WorldWideScience

Sample records for ssy annual shipping

  1. SSI's International Development Co-operation (SIUS). Annual report 1998

    International Nuclear Information System (INIS)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  2. SSI`s International Development Co-operation (SIUS). Annual report 1998

    Energy Technology Data Exchange (ETDEWEB)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  3. Fiscal 1978 annual report of Japan Nuclear Ship Development Agency

    International Nuclear Information System (INIS)

    1979-01-01

    In October, 1978, the nuclear ship Mutsu was moved to Sasebo Port from Ominato Port for shield repair and comprehensive safety check-up and repair; and this was a long-standing problem for the ship. In face of a new energy age, Japan Nuclear Ship Development Agency is endeavoring to bring up the nuclear ship technology in Japan to the top level in the world by successfully completing the n.s. Mutsu through perfect safety and reliability. For Japan, which is a leading country of shipbuilding and merchant shipping, the development of nuclear ships is extremely important. On the activities of the agency from April, 1978, to March, 1979, the following matters are described: safety check and shielding repair of the n.s. Mutsu; Maintenance of the n.s. Mutsu at Ominato and Sasebo ports and its sailing to Sasebo port; works at Sasebo port before and after the arrival of the n.s. Mutsu; maintenance works of the Mutsu facilities at Ominato port; governmental formalities for permission and approval; training of ship crew; administrative works. (J.P.N.)

  4. Annual report of Japan Nuclear Ship Development Agency

    International Nuclear Information System (INIS)

    1978-01-01

    Works performed in fiscal 1977 concerning the nuclear ship 'Mutsu' are reported: safety inspection and shielding repair of the Mutsu; maintenance of the Mutsu and its port facilities; permissions by law; P.R. etc. on its prospective repair port; ship crew training; and, organization etc. Safety inspection of the Mutsu was carried out on its both hardware and software. For repair, a final basic design was started. Without ship operation, the Mutsu's hull, reactor plant, etc. and port facilities were subjected to maintenance works. P.R. works on its repair port concentrated on understanding of the local people. (Mori, K.)

  5. Annual report of Japan Nuclear Ship Development Agency, 1980

    International Nuclear Information System (INIS)

    1981-01-01

    Japan Nuclear Ship Development Agency executed the works centering around the repair of shielding and the general inspection on safety of the nuclear-Ship Mutsu in the fiscal year 1980. On the other hand, the law revising the law concerning Japan Nuclear Ship Development Agency was enforced, and the Agency was entitled to carry out the research and investigation required for the development of new nuclear ships. As for the repair of reactor shielding, the alteration of the reactor installation was permitted in November, 1979, and the design and the method of construction were approved in August, 1980. The preparatory works were carried out from April to August, 1980, prior to the main works. The repair works were started in August, and the new shields have been manufactured, while the existing shields and the equipments in the containment vessel were removed. The completed new shields have been installed successively in the containment vessel. It was confirmed that there is no problem in the safety of the nuclear ship Mutsu, as the result of the general inspection on safety completed in June, 1980. Maintenance works were carried out for the Mutsu and the normally berthing port. The periodic measurement of radiation dose rate, the selection of the new normally berthing port, the research and development of nuclear ships and others are also reported. (Kako, I.)

  6. Annual report of the Japan Nuclear Ship Development Agency, 1979

    International Nuclear Information System (INIS)

    1980-01-01

    The pending repair work of the shielding of the nuclear ship ''Mutsu'' was started at long last, and the development of nuclear ships in Japan is to be accelerated again. The Agency intends to exert more efforts to execute the repair of shielding and the works of the general inspection on safety for ''Mutsu'' rapidly and surely and to attain the expected objective. The energy situation in the world is still in confusion, and all countries, advanced and developing alike, are carrying out the researches to develop and utilize substitute energy. Especially large expectation is entertained in atomic energy which can fill the energy gap for the time being, and the policy to promote positively the improvement of safety and the development of the application to new fields is being taken. In such situation, the Atomic Energy Commission clarified the policy to positively promote the research and development on nuclear ships including the design of new nuclear reactors considering their necessity to relax the restriction of energy supply. As for the ''Mutsu'', the AEC insists that the repair should be completed and the operation test must be executed urgently. Concerning the organization for the research and development, the Agency is to undertake the solution of the pending problems related to the ''Mutsu'', and also is required to have the functions of the research and development aiming at the improvement of the economy and reliability of nuclear ships. In this report, the works of the Agency carried out in 1979 are described. (Kako, I.)

  7. Shipping

    NARCIS (Netherlands)

    Wijnolst, N.; Wergeland, T.

    1996-01-01

    Shipping is a multi-faceted industry which is rather complex to define from an academic point of view. This book attempts to grasp these complexities and provide the reader with an overview of the main topics and terminology in shipping. The book is based on material from our courses in shipping at

  8. Shipping

    OpenAIRE

    Wijnolst, N.; Wergeland, T.

    1996-01-01

    Shipping is a multi-faceted industry which is rather complex to define from an academic point of view. This book attempts to grasp these complexities and provide the reader with an overview of the main topics and terminology in shipping. The book is based on material from our courses in shipping at the universities in Delft and Bergen. As with our lectures, we draw upon quite a va ried material, from research studies at a high academic level to lower level student work and purely descriptive ...

  9. Documentation for first annual testing and inspections of Benificial Uses Shipping System (BUSS) Cask

    International Nuclear Information System (INIS)

    Lundeen, J.E.

    1994-01-01

    The purpose of this report is to compile date generated during the first annual tests and inspections of the Benificiai Uses Shipping System (BUSS) Cask. In addition, this report will verify that the testing criteria identified in chapter 8 of the BUSS Cask Safety Analysis Report for Packaging (SARP) was met. Section 8.2 ''Maintenance and Periodic Inspection Program'' of the BUSS Cask SARP requires that the following tests and inspections be performed on an annual basis: Hydrostatic pressure test; helium leak test; dye penetrant test on the trunnions and lifting lugs; and torque test on all bolts; impact limiter inspection and weight test. The first annual inspections and testing of the BUSS Cask were completed on May 5, 1994, and met the SARP criteria

  10. Ship-source oil pollution fund : annual report 1997-1998

    International Nuclear Information System (INIS)

    1998-01-01

    The Ship-source Oil Pollution Fund (SOPF) receives reports of oil pollution caused by ships in Canadian waters. The reports come from a variety of sources, including individuals who wish to be advised whether they are entitled for consideration under the Canada Shipping Act as potential claimants as a result of oil pollution damage and expenses they have suffered. The SOPF fully investigates all such reports and inquiries. A summary of each investigation that fall within the SOPF purview is provided in this report. This recitation includes a number of references to incidents dating as far back as the 1970s, providing for each incident the name of the ship, a summary of the incident, the damage caused, and the claims received and paid out by the fund. The balance of the SOPF on March 31, 1998 was just over $268 million. As of April 1, 1998 the maximum liability of the SOPF is about $128 million for all claims in respect of any one oil spill. The amount of liability is indexed annually to the consumer price index. 1 fig., 1 tab

  11. Ship

    OpenAIRE

    Keuning, J.A.

    2008-01-01

    The invention concerns a ship designed for use at high speed and heavy seas having a single long and slender hull with a narrow beam and a more or less vertical bow, whereby the front half of the hull has more or less vertical sides, minimal flare in the bow sections and towards the bow an increase in draught at its center line combined with a more or less similar increase of freeboard and whereby the aft end of the hull has a flat or slightly V-shaped bottom with one or more propellers and/o...

  12. The TANF/SSI connection.

    Science.gov (United States)

    Wamhoff, Steve; Wiseman, Michael

    Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults

  13. SSI and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  14. 49 CFR 15.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...

  15. Annual report of the Japan Nuclear Ship Research and Development Agency, for fiscal 1981

    International Nuclear Information System (INIS)

    1982-01-01

    All the works of shielding repair and safety general inspection for the nuclear ship ''Mutsu'' were completed. For advancing the research and development of nucear ships, of course, the data and experience of the behavior of marine nuclear reactors are required, which can be obtained only by operating nuclear ships. The Agency will carry out the experimental voyage after the prescribed tests are finished, and endeavor to attain the objective. A new development was observed on the new home port for the Mutsu. In May, 1981, the agreement was reached among those concerned to decide Sekine Beach, Mutsu City, as the candidate site after the survey and coordination, and to construct the home port as early as possible. The Agency carried out the survey required for the location, and reported in March, 1982, that the construction of the home port is technically feasible, and also the concept of the home port and the incidental facilities on land was informed to Aomori Prefecture. Hereafter, the compensation for fishery and the purchase of land will be actively promoted. In order to ease the restriction on the energy supply for shipping industry, the technical basis for the practical use of nuclear ships must be urgently consolidated. In this report, the works performed by the Agency in fiscal 1981 are described. (Kako, I.)

  16. Ship-Source Oil Pollution Fund annual report, 1991-1992

    International Nuclear Information System (INIS)

    1992-01-01

    The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1991 and ending 31 March 1992. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, United States legislation, the Haven incident, and the status of the fund. Twenty-three oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 4 figs., 1 tab

  17. Ship-Source Oil Pollution Fund annual report, 1992-1993

    International Nuclear Information System (INIS)

    1993-01-01

    The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1992 and ending 31 March 1993. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, major international incidents, the International Conference on the Revision of the 1969 Civil Liability Convention and the 1971 Fund Convention, the 1993 Oil Spill Conference, and the status of the fund. Twenty-nine oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 3 figs

  18. Second Annual Maintenance, Inspection, and Test Report for PAS-1 Cask Certification for Shipping Payload B

    International Nuclear Information System (INIS)

    KELLY, D.J.

    2000-01-01

    The Nuclear Packaging, Inc. (NuPac), PAS-1 cask is required to undergo annual maintenance and inspections to retain certification in accordance with U.S. Department of Energy (DOE) Certificate of Compliance USA/9184B(U) (Appendix A). The packaging configuration being tested and maintained is the NuPac PAS-1 cask for Payload B. The intent of the maintenance and inspections is to ensure the packaging remains in unimpaired physical condition. Two casks, serial numbers 2162-026 and 2162-027, were maintained, inspected, and tested at the 306E Development, Fabrication, and Test Laboratory, located at the Hanford Site's 300 Area. Waste Management Federal Services, Inc. (WMFS), a subsidiary of GTS Duratek, was in charge of the maintenance and testing. Cogema Engineering Corporation (Cogema) directed the operations in the test facility. The maintenance, testing, and inspections were conducted successfully with both PAS-1 casks. The work conducted on the overpacks included weighing, gasket replacement, and plastic pipe plug and foam inspections. The work conducted on the secondary containment vessel (SCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, and a helium leak test. The work conducted on the primary containment vessel (PCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, dimensional inspection of the vessel bottom, a helium leak test, and dye penetrant inspection of the welds. The vermiculite material used in the cask rack assembly was replaced

  19. Inter-annual trend of the primary contribution of ship emissions to PM2.5 concentrations in Venice (Italy): Efficiency of emissions mitigation strategies

    Science.gov (United States)

    Contini, Daniele; Gambaro, Andrea; Donateo, Antonio; Cescon, Paolo; Cesari, Daniela; Merico, Eva; Belosi, Franco; Citron, Marta

    2015-02-01

    Ships and harbour emissions are currently increasing, due to the increase of tourism and trade, with potential impact on global air pollution and climate. At local scale, in-port ship emissions influence air quality in coastal areas impacting on health of coastal communities. International legislations to reduce ship emissions, both at Worldwide and European levels, are mainly based on the use of low-sulphur content fuel. In this work an analysis of the inter-annual trends of primary contribution, ε, of tourist shipping to the atmospheric PM2.5 concentrations in the urban area of Venice has been performed. Measurements have been taken in the summer periods of 2007, 2009 and 2012. Results show a decrease of ε from 7% (±1%) in 2007 to 5% (±1%) in 2009 and to 3.5% (±1%) in 2012. The meteorological and micrometeorological conditions of the campaigns were similar. Tourist ship traffic during measurement campaigns increased, in terms of gross tonnage, of about 25.4% from 2007 to 2009 and of 17.6% from 2009 to 2012. The decrease of ε was associated to the effect of a voluntary agreement (Venice Blue Flag) for the use of low-sulphur content fuel enforced in the area between 2007 and 2009 and to the implementation of the 2005/33/CE Directive in 2010. Results show that the use of low-sulphur fuel could effectively reduce the impact of shipping to atmospheric primary particles at local scale. Further, voluntary agreement could also be effective in reducing the impact of shipping on local air quality in coastal areas.

