| Part of a heptameric protein complex that regulates retro...grade Golgi-to-ER protein traffic in eukaryotic cells; coatomer forms the COP I ves

  19. ORF Alignment: NC_006274 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

  20. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003071 gi|42569531 >1wd2A 1 58 290 342 7e-13 ... gb|AAD32294.1| similar to Ariadne... protein from Drosophila [Arabidopsis thaliana] ... emb|CAD52893.1| ARIADNE-like protein ARI11 [Arabi...dopsis ... thaliana] pir||A84725 similar to Ariadne protein from ... Drosophila [imported] - A

  1. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 1| ... acyl-CoA dehydrogenase, ferrulic acid biotransformation ... protein, putative [Pseudomo...ransformation protein, ... putative [Pseudomonas putida KT2440] gb|AAN68958.... NC_002947 gi|26990069 >1u8vA 9 432 4 458 7e-34 ... ref|NP_745494.1| acyl-CoA dehydrogenase, ferrulic acid biot

  2. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

  3. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925959 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  4. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923242 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  5. ORF Alignment: NC_002758 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002758 gi|15923246 >1kolA 35 389 28 338 2e-04 ... dbj|BAB56418.1| similar to xylitol... ... SA0246 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370780.1| similar to xylitol

  6. ORF Alignment: NC_006351 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006351 gi|53722258 >1kolA 2 388 1 341 4e-33 ... ref|YP_111243.1| putative zinc-binding xylitol... ... zinc-binding xylitol/sorbitol dehydrogenase ... [Burkholderia pseudomallei K96243] ... .../sorbitol dehydrogenase [Burkholderia ... pseudomallei K96243] emb|CAH38702.1| putative ...

  7. ORF Alignment: NC_002745 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002745 gi|15925955 >1n8kA 34 374 26 339 4e-06 ... dbj|BAB56414.1| similar to xylitol... ... SA0242 [Staphylococcus aureus subsp. aureus N315] ... ref|NP_370776.1| similar to xylitol

  8. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003155 gi|29828632 >1w1oA 22 489 11 408 6e-19 ... dbj|BAC69801.1| putative xylitol... oxidase [Streptomyces avermitilis MA-4680] ... ref|NP_823266.1| putative xylitol oxidase [Streptomyc

  9. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

  10. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13474107 >1n8kA 9 365 1 332 2e-32 ... ref|NP_105675.1| xylitol (sorbitol...e ... (Xylitol dehydrogenase) (XDH) dbj|BAB51461.1| xylitol ... (sorbitol) dehydrogenase [Meso

  11. ORF Alignment: NC_000963 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000963 gi|15604602 >1mwmA 4 314 14 327 1e-47 ... ref|NP_221120.1| ROD SHAPE-DETERMINING... PROTEIN MREB (mreB) [Rickettsia prowazekii ... str. Madrid E] emb|CAA15196.1| ROD SHAPE-DETERMINING

  12. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557359 >1mwmA 3 314 11 322 5e-28 ... ref|NP_907174.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN (FRAGMENT) [Wolinella ... succinogenes DSM 1740] emb|CAE10074.1| PUTATIVE ROD ... SHAPE-DETERMIN...ING PROTEIN (FRAGMENT) [Wolinella ... succinogenes] ... Length = 312 ...

  13. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34556511 >1mwmA 3 314 14 327 1e-46 ... ref|NP_906326.1| PUTATIVE ROD SHAPE-DETERMINING... PROTEIN [Wolinella succinogenes DSM ... 1740] emb|CAE09226.1| PUTATIVE ROD SHAPE-DETERMINING

  14. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15612352 >1mwmA 3 314 14 329 4e-45 ... ref|NP_224005.1| ROD SHAPE-DETERMINING... PROTEIN [Helicobacter pylori J99] ... gb|AAD06861.1| ROD SHAPE-DETERMINING PROTEIN ... [

  15. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17544778 >1mwmA 4 314 14 329 3e-49 ... emb|CAD13587.1| PROBABLE ROD SHAPE-DETERMINING... PROTEIN [Ralstonia solanacearum] ... ref|NP_518180.1| PROBABLE ROD SHAPE-DETERMINING PR

  16. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17548082 >1wcv1 2 241 2 249 7e-27 ... emb|CAD16862.1| PROBABLE SEPTUM SITE-DETERMINING... PROTEIN MIND [Ralstonia ... solanacearum] ref|NP_521484.1| PROBABLE SEPTUM ... SITE-DETERMINING

  17. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_000921 gi|15611661 >1vdkA 1 460 2 461 e-141 ... ref|NP_223312.1| ASPARTATE AMMONIA...-LYASE [Helicobacter pylori J99] gb|AAD06167.1| ... ASPARTATE AMMONIA-LYASE [Helicobacter pylori J99

  18. ORF Alignment: NC_003295 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003295 gi|17547375 >1v4aA 29 433 25 452 2e-95 ... emb|CAD16363.1| PROBABLE GLUTAMATE-AMMONIA... ... [Ralstonia solanacearum] ref|NP_520777.1| PROBABLE ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERAS

  19. ORF Alignment: NC_003047 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003047 gi|15964777 >1v4aA 24 435 49 467 e-101 ... emb|CAC45596.1| PUTATIVE GLUTAMATE-AMMONIA...-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti] ref|NP_385130.1| PUTATIVE ... GLUTAMATE-AMMO...NIA-LIGASE ADENYLYLTRANSFERASE PROTEIN ... [Sinorhizobium meliloti 1021] sp|

  20. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...