  20. 49 CFR 1520.13 - Marking SSI.

    Science.gov (United States)

    2010-10-01

    ... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...

  1. SSI's review of ASAR Oskarshamn 1

    International Nuclear Information System (INIS)

    Godaas, T.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  2. SSI's Review of RD and D Programme 98

    International Nuclear Information System (INIS)

    1999-06-01

    The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues

  3. Dicty_cDB: SSI473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  4. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  5. Development of a surgical site infection (SSI) surveillance system, calculation of SSI rates and specification of important factors affecting SSI in a digestive organ surgical department.

    Science.gov (United States)

    Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji

    2007-06-01

    We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.

  6. Preoperative antiseptic skin preparations and reducing SSI.

    Science.gov (United States)

    Al Maqbali, Mohammed Abdullah

    Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.

  7. SSI's review of ASAR Ringhals 2, 1994

    International Nuclear Information System (INIS)

    Hofvander, P.

    1995-11-01

    Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs

  8. 77 FR 23119 - Annual Marine Events in the Eighth Coast Guard District, Smoking the Sound; Biloxi Ship Channel...

    Science.gov (United States)

    2012-04-18

    ...The Coast Guard will enforce Special Local Regulations for the Smoking the Sound boat races in the Biloxi Ship Channel, Biloxi, MS from 8 a.m. until 6 p.m. on April 28 and April 29, 2012. This action is necessary for the safeguard of participants and spectators, including all crews, vessels, and persons on navigable waters during the Smoking the Sound boat races. During the enforcement period, entry into, transiting or anchoring in the regulated area is prohibited to all vessels not registered with the sponsor as participants or official patrol vessels, unless specifically authorized by the Captain of the Port (COTP) Mobile or the designated Coast Guard Patrol Commander.

  9. "Jazz Ruuler" toob dzhässi Rock Cafesse

    Index Scriptorium Estoniae

    2008-01-01

    Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés

  10. Dicty_cDB: SSI468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  11. Dicty_cDB: SSI527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict

  12. Dicty_cDB: SSI485 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056

  13. SSI's review of SKB's RDandD Program 2007

    International Nuclear Information System (INIS)

    Wiebert, Anders

    2008-05-01

    In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented

  14. The SSI reviews of the SKB research programs 1992

    International Nuclear Information System (INIS)

    Jensen, Mikael.

    1993-02-01

    The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs

  15. Science teachers teaching socioscientific issues (SSI): Four case studies

    Science.gov (United States)

    Lee, Hyunju

    Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they

  16. Multi-equilibrium property of metabolic networks: SSI module

    Directory of Open Access Journals (Sweden)

    Chen Luonan

    2011-06-01

    Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.

  17. Shipping Fairways

    Data.gov (United States)

    Department of Homeland Security — Various shipping zones delineate activities and regulations for marine vessel traffic. Traffic lanes define specific traffic flow, while traffic separation zones...

  18. Estimation of annual heat flux balance at the sea surface from sst (NOAA-satellite and ships drift data off southeast Brazil

    Directory of Open Access Journals (Sweden)

    Yoshimine Ikeda

    1985-01-01

    Full Text Available The objective of this work is to study the possibility of estimating the heat flux balance at the sea surface from GOSSTCOMP (Global Ocean Sea Surface Temperature Computation developed by NOAA/NESS, USA, and sea surface current data based from ships drift information obtained from Pilot Charts, published by the Diretoria de Hidrografia e Navegação (DHN, Brazilian Navy. The annual mean value of the heat flux balance at the sea surface off southeast Brazil for 1977, is estimated from data on the balance between the heat transported by the currents and that transported by eddy diffusion for each volume defined as 2º x 2º (Lat. x Long. square with a constant depth equivalent to an oceanic mixed layer, 100 m thick. Results show several oceanic areas where there are net flows of heat from atmosphere towards the sea surface. In front of Rio de Janeiro the heat flow was downward and up to 70 ly day-1 and is probably related to the upwellirug phenomenon normally occurring in that area. Another coastal area between Lat. 25ºS to 28ºS indicated an downward flow up to 50 ly day-1; and for an area south of Lat. 27ºS, Long. 040ºW - 048ºW an downward flow up to 200 ly day-1, where the transfer was probably due to the cold water of a nortward flux from the Falkland (Malvinas Current. Results also show several oceanic areas where net flows of heat (of about -100 ly day-1 were toward the atmosphere. In the oceanic areas Lat. 19ºS - 23ºS and Lat. 24ºS - 30ºS, the flows were probably due to the warm water of a southward flux of the Brazil Current. The resulting fluxes from the warm waters of the Brazil Current when compared with those from warm waters of the Gulf Stream and Kuroshio, indicate that the Gulf Stream carries about 3.3 times and the Kuroshio 1.7 times more heat than the Brazil Current. These values agree with those of data available on the heat fluxes of the above mentioned Currents calculated by different methods (Budyko, 1974.

  19. Ship Vibrations

    DEFF Research Database (Denmark)

    Sørensen, Herman

    1997-01-01

    Methods for calculating natural frequencies for ship hulls and for plates and panels.Evaluation of the risk for inconvenient vibrations on board......Methods for calculating natural frequencies for ship hulls and for plates and panels.Evaluation of the risk for inconvenient vibrations on board...

  20. Internationalisation Within Liner Shipping

    DEFF Research Database (Denmark)

    Prockl, Günter; Kinra, Aseem; Kotzab, Herbert

    2018-01-01

    , the degree of internationalisation, measured on the basis of sea-oriented operations, differs from that measured according to land-oriented front-end marketing and sales activities. The purpose of this study is to further examine the internationalisation patterns of shipping lines. An examination...... of the front-end activities and the structures of leading container-shipping companies is conducted. The sales office networks of the sector’s 20 largest companies worldwide (by twenty-foot equivalent unit capacity) are analysed as key indicators. The numbers of sales offices are measured by analysing...... the websites of the sample (20 companies), as well as annual reports and other publicly available data sources. The findings show that not all shipping companies are international, by virtue of the industry. While it is difficult to observe differences in the overall patterns of the sales networks at a macro...

  1. Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...

  2. Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...

  3. Influence of different boundary conditions on analysis of SSI

    International Nuclear Information System (INIS)

    Wang Jiachun

    2005-01-01

    In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)

  4. ssi plaat saab 30aastaseks / Gerli Romanovitsh

    Index Scriptorium Estoniae

    Romanovitš, Gerli, 1977-

    2004-01-01

    Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas

  5. 20 CFR 416.266 - Continuation of SSI status for Medicaid

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...

  6. Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor

    DEFF Research Database (Denmark)

    Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten

    2008-01-01

    The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...

  7. 20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...

  8. Test Ship

    Data.gov (United States)

    Federal Laboratory Consortium — The U. S. Navy dedicated the decommissioned Spruance Class destroyer ex-PAUL F. FOSTER (EDD 964), Test Ship, primarily for at sea demonstration of short range weapon...

  9. Fast ship

    OpenAIRE

    Keuning, J.A.

    2014-01-01

    The invention concerns a ship whereby the hull and the mechanical propulsion device are designed such that the Froude number is larger than 0.5. In the aft ship the hull has a bottom with V-shaped bottom surfaces with a deadrise angle that is less than 40 degrees and the hull has substantially vertical sides. In the hull are a passenger compartment and a trim tank. The trim tank volume is such that the weight of a filled trim tank is more than 30 % of the weight of displacement of the hull wi...

  10. A Persian-version of the stuttering severity instrument-version four (SSI-4): How the new additions to SSI-4 complement its stuttering severity score?

    Science.gov (United States)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.

  11. Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io

    Science.gov (United States)

    Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.

    2005-01-01

    Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.

  12. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI

    Directory of Open Access Journals (Sweden)

    Rohini Murlidhar Gajbhiye

    2017-02-01

    Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20

  13. Ship's barbers

    OpenAIRE

    Unknown

    2003-01-01

    Showing two sailors having their hair cut (? one is possibly being shaved) on board ship. Three other sailors can be seen standing on the right-hand side of the photograph. The photograph is from an album inscribed 'H.M.S. Lancaster; Mediterranean Photographic Album: Diary of Events and Important Places Visited during the Commission 1910-1912' on the cover. This album was the property of Sydney Harold Liddle.

  14. FT4 Data Analysis Summary (SSI-ARC)

    Science.gov (United States)

    Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor

    2016-01-01

    Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.

  15. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents

    Directory of Open Access Journals (Sweden)

    Ruuttu Titta

    2005-02-01

    Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  16. Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI) in adolescents.

    Science.gov (United States)

    Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri

    2005-02-03

    Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.

  17. SSI response of a typical shear wall structure. Volume 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.

    1984-04-01

    The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables

  18. SSI's review of SKB's RD and D programme 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others

    2002-08-01

    In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  19. Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.

    Science.gov (United States)

    Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F

    2012-10-01

    Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  20. 49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...

  1. 76 FR 446 - Supplemental Security Income (SSI) for the Aged, Blind, and Disabled; Dedicated Accounts and...

    Science.gov (United States)

    2011-01-05

    ... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...

  2. Effective Strategies To Improve the Employment of SSI/SSDI Participants.

    Science.gov (United States)

    Radtke, Jean, Ed.

    This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…

  3. SSI response of a typical shear wall structure

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.

    1985-01-01

    The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)

  4. Active Volcanism on Io as Seen by Galileo SSI

    Science.gov (United States)

    McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.

    1998-01-01

    Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50

  5. Cl@ssi 2.0: experience in Emilia Romagna

    Directory of Open Access Journals (Sweden)

    Elena Pacetti

    2013-06-01

    Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.

  6. 46 CFR 167.15-20 - Inspections of nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Inspections of nautical school ships. 167.15-20 Section... NAUTICAL SCHOOL SHIPS Inspections § 167.15-20 Inspections of nautical school ships. (a) At each annual inspection, or oftener if deemed necessary, the inspector will inspect the hull, boilers, machinery...

  7. Green Shipping Practices of Shipping Firms

    Directory of Open Access Journals (Sweden)

    Young-Tae Chang

    2017-05-01

    Full Text Available The primary objective of this study is to provide an empirical research using structural equation modeling to identify the factors that motivate shipping firms to adopt green shipping practices (GSP. Furthermore, it also examines if adopting GSP can enhance the shipping firms’ environmental and productivity performance. The findings show that shipping firms are motivated to adopt GSP mostly by industrial norms set by institutionalized associations. They are also motivated by customers’ demand for environmental friendliness and their own strategy to make good image. Unlike our expectation, government regulations and international environmental laws are not significant in influencing shipping firms to adopt GSP. Moreover, adoption of green shipping practices can improve the environmental and productivity performance of the shipping firms.

  8. DoSSiER: Database of Scientific Simulation and Experimental Results

    CERN Document Server

    Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea

    2017-01-01

    The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.

  9. Green shipping management

    CERN Document Server

    Lun, Y H Venus; Wong, Christina W Y; Cheng, T C E

    2016-01-01

    This book presents theory-driven discussion on the link between implementing green shipping practices (GSP) and shipping firm performance. It examines the shipping industry’s challenge of supporting economic growth while enhancing environmental performance. Consisting of nine chapters, the book covers topics such as the conceptualization of green shipping practices (GSPs), measurement scales for evaluating GSP implementation, greening capability, greening and performance relativity (GPR), green management practice, green shipping network, greening capacity, and greening propensity. In view of the increasing quest for environment protection in the shipping sector, this book provides a good reference for firms to understand and evaluate their capability in carrying out green operations on their shipping activities.

  10. The shipping man adventures in ship finance

    CERN Document Server

    McCleery, Matthew

    2013-01-01

    When restless New York City hedge fund manager Robert Fairchild watches the Baltic Dry Cargo Index plunge 97%, registering an all-time high and a 25-year low within the span of just six months, he decides to buy a ship. Immediately fantasizing about naming a vessel after his wife, carrying a string of worry beads and being able to introduce himself as a "shipowner" at his upcoming college reunion, Fairchild immediately embarks on an odyssey into the most exclusive, glamorous and high stakes business in the world. From pirates off the coast of Somalia and on Wall Street to Greek and Norwegian shipping magnates, the education of Robert Fairchild is an expensive one. In the end, he loses his hedge fund, but he gains a life - as a Shipping Man. Part fast paced financial thriller, part ship finance text book, The Shipping Man is 310 pages of required reading for anyone with an interest in capital formation for shipping.

  11. NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...

  12. Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area, December 2010

    Data.gov (United States)

    Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...

  13. 20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.

    Science.gov (United States)

    2010-04-01

    ... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...

  14. SSI analysis of a massive concrete structure based on a novel ...

    Indian Academy of Sciences (India)

    1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...

  15. SSI [soil-structure interactions] and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1986-01-01

    This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils

  16. Ship emissions and their externalities for Greece

    Science.gov (United States)

    Tzannatos, Ernestos

    2010-06-01

    The existing and emerging international and European policy framework for the reduction of ship exhaust emissions dictates the need to produce reliable national, regional and global inventories in order to monitor emission trends and consequently provide the necessary support for future policy making. Furthermore, the inventories of ship exhaust emissions constitute the basis upon which their external costs are estimated in an attempt to highlight the economic burden they impose upon the society and facilitate the cost-benefit analysis of the proposed emission abatement technologies, operational measures and market-based instruments prior to their implementation. The case of Greece is of particular interest mainly because the dense ship traffic within the Greek seas directly imposes the impact of its exhaust emission pollutants (NO x, SO 2 and PM) upon the highly populated, physically sensitive and culturally precious Greek coastline, as well as upon the land and seas of Greece in general, whereas the contribution of Greece in the global CO 2 inventory at a time of climatic change awareness cannot be ignored. In this context, this paper presents the contribution of Greece in ship exhaust emissions of CO 2, NO x, SO 2 and PM from domestic and international shipping over the last 25 years (1984-2008), utilizing the fuel-based (fuel sales) emission methodology. Furthermore, the ship exhaust emissions generated within the Greek seas and their externalities are estimated for the year 2008, through utilizing the fuel-based (fuel sales) approach for domestic shipping and the activity-based (ship traffic) approach for international shipping. On this basis, it was found that during the 1984 to 2008 period the fuel-based (fuel sales) ship emission inventory for Greece increased at an average annual rate of 2.85%. In 2008, the CO 2, NO x, SO 2 and PM emissions reached 12.9 million tons (of which 12.4 million tons of CO 2) and their externalities were found to be around 3

  17. Nuclear ship engineering simulator

    International Nuclear Information System (INIS)

    Itoh, Yasuyoshi; Kusunoki, Tsuyoshi; Hashidate, Koji

    1991-01-01

    The nuclear ship engineering simulator, which analyzes overall system response of nuclear ship numerically, is now being developed by JAERI as an advanced design tool with the latest computer technology in software and hardware. The development of the nuclear ship engineering simulator aims at grasping characteristics of a reactor plant under the situation generated by the combination of ocean, a ship hull and a reactor. The data from various tests with the nuclear ship 'MUTSU' will be used for this simulator to modulate and verify its functions of reproducing realistic response of nuclear ship, and then the simulator will be utilized for the research and development of advanced marine reactors. (author)

  18. A Persian-version of the stuttering severity instrument-version four (SSI-4) : How the new additions to SSI-4 complement its stuttering severity score?

    NARCIS (Netherlands)

    Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood

    2018-01-01

    Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to

  19. Guide to ship sanitation

    National Research Council Canada - National Science Library

    2011-01-01

    "The third edition of the Guide to Ship Sanitation presents the public health significance of ships in terms of disease and highlights the importance of applying appropriate control measures"--Back cover...

  20. Recycling of merchant ships

    Directory of Open Access Journals (Sweden)

    Magdalena Klopott

    2013-12-01

    Full Text Available The article briefly outlines the issues concerning ship recycling. It highlights ships' high value as sources of steel scrap and non-ferrous metals, without omitting the fact that they also contain a range of hazardous substances. Moreover, the article also focuses on basic ship demolition methods and their environmental impact, as well as emphasizes the importance of “design for ship recycling” philosophy.

  1. Dutch Ships and Sailors

    NARCIS (Netherlands)

    de Boer, Victor; Hoekstra, F.G.; Leinenga, Jurjen; van Rossum, Matthias

    2014-01-01

    Dutch Ships and Sailors provides an infrastructure for maritime historical datasets, linking correlating data through semantic web technology. It brings together datasets related to recruitment and shipping in the East-India trade (mainly 18th century) and in the shipping of the northern provinces

  2. Reactors. Nuclear propulsion ships

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2001-01-01

    This article has for object the development of nuclear-powered ships and the conception of the nuclear-powered ship. The technology of the naval propulsion P.W.R. type reactor is described in the article B.N.3 141 'Nuclear Boilers ships'. (N.C.)

  3. 46 CFR 167.15-10 - Application for annual inspection.

    Science.gov (United States)

    2010-10-01

    ... NAUTICAL SCHOOL SHIPS Inspections § 167.15-10 Application for annual inspection. Application in writing for the annual inspection of every nautical school ship required to be inspected by law and the... Inspection, at any local Marine Inspection Office, U.S. Coast Guard, where the nautical school ship may be...

  4. Nuclear merchant ship propulsion

    International Nuclear Information System (INIS)

    Schroeder, E.; Jager, W.; Schafstall, H.G.

    1977-01-01

    The operation of about 300 nuclear naval vessels has proven the feasibility of nuclear ship propulsion. Until now six non military ships have been built or are under construction. In the Soviet Union two nuclear icebreakers are in operation, and a third one is under construction. In the western world three prototype merchant ships have been built. Of these ships only the NS OTTO HAHN is in operation and provides valuable experience for future large scale use of nuclear merchant ship propulsion. In many countries studies and plans are made for future nuclear merchant ships. Types of vessels investigated are large containerships, tankers and specialized ships like icebreakers or ice-breaking ships. The future of nuclear merchant ship propulsion depends on three interrelated items: (1) nuclear ship technology; (2) economy of nuclear ship propulsion; (3) legal questions. Nuclear merchant ship technology is based until now on standard ship technology and light water reactor technology. Except for special questions due to the non-stationary type of the plant entirely new problems do not arise. This has been proven by the recent conceptual licensing procedure for a large nuclear containership in Germany. The economics of nuclear propulsion will be under discussion until they are proven by the operation of privately owned lead ships. Unsolved legal questions e.g. in connection with port entry permissions are at present another problem for nuclear shipping. Efforts are made to solve these questions on an international basis. The future development of nuclear energy electricity production in large land based plants will stimulate the employment of smaller units. Any future development of long distance sea transport will have to take this opportunity of a reliable and economic energy supply into account

  5. Seismic Response of Steel Braced Building Frame Considering Soil Structure Interaction (SSI): An Experimental Study

    Science.gov (United States)

    Hirave, Vivek; Kalyanshetti, Mahesh

    2018-02-01

    Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.

  6. Safety of nuclear ships

    International Nuclear Information System (INIS)

    1978-01-01

    Interest in the utilization of nuclear steam supply systems for merchant ships and icebreakers has recently increased considerably due to the sharp rise in oil prices and the continuing trend towards larger and faster merchant ships. Canada, for example, is considering construction of an icebreaker in the near future. On the other hand, an accident which could result in serious damage to or the sinking of a nuclear ship is potentially far more dangerous to the general public than a similar accident with a conventional ship. Therefore, it was very important to evaluate in an international forum the safety of nuclear ships in the light of our contemporary safety philosophy, taking into account the results of cumulative operating experience with nuclear ships in operation. The philosophy and safety requirement for land-based nuclear installations were outlined because of many common features for both land-based nuclear installations and nuclear ships. Nevertheless, essential specific safety requirements for nuclear ships must always be considered, and the work on safety problems for nuclear ships sponsored by the NEA was regarded as an important step towards developing an international code of practice by IMCO on the safety of nuclear merchant ships. One session was devoted to the quantitative assessment of nuclear ship safety. The probability technique of an accident risk assessment for nuclear power plants is well known and widely used. Its modification, to make it applicable to nuclear propelled merchant ships, was discussed in some papers. Mathematical models for describing various postulated accidents with nuclear ships were developed and reported by several speakers. Several papers discussed a loss-of-coolant accident (LOCA) with nuclear steam supply systems of nuclear ships and engineering design features to prevent a radioactive effluence after LOCA. Other types of postulated accidents with reactors and systems in static and dynamic conditions were also

  7. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel; Utgaangspunkter foer SSI:s granskning av ansoekan foer en inkapslingsanlaeggning och ett slutfoervar foer anvaent kaernbraensle

    Energy Technology Data Exchange (ETDEWEB)

    Oehlen, Elisabeth

    2006-09-15

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.

  8. Secondary signal imaging (SSI) electron tomography (SSI-ET): A new three-dimensional metrology for mesoscale specimens in transmission electron microscope.

    Science.gov (United States)

    Han, Chang Wan; Ortalan, Volkan

    2015-09-01

    We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.

  9. Validation of seismic soil structure interaction (SSI) methodology for a UK PWR nuclear power station

    International Nuclear Information System (INIS)

    Llambias, J.M.

    1993-01-01

    The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation

  10. Buckling of Ship Structures

    CERN Document Server

    Shama, Mohamed

    2013-01-01

    Buckling of Ship Structures presents a comprehensive analysis of the buckling problem of ship structural members. A full analysis of the various types of loadings and stresses imposed on ship plating and primary and secondary structural members is given. The main causes and consequences of the buckling mode of failure of ship structure and the methods commonly used to control buckling failure are clarified. This book contains the main equations required to determine the critical buckling stresses for both ship plating and the primary and secondary stiffening structural members. The critical buckling stresses are given for ship plating subjected to the induced various types of loadings and having the most common boundary conditions encountered in ship structures.  The text bridges the gap existing in most books covering the subject of buckling of ship structures in the classical analytical format, by putting the emphasis on the practical methods required to ensure safety against buckling of ship structur...

  11. Using Social Media to Promote Pre-Service Science Teachers' Practices of Socio-Scientific Issue (SSI) - Based Teaching

    Science.gov (United States)

    Pitiporntapin, Sasithep; Lankford, Deanna Marie

    2015-01-01

    This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…

  12. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Oehlen, Elisabeth

    2006-09-01

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect

  13. Crushing Strength of Ship Structures

    DEFF Research Database (Denmark)

    Cerup-Simonsen, Bo; Abramowicz, W.; Høstgaard-Brene, C.N.S.

    1999-01-01

    The crushing response of ship structures is of primary importance to the designers and practicing engineers concerned with accidental loading and accident reconstruction of marine vehicles. Ship to-ship collisions, ship-harbor infrastructure interaction or ship-offshore structure interaction are ...

  14. 75 FR 1271 - Technical Revisions to the Supplemental Security Income (SSI) Regulations on Income and Resources

    Science.gov (United States)

    2010-01-11

    ... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...

  15. Galileo SSI Observations of Io During Orbits C30 I33

    Science.gov (United States)

    Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.

    2002-01-01

    New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.

  16. 20 CFR 416.1826 - Showing that you are not married when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...

  17. Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter

    Science.gov (United States)

    Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann

    2010-01-01

    There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…

  18. Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model

    Institute of Scientific and Technical Information of China (English)

    Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi

    2013-01-01

    The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.

  19. Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas; Vatrapu, Ravi

    2015-01-01

    and national borders within international shipping which is a rather complex domain. The intellectual objective is to generate and evaluate the efficacy and effectiveness of design principles for inter-organizational information infrastructures in the international shipping domain that can have positive...

  20. Liner Shipping Fleet Repositioning

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller

    2011-01-01

    Liner shipping fleet repositioning consists of moving vessels between services in a liner ship- ping network in order to better orient the overall network to the world economy, and to ensure the proper maintenance of vessels. Thus, fleet repositioning involves sailing and loading activities subject...

  1. Handbook of nuclear ships

    International Nuclear Information System (INIS)

    1981-03-01

    First, the government organs and other organizations related to nuclear ships and their tasks are described. The fundamental plan for the development of nuclear ships had been determined in July, 1963, and was revised three times thereafter. However in December, 1980, new determination to carry out the research works also was made. The course of the construction of the nuclear ship ''Mutsu'' from 1955 to 1980, the main particulars of the nuclear ship ''Mutsu'' and the drawing of the general arrangement are shown. The designated port for berthing the Mutsu was completed in 1972 in Ominato, Aomori Prefecture, but after the happening of radiation leak during the trial operation of the Mutsu in 1974, it was agreed to remove the port. The main works to be carried out at the port and the port facilities are explained. The progress of the examination of safety of the Mutsu and the result, the test of raising the power output carried out in 1974, and the course of selecting the port for making the repair works of the Mutsu are described. The law concerning Japan Nuclear Ship Research and Development Agency had been instituted in 1963, and was revised four times thereafter. The change of the budget for the tests and researches related to nuclear ships in Japan is shown. The state of development of nuclear ships in foreign countries, the international organs related to atomic energy, shipping, shipbuilding and energy, and chronological table are introduced. (Kako, I.)

  2. Effective and Safe Ships

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Amdahl, Jørgen; Rutgersson, Olle

    1996-01-01

    A Joint Nordic Research project "Effecive and Safe Ships" is presented. The project is aiming to develop methods and tools for quantitative evaluation fo ship safety. This report is the report of the preliminary phase where the plan for the main project is developed. The objectives of the project...

  3. Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas

    to creating a more efficient shipping industry, and a number of critical issues are identified. These include that shipments depend on shipping information, that shipments often are delayed due to issues with documentation, that EDI messages account for only a minor part of the needed information......This thesis applies theoretical perspectives from the Information Systems (IS) research field to propose how Information Technology (IT) can improve containerized shipping. This question is addressed by developing a set of design principles for an information infrastructure for sharing shipping...... information named the Shipping Information Pipeline (SIP). Review of the literature revealed that IS research prescribed a set of meta-design principles, including digitalization and digital collaboration by implementation of Inter-Organizational Systems based on Electronic Data Interchange (EDI) messages...

  4. Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses

    International Nuclear Information System (INIS)

    Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee

    2016-01-01

    The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45

  5. Nuclear ships and their safety

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1961-04-15

    Several aspects of nuclear ship propulsion, with special reference to nuclear safety, were discussed at an international symposium at Taormina, Italy, from 14-18 November 1960. Discussions on specific topics are conducted, grouped under the following headings: Economics and National Activities in Nuclear Ship Propulsion; International Problems and General Aspects of Safety for Nuclear Ships; Nuclear Ship Projects from the Angle of Safety; Ship Reactor Problems; Sea Motion and Hull Problems; Maintenance and Refuelling Problems; and Safety Aspects of Nuclear Ship Operation.

  6. From the American Academy of Pediatrics: Policy statements--Supplemental Security Income (SSI) for children and youth with disabilities.

    Science.gov (United States)

    2009-12-01

    The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.

  7. 73. Surgical site infection after CABG: Root cause analysis and quality measures recommendation SSI quality improvement project

    Directory of Open Access Journals (Sweden)

    A. Arifi

    2016-07-01

    Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the

  8. Hydrodynamics of Ship Propellers

    DEFF Research Database (Denmark)

    Breslin, John P.; Andersen, Poul

    This book deals with flows over propellers operating behind ships, and the hydrodynamic forces and moments which the propeller generates on the shaft and on the ship hull.The first part of the text is devoted to fundamentals of the flow about hydrofoil sections (with and without cavitation...... of an intermittently cavitating propeller in a wake and the pressures and forces it exerts on the shaft and on the ship hull is examined. A final chapter discusses the optimization of efficiency of compound propulsors. The authors have taken care to clearly describe physical concepts and mathematical steps. Appendices...

  9. Multidrug-Resistant Gram-Negative Bacterial and Carbapenem-Resistant Enterobacteriaceae Infections in the Department of the Navy: Annual Report 2013

    Science.gov (United States)

    2015-03-19

    Department per patient per admission. Device- and procedure-associated metrics (CLABSI, VAP , SSI) require the use of International Classification of...Overall Prevalence 0.28 HO Bacteremia 0.002 HO UTI 0.008 CLABSI -- VAP -- SSI 0.01 Per 100 Procedures per 1,000 Patient -Days...policy or position of the Department of the Navy, Department of Defense, nor the U.S. Government. i MDRGNB/CRE Infections in the DON: Annual

  10. Designing Adaptable Ships: Modularity and Flexibility in Future Ship Designs

    Science.gov (United States)

    2016-01-01

    with motors, belts, shafts , seals, valves, hose spindles , and switches. If ship installation is not installed, the system will be status quo. Ship...Impact: the current centrifugal purifiers (Alfa-Laval) have experienced frequent failures with motor, belts, shafts , seals, valves, hose spindles ... Designing Adaptable Ships Modularity and Flexibility in Future Ship Designs John F. Schank, Scott Savitz, Ken Munson, Brian Perkinson, James

  11. Optimization in liner shipping

    DEFF Research Database (Denmark)

    Brouer, Berit Dangaard; Karsten, Christian Vad; Pisinger, David

    2017-01-01

    Seaborne trade is the lynchpin in almost every international supply chain, and about 90% of non-bulk cargo worldwide is transported by container. In this survey we give an overview of data-driven optimization problems in liner shipping. Research in liner shipping is motivated by a need for handling...... still more complex decision problems, based on big data sets and going across several organizational entities. Moreover, liner shipping optimization problems are pushing the limits of optimization methods, creating a new breeding ground for advanced modelling and solution methods. Starting from liner...... shipping network design, we consider the problem of container routing and speed optimization. Next, we consider empty container repositioning and stowage planning as well as disruption management. In addition, the problem of bunker purchasing is considered in depth. In each section we give a clear problem...

  12. Civilian nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-03-01

    This report contains a review of the information available on nuclear powered ships, built for civilian purposes. In the introduction a short discussion is given of the reasons for the limited use of nuclear ships for these purposes. In the second section a brief review is presented of data for the three experimental/merchant ships build by the United States, Germany and Japan, i.e. NS Savannah, NS Otto Hahn and NS Mutsu. In the third section the Soviet/Russian icebreaker NS Lenin is considered. Its design, operational experience and the introduction of a new nuclear propulsion plant is reviewed. In the fourth section the newer Soviet/Russian icebreakers with nuclear propulsion are considered. Finally design of the Soviet/Russian icebreaker transport/container ship NS Sevmorput is reviewed in the fifth section. The future Russian plans for nuclear vessels for the arctic waters are briefly discussed. (au)

  13. Ship propulsion reactors technology

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2002-01-01

    This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

  14. Ship construction and welding

    CERN Document Server

    Mandal, Nisith R

    2017-01-01

    This book addresses various aspects of ship construction, from ship types and construction materials, to welding technologies and accuracy control. The contents of the book are logically organized and divided into twenty-one chapters. The book covers structural arrangement with longitudinal and transverse framing systems based on the service load, and explains basic structural elements like hatch side girders, hatch end beams, stringers, etc. along with structural subassemblies like floors, bulkheads, inner bottom, decks and shells. It presents in detail double bottom construction, wing tanks & duct keels, fore & aft end structures, etc., together with necessary illustrations. The midship sections of various ship types are introduced, together with structural continuity and alignment in ship structures. With regard to construction materials, the book discusses steel, aluminum alloys and fiber reinforced composites. Various methods of steel material preparation are discussed, and plate cutting and form...

  15. Nuclear ship accidents

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-05-01

    In this report available information on 28 nuclear ship accident and incidents is considered. Of these 5 deals with U.S. ships and 23 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the nuclear propulsion plants, radiation exposures, fires/explosions and sea water leaks into the submarines are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that much of the available information is of a rather dubious nature. consequently some of the assessments made may not be correct. (au)

  16. Performance Monitoring of Ships

    DEFF Research Database (Denmark)

    Hansen, Søren Vinther

    is used as input to the system and by comparing model and ship behaviour, an index describing the ship’s performance is generated. The work in this thesis is based on data logged through the automation system on board a PostPanmax container ship where data have been logged through a year. A routine...... in the models have been identified. The models used in this work are based on empirical relations or based on regression analyses of model tests and full-scale trials. In order to achieve valid results the conditions where performance is estimated have to be inside the boundaries of the model. Filters have been......The purpose of the research project is to establish a reliable index in the performance evaluation of ships. During operation the ship will experience added resistance due to fouling of hull and propeller. The added resistance will lead to increased fuel consumption and thus increased emissions...

  17. Distributed propulsion for ships

    OpenAIRE

    Nylund, Vilde

    2017-01-01

    It is anticipated that using distributed electric propulsion (DEP) on conventional ships will increase the total propulsive efficiency. This is mainly due to two reasons; firstly, because the total propeller disk area can be increased. Secondly, because each propeller can be optimised for the local wake where it is operating. In this work, the benefits of using DEP has been investigated for a 14 000 TEU container ship. Based on a literary study of the present state of propeller modelling ...

  18. SHIPPING REQUESTS ON EDH

    CERN Multimedia

    Logistics Group

    2001-01-01

    Users are informed that as from 1 September 2001 all Shipping Requests must be made on EDH using the appropriate electronic form. The submission of user requests directly into EDH will help rationalise the activities of the Shipping Service (Import & Export), with requests being automatically forwarded to hierarchical supervisors thereby improving the processing speed and facilitating the follow-up. Thank you for your collaboration.

  19. Plastic Pollution from Ships

    OpenAIRE

    Čulin, Jelena; Bielić, Toni

    2016-01-01

    The environmental impact of shipping on marine environment includes discharge of garbage. Plastic litter is of particular concern due to abundance, resistance to degradation and detrimental effect on marine biota. According to recently published studies, a further research is required to assess human health risk. Monitoring data indicate that despite banning plastic disposal at sea, shipping is still a source of plastic pollution. Some of the measures to combat the problem are discussed.

  20. On the Global Ship Hull Bending Energy in Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Li, Y.

    2004-01-01

    During ship collisions part of the kinetic energy of the involved vessels prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can be stored in elastic...... hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non trivial part of the energy released for structural deformation during the collision can be absorbed as elastic energy in global...... ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship-ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing is confined...

  1. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  2. Outer Dynamics of Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    The purpose is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisions with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding structures....

  3. Recent situations around nuclear ships

    International Nuclear Information System (INIS)

    Mizuno, Hiroshi

    1978-01-01

    The philosophy when the safety standard for nuclear ships is drawn up and the international rules specifically for nuclear ships are summarized. As for the safety standard for nuclear ships, the safety requirements for ordinary ships, for the ships transporting nuclear reactors, for ordinary nuclear reactors, and for the reactors moving around the seas must be included. As for the international rules for nuclear ships, there are chapter 8 ''Nuclear ships'' in the International Convention on the Safety of Life at Sea, 1960 and 1974, and Safety Consideration in the Use of Ports and Approaches by Nuclear Merchant Ships. Also there are national rules and standards in Japan and foreign countries. One of the means to explore the practicality of nuclear ships is the investigation of the economy. At this time, the social merits and demerits of nuclear ships must be compared with conventional ships by taking total expenses into account without omission. When oil is depleted, the age of nuclear ships will not necessarily begin, and the will be still some competitors. The investigations concerning the economy of nuclear ships have been carried out in various countries. The present state of the development of nuclear ships in Japan and foreign countries is explained. Many conferences and symposia have been held concerning nuclear ships, and those held recently are enumerated. The realization of nuclear ship age cannot be anticipated from existing papers and shipbuilding projects. (Kako, I.)

  4. Outer Dynamics of Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    The purpose of these notes is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisons with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding...

  5. Effects of different SSI parameters on the floor response spectra of a nuclear reactor building

    International Nuclear Information System (INIS)

    Kabir, A.F.; Bolourchi, S.; Maryak, M.E.

    1991-01-01

    The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth

  6. The SSI TOOLBOX Source Term Model SOSIM - Screening for important radionuclides and parameter sensitivity analysis

    Energy Technology Data Exchange (ETDEWEB)

    Avila Moreno, R.; Barrdahl, R.; Haegg, C.

    1995-05-01

    The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.

  7. Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model

    International Nuclear Information System (INIS)

    Kang, Joo-Hyung; Lee, Sang-Hoon

    2008-01-01

    Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated

  8. Accidents in nuclear ships

    Energy Technology Data Exchange (ETDEWEB)

    Oelgaard, P L [Risoe National Lab., Roskilde (Denmark); [Technical Univ. of Denmark, Lyngby (Denmark)

    1996-12-01

    This report starts with a discussion of the types of nuclear vessels accidents, in particular accidents which involve the nuclear propulsion systems. Next available information on 61 reported nuclear ship events in considered. Of these 6 deals with U.S. ships, 54 with USSR ships and 1 with a French ship. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/explosions, sea-water leaks into the submarines and sinking of vessels are considered. For each event a summary of available information is presented, and comments are added. In some cases the available information is not credible, and these events are neglected. This reduces the number of events to 5 U.S. events, 35 USSR/Russian events and 1 French event. A comparison is made between the reported Soviet accidents and information available on dumped and damaged Soviet naval reactors. It seems possible to obtain good correlation between the two types of events. An analysis is made of the accident and estimates are made of the accident probabilities which are found to be of the order of 10{sup -3} per ship reactor years. It if finally pointed out that the consequences of nuclear ship accidents are fairly local and does in no way not approach the magnitude of the Chernobyl accident. It is emphasized that some of the information on which this report is based, may not be correct. Consequently some of the results of the assessments made may not be correct. (au).

  9. Accidents in nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1996-12-01

    This report starts with a discussion of the types of nuclear vessels accidents, in particular accidents which involve the nuclear propulsion systems. Next available information on 61 reported nuclear ship events in considered. Of these 6 deals with U.S. ships, 54 with USSR ships and 1 with a French ship. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/explosions, sea-water leaks into the submarines and sinking of vessels are considered. For each event a summary of available information is presented, and comments are added. In some cases the available information is not credible, and these events are neglected. This reduces the number of events to 5 U.S. events, 35 USSR/Russian events and 1 French event. A comparison is made between the reported Soviet accidents and information available on dumped and damaged Soviet naval reactors. It seems possible to obtain good correlation between the two types of events. An analysis is made of the accident and estimates are made of the accident probabilities which are found to be of the order of 10 -3 per ship reactor years. It if finally pointed out that the consequences of nuclear ship accidents are fairly local and does in no way not approach the magnitude of the Chernobyl accident. It is emphasized that some of the information on which this report is based, may not be correct. Consequently some of the results of the assessments made may not be correct. (au)

  10. On the global ship hull bending energy in ship collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Li, Yujie

    2009-01-01

    During ship collisions part of the kinetic energy of the involved vessels immediately prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can...... be stored in elastic hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non-trivial part of the energy released for structural deformation during the collision can be absorbed as elastic...... energy in global ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship–ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing...

  11. EX1301: Ship Shakedown and Patch Test Exploration, NE Canyons and Seamounts on NOAA Ship Okeanos Explorer between 20130318 and 20130405

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Following annual ship shakedown and patch tests, EX1301 will complete the comprehensive mapping of the Northeast canyons and the adjacent continental shelf carried...

  12. Ship operations report, 1973

    International Nuclear Information System (INIS)

    1973-01-01

    The NOAA Fleet Operations Report 1973 was developed to provide a summary of project accomplishments during calendar year 1973. The report was prepared from season, cruise and special reports submitted by ships of the fleet. Centralized management of the NOAA Fleet was finalized by changing the operational control of the National Marine Fisheries Service (NMFS) Ships DAVID STARR JORDAN (FRS 44), TOWNSEND CROMWELL (FRS 43) and MURRE II (FRV 63) from NMFS to the National Ocean Survey on July 1, 1973. Throughout the year, ships routinely collected and transmitted weather data. Similarly, as NOAA participants in the Integrated Global Ocean Station System (IGOSS) service program, XBT observations were taken and either radioed or submitted in log form via mail. In addition, particulate and radionuclide samples were taken in cooperation with the Atomic Energy Commission, sediment samples were obtained for the Smithsonian Institution and observations were made of marine mammals

  13. Ship operations report, 1975

    International Nuclear Information System (INIS)

    1976-01-01

    The NOAA Ship Operations Report 1975 was developed to provide a summary of projects undertaken during calendar year 1975. The report was prepared from season, cruise and special reports submitted by ships of the fleet. This report is promulgated for inhouse dissemination in the National Oceanic and Atmospheric Administration, for collaborating and interested agencies, and for use by members of the scientific community. Throughout the year, ships routinely collected and transmitted weather data. Similarly, as NOAA participants in the Integrated Global Ocean Station System (IGOSS) service program, XBT observations were taken and either radioed or submitted in log form via mail. In addition, particulate and radionuclide samples were taken in cooperation with the Atomic Energy Commission, sediment samples were obtained for the Smithsonian Institution and observations were made of marine mammals

  14. Shipping emissions in ports

    OpenAIRE

    Merk, Olaf

    2014-01-01

    Shipping emissions in ports are substantial, accounting for 18 million tonnes of CO2 emissions, 0.4 million tonnes of NOx, 0.2 million of SOx and 0.03 million tonnes of PM10 in 2011. Around 85% of emissions come from containerships and tankers. Containerships have short port stays, but high emissions during these stays. Most of CO2 emissions in ports from shipping are in Asia and Europe (58%), but this share is low compared to their share of port calls (70%). European ports have much less emi...

  15. Are nuclear ships environmentally safer than conventionally powered ships

    International Nuclear Information System (INIS)

    Bone, C.A.; Molgaard, C.A.; Helmkamp, J.C.; Golbeck, A.L.

    1988-01-01

    An epidemiologic analysis was conducted to determine if risk of hospitalization varied by age, ship type, or occupation between nuclear and conventional powered ship crews in the U.S. Navy. Study cohorts consisted of all male enlisted personnel who served exclusively aboard conventional or nuclear powered aircraft carriers and cruisers during the years 1975-1979; cases were those men hospitalized during this period (N = 48,242). Conventional ship personnel showed significantly elevated rates of injury and disease when compared to nuclear ship personnel. The largest relative risks by age occurred for conventional ship crewmen less than 30 years old. Seaman, logistics (supply), and healthcare personnel serving aboard conventional ships comprised the occupational groups exhibiting the highest hospitalization rate differentials. The results strongly suggest that nuclear ships provide a healthier, safer working and living environment than conventional ships

  16. An Assessment of the SST Simulation Using the Climate Forecast System Coupled to the SSiB Surface Model

    Science.gov (United States)

    Wang, Y.; Xue, Y.; Huang, B.; Lee, J.; De Sales, F.

    2016-12-01

    A long term simulation has been conducted using the Climate Forecast System (CFSv2) coupled to the SSiB-2 land model, which consists of the Global Forecast System atmospheric model (GFS) and the Modular Ocean model - version 4 (MOM4) as the ocean component. This study evaluates the model's performance in simulating sea surface temperature (SST) mean state, trend, and inter-annual and decadal variabilities. The model is able to produce the reasonable spatial distribution of the SST climatology; however, it has prominent large scale biases. In the middle latitude of the Northern Hemisphere, major cold biases is close to the warm side of the large SST gradients, which may be associated with the weaker Kuroshio and Gulf Stream extensions that diffuse the SST gradient. IN addition, warm biases extend along the west coast of the North America continent to the high latitude, which may be related with excessive Ekman down-welling and solar radiation fluxes reaching to the surface due to the lack of cloud there. Warm biases also exist over the tropical cold tough areas in the Pacific and Atlantic. The global SST trend and interannual variations are well captured except for that in the south Hemisphere after year 2000, which is mainly contributed by the bias from the southern Pacific Ocean. Although the model fails to accurately produce ENSO events in proper years, it does reproduce the ENSO frequency well; they are skewed toward more warm events after 1990. The model also shows ability in SST decadal variation, such as the so-called inter-decadal Pacific oscillation (IPO); however, its phases seem to go reversely compared with the observation.

  17. Mechanics of Ship Grounding

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    In these notes first a simplified mathematical model is presented for analysis of ship hull loading due to grounding on relatively hard and plane sand, clay or rock sea bottoms. In a second section a more rational calculation model is described for the sea bed soil reaction forces on the sea bott...

  18. SHIPPING OF RADIOACTIVE ITEMS

    CERN Multimedia

    TIS/RP Group

    2001-01-01

    The TIS-RP group informs users that shipping of small radioactive items is normally guaranteed within 24 hours from the time the material is handed in at the TIS-RP service. This time is imposed by the necessary procedures (identification of the radionuclides, determination of dose rate and massive objects require a longer procedure and will therefore take longer.

  19. Ship Roll Motion Control

    DEFF Research Database (Denmark)

    Perez, Tristan; Blanke, Mogens

    2010-01-01

    . This tutorial paper presents an account of the development of various ship roll motion control systems and the challenges associated with their design. The paper discusses how to assess performance, the applicability of dierent models, and control methods that have been applied in the past....

  20. Ship Roll Damping Control

    DEFF Research Database (Denmark)

    Perez, Tristan; Blanke, Mogens

    2012-01-01

    limitations and large variations of the spectral characteristics of wave-induced roll motion. This tutorial paper presents an account of the development of various ship roll motion control systems together with the challenges associated with their design. It discusses the assessment of performance...

  1. Options of ship discharge

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2010-05-15

    Environmental performance is a key design consideration for manufacturers of bulk handling machines, not least ship unloaders, with features being introduced to minimise dust and noise pollution. The article reports on developments in grab unloaders, slewing grabcranes and mobile grabcranes by manufacturers such as Konecrane, EMS-Tech, Liebherr-Werk Nenzing and Gottwald. 2 photos.

  2. Hydroelastic Vibrations of Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher; Folsø, Rasmus

    2002-01-01

    A formula for the necessary hull girder bending stiffness required to avoid serious springing vibrations is derived. The expression takes into account the zero crossing period of the waves, the ship speed and main dimensions. For whipping vibrations the probability of exceedance for the combined...

  3. Classification of Ship Routing and Scheduling Problems in Liner Shipping

    DEFF Research Database (Denmark)

    Kjeldsen, Karina Hjortshøj

    2011-01-01

    This article provides a classification scheme for ship routing and scheduling problems in liner shipping in line with the current and future operational conditions of the liner shipping industry. Based on the classification, the literature is divided into groups whose main characteristics...

  4. Wallops Ship Surveillance System

    Science.gov (United States)

    Smith, Donna C.

    2011-01-01

    Approved as a Wallops control center backup system, the Wallops Ship Surveillance Software is a day-of-launch risk analysis tool for spaceport activities. The system calculates impact probabilities and displays ship locations relative to boundary lines. It enables rapid analysis of possible flight paths to preclude the need to cancel launches and allow execution of launches in a timely manner. Its design is based on low-cost, large-customer- base elements including personal computers, the Windows operating system, C/C++ object-oriented software, and network interfaces. In conformance with the NASA software safety standard, the system is designed to ensure that it does not falsely report a safe-for-launch condition. To improve the current ship surveillance method, the system is designed to prevent delay of launch under a safe-for-launch condition. A single workstation is designated the controller of the official ship information and the official risk analysis. Copies of this information are shared with other networked workstations. The program design is divided into five subsystems areas: 1. Communication Link -- threads that control the networking of workstations; 2. Contact List -- a thread that controls a list of protected item (ocean vessel) information; 3. Hazard List -- threads that control a list of hazardous item (debris) information and associated risk calculation information; 4. Display -- threads that control operator inputs and screen display outputs; and 5. Archive -- a thread that controls archive file read and write access. Currently, most of the hazard list thread and parts of other threads are being reused as part of a new ship surveillance system, under the SureTrak project.

  5. Added masses of ship structures

    CERN Document Server

    Korotkin, Alexandr I

    2008-01-01

    This essentially self-contained reference book contains data on added masses of ships and various ship and marine engineering structures. Theoretical and experimental methods for determining added masses of these objects are described.

  6. Ship Observations - VOS and Navy

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Combination of Voluntary Observing Ship (VOS) and US Navy Ship weather observations. Obs generally taken 2-4 times daily at 00, 06, 12, and 18z.

  7. Trends of shipping markets development

    Directory of Open Access Journals (Sweden)

    Tomasz Nowosielski

    2012-06-01

    Full Text Available Shipping markets are dependent on international trade transactions that generate transport needs. These needs can dynamically change depending on global natural resources and commodity markets situation. The changes affecting shipping markets can also be caused by changes to the existing cargo flows and by establishing new ones in different geographies. It is anticipated that in the future shipping markets will change, visible by a decline in shipping in North America and Europe and an increase in Asia.

  8. Effect of the gate scaling on the analogue performance of s-Si CMOS devices

    International Nuclear Information System (INIS)

    Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E

    2011-01-01

    In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts

  9. High cost for drilling ships

    International Nuclear Information System (INIS)

    Hooghiemstra, J.

    2007-01-01

    Prices for the rent of a drilling ship are very high. Per day the rent is 1% of the price for building such a ship, and those prices have risen as well. Still, it is attractive for oil companies to rent a drilling ship [nl

  10. THE EFFECT OF 5E LEARNING CYCLE INSTRUCTIONAL MODEL USING SOCIOSCIENTIFIC ISSUES (SSI LEARNING CONTEXT ON STUDENTS’ CRITICAL THINKING

    Directory of Open Access Journals (Sweden)

    A. Cahyarini

    2016-11-01

    Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills (  = 74,95 than both the student who learned using 5E LC model (  = 74,17 and  the student who learned using conventional method (  = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However,  there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.

  11. Towards Real Time Simulation of Ship-Ship Interaction

    DEFF Research Database (Denmark)

    Lindberg, Ole; Bingham, Harry B.; Engsig-Karup, Allan Peter

    2012-01-01

    We present recent and preliminary work directed towards the development of a simplified, physics-based model for improved simulation of ship-ship interaction that can be used for both analysis and real-time computing (i.e. with real-time constraints due to visualization). The goal is to implement...... accurate (realistic) and much faster ship-wave and ship-ship simulations than are currently possible. The coupling of simulation with visualization should improve the visual experience such that it can be perceived as more realistic in training. Today the state-of-art in real-time ship-ship interaction...... is for efficiency reasons and time-constraints in visualization based on model experiments in towing tanks and precomputed force tables. We anticipate that the fast, and highly parallel, algorithm described by Engsig-Karup et al. [2011] for execution on affordable modern high-throughput Graphics Processing Units...

  12. The role of the cerebellum in auditory processing using the SSI test A participação do cerebelo no processamento auditivo com o uso do teste SSI

    Directory of Open Access Journals (Sweden)

    Patricia Maria Sens

    2011-10-01

    Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte

  13. EMP coupling to ships

    International Nuclear Information System (INIS)

    Deadrick, F.J.; Cabayan, H.S.; Kunz, K.F.; Bevensee, R.M.; Martin, L.C.; Egbert, R.W.

    1980-01-01

    Scale-model tests were conducted to establish the adequacy and limitations of model measurements as tools for predicting electromagnetic pulse (EMP) coupling voltages and currents to the critical antennas, cables, and metallic structures on ships. The scale-model predictions are compared with the results of the full-scale EMP simulation test of the Canadian ASW ship, HMCS Huron. (The EMP coupling predictions in this report were made without prior knowledge of the results of the data from the HMCS Huron tests.) This report establishes that the scale-model tests in conjunction with the data base from EMP coupling modules provides the necessary information for source model development and permits effective, low-cost study of particular system configurations. 184 figures, 9 tables

  14. SHIPPING OF RADIOACTIVE ITEMS

    CERN Multimedia

    TIS/RP Group

    2001-01-01

    The TIS-RP group informs users that shipping of small radioactive items is normally guaranteed within 24 hours from the time the material is handed in at the TIS-RP service. This time is imposed by the necessary procedures (identification of the radionuclides, determination of dose rate, preparation of the package and related paperwork). Large and massive objects require a longer procedure and will therefore take longer.

  15. Ship and Shoot

    Science.gov (United States)

    Woods, Ron

    2012-01-01

    Ron Woods shared incredibly valuable insights gained during his 28 years at the Kennedy Space Center (KSC) packaging Flight Crew Equipment for shuttle and ISS missions. In particular, Woods shared anecdotes and photos from various processing events. The moral of these stories and the main focus of this discussion were the additional processing efforts and effects related to a "ship-and-shoot" philosophy toward flight hardware.

  16. Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI

    Directory of Open Access Journals (Sweden)

    MOHD AFIFI BAHURUDIN SETAMBAH

    2018-05-01

    Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.

  17. Development of generic soil profiles and soil data development for SSI analyses

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)

    2014-04-01

    This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.

  18. Nonlinear Time Domain Seismic Soil-Structure Interaction (SSI) Deep Soil Site Methodology Development

    International Nuclear Information System (INIS)

    Spears, Robert Edward; Coleman, Justin Leigh

    2015-01-01

    Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This

  19. Future shift of the relative roles of precipitation and temperature in controlling annual runoff in the conterminous United States

    Science.gov (United States)

    Kai Duan; Ge Sun; Steven G. McNulty; Peter V. Caldwell; Erika C. Cohen; Shanlei Sun; Heather D. Aldridge; Decheng Zhou; Liangxia Zhang; Yang Zhang

    2017-01-01

    This study examines the relative roles of cli- matic variables in altering annual runoff in the contermi- nous United States (CONUS) in the 21st century, using a monthly ecohydrological model (the Water Supply Stress In- dex model, WaSSI) driven with historical records and future scenarios constructed from 20 Coupled Model Intercompar- ison Project Phase 5 (CMIP5)...

  20. Enhanced situational technologies applied to ship channels

    Science.gov (United States)

    Helgeson, Michael A.; Wacker, Roger A.

    1997-06-01

    The Houston Ship Channel ranks as America's number one port in foreign tonnage by welcoming more than 50,000 cargo ships and barges annually. Locally 196,000 jobs, 5.5 billion dollars in business revenue and 213 million dollars in taxes are generated. Unfortunately, 32 days of each year vessel traffic stops for hours due to fog causing an estimated 40- 100 million dollars loss as ships idly wait in the channel for weather to clear. In addition, poor visibility has contributed to past vessel collisions which have resulted in channel closure, and associated damage to property and the environment. Today's imaging technology for synthetic vision systems and enhanced situational awareness systems offers a new solution to this problem. Whereas, typically these systems have been targeted at aircraft landing systems the channel navigation application provides a peripheral ground based market. This paper describes two imaging solutions to the problem. One using an active 35 GHz scanning radar and the other using a 94 GHz passive millimeter wave camera.

  1. Resistance to Dialogic Discourse in SSI Teaching: The Effects of an Argumentation-Based Workshop, Teaching Practicum, and Induction on a Preservice Science Teacher

    Science.gov (United States)

    Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan

    2017-01-01

    Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…

  2. Analysis of a ship-to-ship collision

    International Nuclear Information System (INIS)

    Porter, V.L.; Ammerman, D.J.

    1996-01-01

    Sandia National Laboratories is involved in a safety assessment for the shipment of radioactive material by sea. One part of this study is investigation of the consequences of ship-to-ship collisions. This paper describes two sets of finite element analyses performed to assess the structural response of a small freighter and the loading imparted to radioactive material (RAM) packages during several postulated collision scenarios with another ship. The first series of analyses was performed to evaluate the amount of penetration of the freighter hull by a striking ship of various masses and initial velocities. Although these analyses included a representation of a single RAM package, the package was not impacted during the collision so forces on the package could not be computed. Therefore, a second series of analyses incorporating a representation of a row of seven packages was performed to ensure direct package impact by the striking ship. Average forces on a package were evaluated for several initial velocities and masses of the striking ship. In addition to. providing insight to ship and package response during a few postulated ship collisions scenarios, these analyses will be used to benchmark simpler ship collision models used in probabilistic risk assessment analyses

  3. Hospital Ship Replacement

    Science.gov (United States)

    2011-08-01

    serious contender. Although it is a proven hull design for stability, integrating the ability to quickly transfer patients aboard is challenging . The...Waste management afloat is a constant challenge for the Navy. It is even more so when designing a hospital ship. In addition to the typical waste...0.97 Optbrs: Corrmon rail fuellrijacllon,crude oil. Rated power generating sets 61:ili:ln()q;to~ 50Htl760rpm &.gne type -1801.\\ Vlc )l ~W.’/cyl SI;O k

  4. Ship Creek bioassessment investigations

    Energy Technology Data Exchange (ETDEWEB)

    Cushing, C.E.; Mueller, R.P.; Murphy, M.T.

    1995-06-01

    Pacific Northwest Laboratory (PNL) was asked by Elmendorf Air Force Base (EAFB) personnel to conduct a series of collections of macroinvertebrates and sediments from Ship Creek to (1) establish baseline data on these populations for reference in evaluating possible impacts from Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) activities at two operable units, (2) compare current population indices with those found by previous investigations in Ship Creek, and (3) determine baseline levels of concentrations of any contaminants in the sediments associated with the macroinvertebrates. A specific suite of indices established by the US Environmental Protection Agency (EPA) was requested for the macroinvertebrate analyses; these follow the Rapid Bioassessment Protocol developed by Plafkin et al. (1989) and will be described. Sediment sample analyses included a Microtox bioassay and chemical analysis for contaminants of concern. These analyses included, volatile organic compounds, total gasoline and diesel hydrocarbons (EPA method 8015, CA modified), total organic carbon, and an inductive-coupled plasma/mass spectrometry (ICP/MS) metals scan. Appendix A reports on the sediment analyses. The Work Plan is attached as Appendix B.

  5. ERDC Ship/Tow Simulator

    Data.gov (United States)

    Federal Laboratory Consortium — Performing Advanced Hydrodynamic ModelingEngineers and ship pilots can now overcome the challenges of evaluating navigation channel designs, modifications and safety...

  6. Present state of Japan Nuclear Ship Development Agency

    International Nuclear Information System (INIS)

    Takada, Yoshio

    1981-01-01

    The Japan Nuclear Ship Development Agency held the annual report meeting on April 8, 1981. The main contents were the plan of research and development of nuclear ships hereafter, the present state of the repair works for the nuclear ship ''Mutsu'', the progress of the selection of the new home port and others. In the last year, the function of research was given to the Agency by the revision of the related law. The full-scale repair works for Mutsu were started in August, 1980, and various equipments and shields in the containment vessel and the upper shields of the containment vessel have been removed. Subsequently, new shields are being installed. According to the report by the committee of nuclear ship research and development, the development of Mutsu, which is valuable as the experimental ship, is continued. Moreover, it is proposed to do the research and development of an improved marine nuclear plant for the purposes of securing the economic efficiency, the proving of the reliability of nuclear merchant ships, and the establishment of safety. As the home port for Mutsu, the new port will be constructed on the open sea side in Aomori Prefecture, and as a candidate, Sekine beach in Mutsu City was named. Till the completion of the new home port, Mutsu will be berthed in Ominato home port. The conditions for entering and berthing in Ominato port will be decided later. (Kako, I.)

  7. Estimation of shipping emissions in Candarli Gulf, Turkey.

    Science.gov (United States)

    Deniz, Cengiz; Kilic, Alper; Civkaroglu, Gökhan

    2010-12-01

    Ships are significant air pollution sources as their high powered main engines often use heavy fuels. The major atmospheric components emitted are nitrogen oxides, particulate matter (PM), sulfur oxide gases, carbon oxides, and toxic air pollutants. Shipping emissions cause severe impacts on health and environment. These effects of emissions are emerged especially in territorial waters, inland seas, canals, straits, bays, and port regions. Candarli Gulf is one of the major industrial regions on the Aegean side of Turkey. The marine environment of the region is affected by emissions from ships calling to ten different ports. In this study, NO( x ), SO(2), CO(2), hydrocarbons (HC), and PM emissions from 7,520 ships are estimated during the year of 2007. These emissions are classified regarding operation modes and types of ships. Annual shipping emissions are estimated as 631.2 t year(-1) for NO(x), 573.6 t year(-1) for SO(2), 33,848.9 t year(-1) for CO(2), 32.3 t year(-1) for HC, and 57.4 t year(-1) for PM.

  8. Earth-based and Galileo SSI multispectral observations of eastern mare serenitatis and the Apollo 17 landing site

    Science.gov (United States)

    Hiesinger, H.; Jaumann, R.; Neukum, G.

    1993-01-01

    Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.

  9. Incorporating higher order WINKLER springs with 3-D finite element model of a reactor building for seismic SSI analysis

    International Nuclear Information System (INIS)

    Ermutlu, H.E.

    1993-01-01

    In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained

  10. Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC

    Energy Technology Data Exchange (ETDEWEB)

    Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)

    2000-07-01

    The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)

  11. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Energy Technology Data Exchange (ETDEWEB)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.

  12. Framing student dialogue and argumentation: Content knowledge development and procedural knowing in SSI inquiry group work

    Directory of Open Access Journals (Sweden)

    Anne Kristine Byhring

    2014-10-01

    Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.

  13. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    International Nuclear Information System (INIS)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches

  14. The final Galileo SSI observations of Io: Orbits G28-I33

    Science.gov (United States)

    Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.

    2004-01-01

    We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.

  15. Identification and quantification of shipping emissions in Bohai Rim, China

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Fan [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Chen, Yingjun, E-mail: yjchen@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Tian, Chongguo, E-mail: cgtian@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Wang, Xiaoping [University of Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou, Guangdong 510640 (China); Huang, Guopei; Fang, Yin; Zong, Zheng [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

    2014-11-01

    Rapid development of port and shipbuilding industry in China has badly affected the ambient air quality of coastal zone due to shipping emissions. A total of 60 ambient air samples were collected from background site of Tuoji Island in Bohai Sea strait. The air samples were analyzed for PM{sub 2.5}, organic carbon (OC), element carbon (EC), inorganic elements, and water-soluble ions. The maximum concentration of PM{sub 2.5} was observed during spring (73.6 μg·m{sup −3}) compared to winter (39.0 μg·m{sup −3}) with mean of 54.6 μg·m{sup −3}. Back trajectory air mass analysis together with temporal distribution of vanadium (V) showed that V could be the typical tracer of shipping emissions at Tuoji Island. Furthermore, the ratios of vanadium to nickel (V/Ni), vanadium to lead (V/Pb) and vanadium to zinc (V/Zn) also suggest shipping emissions at Tuoji Island. The annual average primary PM{sub 2.5} estimate of shipping emissions was 0.65 μg·m{sup −3} at Tuoji Island, accounting for 2.94% of the total primary PM{sub 2.5}, with a maximum of 3.16% in summer and a minimum of 2.39% in autumn. - Highlights: • Tracers of shipping emissions in coastal zone of northern China were identified. • Contributions of shipping emissions on primary PM{sub 2.5} were estimated. • Shipping emissions accounted for 2.94% of primary PM{sub 2.5} apart from fishing boats. • Impact of shipping emissions on coastal zone increased rapidly in recent years.

  16. Identification and quantification of shipping emissions in Bohai Rim, China

    International Nuclear Information System (INIS)

    Zhang, Fan; Chen, Yingjun; Tian, Chongguo; Wang, Xiaoping; Huang, Guopei; Fang, Yin; Zong, Zheng

    2014-01-01

    Rapid development of port and shipbuilding industry in China has badly affected the ambient air quality of coastal zone due to shipping emissions. A total of 60 ambient air samples were collected from background site of Tuoji Island in Bohai Sea strait. The air samples were analyzed for PM 2.5 , organic carbon (OC), element carbon (EC), inorganic elements, and water-soluble ions. The maximum concentration of PM 2.5 was observed during spring (73.6 μg·m −3 ) compared to winter (39.0 μg·m −3 ) with mean of 54.6 μg·m −3 . Back trajectory air mass analysis together with temporal distribution of vanadium (V) showed that V could be the typical tracer of shipping emissions at Tuoji Island. Furthermore, the ratios of vanadium to nickel (V/Ni), vanadium to lead (V/Pb) and vanadium to zinc (V/Zn) also suggest shipping emissions at Tuoji Island. The annual average primary PM 2.5 estimate of shipping emissions was 0.65 μg·m −3 at Tuoji Island, accounting for 2.94% of the total primary PM 2.5 , with a maximum of 3.16% in summer and a minimum of 2.39% in autumn. - Highlights: • Tracers of shipping emissions in coastal zone of northern China were identified. • Contributions of shipping emissions on primary PM 2.5 were estimated. • Shipping emissions accounted for 2.94% of primary PM 2.5 apart from fishing boats. • Impact of shipping emissions on coastal zone increased rapidly in recent years

  17. On Impact Mechanics in Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship-ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived ...

  18. Luggage and shipped goods

    International Nuclear Information System (INIS)

    Vogel, H.; Haller, D.

    2007-01-01

    Summary: Purpose: Control of luggage and shipped goods are frequently carried out. The possibilities of X-ray technology shall be demonstrated. Materials and methods: There are different imaging techniques. The main concepts are transmission imaging, backscatter imaging, computed tomography, and dual energy imaging and the combination of different methods The images come from manufacturers and personal collections. Results: The search concerns mainly, weapons, explosives, and drugs; furthermore animals, and stolen goods, Special problems offer the control of letters and the detection of Improvised Explosive Devices (IED). Conclusion: One has to expect that controls will increase and that imaging with X-rays will have their part. Pattern recognition software will be used for analysis enforced by economy and by demand for higher efficiency - man and computer will produce more security than man alone

  19. Global Shipping Game

    Science.gov (United States)

    2011-01-28

    information please contact the Chairman, War Gaming Department, Naval War College, 686 Cushing Road, Newport, RI 02841 or via electronic mail at... Game ……………………………………………...9 c. Overarching Research Question……………………………………………..…10 d. Subsidiary Questions…………………………………………………………...10 e ...An e -SLOC is the “cyber network that supports the global maritime trade network.” Industry Global Shipping Game Report 27 experts felt that

  20. Single liner shipping service design

    DEFF Research Database (Denmark)

    Plum, Christian Edinger Munk; Pisinger, David; Salazar-González, Juan-José

    2014-01-01

    The design of container shipping networks is an important logistics problem, involving assets and operational costs measured in billions of dollars. To guide the optimal deployment of the ships, a single vessel round trip is considered by minimizing operational costs and flowing the best paying...

  1. Towards a nuclear merchant ship

    International Nuclear Information System (INIS)

    Nicholson, R.L.R.; Llewelyn, G.I.W.; Farmer, A.A.

    1976-01-01

    The operation of nuclear merchant ships is likely to be attended by a number of constraints and requirements. Not all of these can be fully resolved until such ships come into use and the necessary experience and confidence have been acquired. But the timing of commercial introduction, if it comes about, will depend on the relative economics of nuclear versus fossil fuel propulsion, and the differences in turn depend in part on the operating costs particular to nuclear ships. A review of operation aspects is essential not only to commercial appraisal; each country whose trade may be carried in nuclear ships - whether it will build such ships or not - will have occasion to give some attention to the problems. It is an international problem and is, as noted later, being considered internationally. This paper; i) reviews some of the operational aspects as seen in the U.K.; ii) summarizes views received by the Nuclear Merchant Ship Unit (NMSU) from U.K. shipping, shipbuilding and nuclear industries on the prospects of a U.K. nuclear merchant ship. (author)

  2. Ship exhaust gas plume cooling

    NARCIS (Netherlands)

    Schleijpen, H.M.A.; Neele, P.P.

    2004-01-01

    The exhaust gas plume is an important and sometimes dominating contributor to the infrared signature of ships. Suppression of the infrared ship signatures has been studied by TNO for the Royal Netherlands Navy over considerable time. This study deals with the suppression effects, which can be

  3. Navy Hospital ships in history

    Directory of Open Access Journals (Sweden)

    Sougat Ray

    2017-01-01

    Full Text Available Hospital ships are operated by the Naval forces in or near war zones to provide medical assistance to the wounded personnel of all nationalities and not be used for any military purpose. Hospital ships possibly existed in ancient times and the Athenian Navy had a ship named Therapia. However, it was only during the 17th century that it became a common practice for the naval squadrons to be accompanied by large ships with the facilities of carrying the wounded after each engagement. In 1860, the steamships HMS Melbourne and HMS Mauritius were equipped with genuine medical facilities. They were manned by the Medical Staff Corps and provided services to the British expedition to China. During the World War I and World War II, passenger ships were converted for use as hospital ships and were started to be used on a massive scale. RMS Aquitania and HMHS Britannic were two famous examples of hospital ships used extensively. Modern US hospital ships USNS Mercy and USNS Comfort are operated by Military Sealift Command of the US Navy. Their primary mission is to provide emergency on-site care for US combatant forces deployed in war or other operations.

  4. 1977 Annual Typhoon Report

    Science.gov (United States)

    1995-01-01

    George T. McKaige, USN *CAPT Frederick P. Milwer, USAF CAPT Alan W. Hassebrock, USAF CAPT Charles P. Guard , USAF CAPT”John D. Shewchuk, USAF ENS Edward...Det 1, lWW - USAF 1977 ANNUAL TYPHOON REPORT *Departed during 1977 season FRONTCOVER: ln&a.tedphoztogzaphof a - tmJ -A.toZmb.iaZatAn o.ulh a M dtig -&A...ships provide day and night coverage in the JTWC area of responsibility. Interpretation of this satellite imagery pro- vides cyclone positions, and for

  5. TOTAL annual report 2003

    International Nuclear Information System (INIS)

    2004-01-01

    This 2003 annual report of the Group Total provides economical results and information of the society on the following topics: keys data, the corporate governance (Directors charter, board of directors, audit committee, nomination and remuneration committee, internal control procedures, compensation of directors and executive officers), the corporate social responsibility (environmental stewardship, the future of energy management, the safety enhancement, the human resources, ethics and local development), the investor relations, the management report, the upstream exploration and production, the downstream refining, marketing, trading and shipping, the chemicals and financial and legal information. (A.L.B.)

  6. Identification of Dynamically Positioned Ships

    Directory of Open Access Journals (Sweden)

    Thor I. Fossen

    1996-04-01

    Full Text Available Todays model-based dynamic positioning (DP systems require that the ship and thruster dynamics are known with some accuracy in order to use linear quadratic optical control theory. However, it is difficult to identify the mathematical model of a dynamically posititmed (DP ship since the ship is not persistently excited under DP. In addition the ship parameter estimation problem is nonlinear and multivariable with only position and thruster state measurements available for parameter estimation. The process and measurement noise must also be modeled in order to avoid parameter drift due to environmental disturbances and sensor failure. This article discusses an off-line parallel extended Kalman filter (EKF algorithm utilizing two measurement series in parallel to estimate the parameters in the DP ship model. Full-scale experiments with a supply vessel are used to demonstrate the convergence and robustness of the proposed parameter estimator.

  7. Cybersecurity Framework for Ship Industrial Control System

    OpenAIRE

    Maule, R. William; Hake, Joseph

    2016-01-01

    Ship mechanical and electrical control systems, and the communications grid through which these devices operate, are a high priority concern for Navy leadership. Ship systems use microprocessor-based controls to interface with physical objects, and Programmable Logic Controllers (PLCs) to automate ship electromechanical processes. Ship operations are completely dependent on these devices. The commercial security products upon which ships depend do not work on ICS, leaving ships vulnerable. Th...

  8. Containment of spills from ships

    International Nuclear Information System (INIS)

    Engerer, M.J.

    1992-01-01

    Oil escaping from a ship is contained within a limited area surrounding the ship by means of a flexible ring structure. The ring structure is stored in a collapsed state in a compartment extending around the ship. In response to an oil spill, the ring structure is dropped from the compartment and immediately surrounds the ship. A circular inflatable flotation section of the ring structure is charged with gas under pressure. The gas is supplied from a bottle cascade aboard the ship, through lines preconnected to the flotation section and paid out from free-wheeling reels. The flotation section supports a thin circumferential wall of predetermined height that submerges and assumes a vertical cylinder-like shape surrounding the escaping oil. The oil floats within the confines of the ring structure, and the ring structure is progressively expanded to a predetermined size selected to accommodate the total volume of oil carried by the ship. When the ring structure achieves its expanded state, pressure in the flotation section is raised to render the structure relatively rigid and resistant to collapse in response to wave action. Oil can be removed from the interior of the ring structure by recovery ships using suction lines or other conventional recovery methods. 12 figs

  9. Ships and the Sailors Inside Them

    National Research Council Canada - National Science Library

    Sims, Philip

    2004-01-01

    .... Iron shipbuilding allowed safer and healthier ships but their internal compartmentation created communication problems which were gradually solved with mechanical systems Ships developed their own...

  10. Bio-indications of sunken ships and ship wrecks

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A

    An evaluation of bottom fauna of ship-wreck sites in estuarine and coastal waters of Goa, India, revealed an exceptionally high biotic enrichment. In terms of number of species, faunal dispersion, faunal diversity, biomass and productivity, in space...

  11. SKI's and SSI's review of SKB's safety report SR-Can

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Stroemberg, Bo

    2008-03-01

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality

  12. Neutrino physics with SHIP

    CERN Document Server

    van Herwijnen, Eric

    2016-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee. It recommended that the experiment proceed further to a Comprehensive Design phase. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 POT (Protons On Target) in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c 2 . The main focus will be the physics of the so-called Hidden Portals. The sensitivity to Heavy Neutrinos will allow to probe for the first time the mass range between the kaon and the charm meson mass, and a range of couplings for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions. ντ ...

  13. Production Balance of Ship Erection

    Institute of Scientific and Technical Information of China (English)

    JIANG Ru-hong; TAN Jia-hua; LIU Cun-gen

    2008-01-01

    A network plan model of ship erection was established based on the network planning technologyand the work-package breakdown system. The load-oriented production control method was introduced to buildup a throughput diagram model thus it is possible to describe the ship erection process numerically. Based onthe digitaiized models some cases of production balance of ship erection were studied and three balance indexeswere put forward, they are the load balance rate, the input manpower balance rate and the maximum gantrycrane operating times. Such an analytic method based on the balance evaluation is the important foundationfor digitization and intelligentization of shipyard production management.

  14. Shielding calculations for ships carrying irradiated nuclear fuel

    International Nuclear Information System (INIS)

    Burstall, R.F.; Dean, M.H.

    1983-01-01

    A number of ships have been constructed to carry irradiated fuel from Japan to the UK and France, for reprocessing. About twenty transport flasks may be carried on each voyage. Permanent shielding must be provided on the ships to ensure that no member of the crew receives an annual dose rate greater than a specified limit. As the fuel is of varying type and radiation history, and as flasks of differing designs are used, many calculations are needed. There are a number of difficulties in making shielding calculations for the ships. The geometry is complex, dimensions are large, and considerable air spaces are involved. The paper considers possible methods of calculation. The line-of-sight method is chosen for most of the calculations, for both gamma radiation and neutrons. The basic data which is used in the calculations is described. As the methods of calculation are somewhat approximate, it is necessary to provide confirmation that they are sufficiently accurate. Validation has been provided in two ways. First, measurements have been made on board the ships, and these have been checked against calculation. Second, a simplified model of the flasks and ship has been set up, and calculations checked against more sophisticated methods. Results of the validation checks are presented, and it is shown that adequate accuracy is achieved. (author)

  15. Shielding calculations for ships carrying irradiated nuclear fuel

    International Nuclear Information System (INIS)

    Dean, M.H.

    1985-01-01

    A number of ships have been constructed to carry irradiated fuel from Japan to the U.K. and France, for reprocessing. About 20 transport flasks may be carried on each voyage. Permanent shielding must be provided on the ships to ensure that no member of the crew receives an annual dose greater than a specified limit. As the fuel is of varying type and radiation history, and as flasks of differing designs are used, many shielding calculations are needed. There are a number of difficulties in making shielding calculations for the ships. The geometry is complex, dimensions are large and considerable air spaces are involved. The paper considers possible methods of calculation. The line-of-sight method is chosen for most of the calculations, for both γ-radiation and neutrons. The basic data which is used in the calculations is described. As the methods of calculation are somewhat approximate, it is necessary to provide confirmation that they are sufficiently accurate. Validation has been provided in two ways. First, measurements have been made on board one of the ships, Pacific Crane, and these have been checked against calculation. Second, a simplified model of the flasks and ship has been set up, and calculations checked against more sophisticated methods. Results of the validation checks are presented, and it is shown that adequate accuracy is achieved. (author)

  16. Análise da versão espanhola do Sport Satisfaction Instrument (SSI adaptado à Educação Física Analysis of the Spanish version of the Sport Satisfaction Instrument (SSI adapted to Physical Education

    Directory of Open Access Journals (Sweden)

    Antonio Granero-Gallegos

    2013-03-01

    Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.

  17. SKI's and SSI's experiences from their participation in the siting of a final repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Westerlind, M.; Hedberg, B.

    2000-01-01

    This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)

  18. Potential risks of nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1994-07-01

    This report represents an attempt to evaluate the potential risks of nuclear ships. Firstly reasons are given why nuclear ship accidents will not lead to accidents of the magnitude of the Chernobyl accident. This is due to much lower content of radioactive material and to different reactor designs. Next a review is given of the types of accidents which have actually occurred. Of these the reactor accidents which may lead to serious consequences for the crew and the environment are considered further. These are reactivity accidents and loss of coolant accidents. In addition the long term risks of sunken nuclear ships and sea disposed reactor compartments etc. are also discussed. Based on available accident data an attempt is made to estimate the probability of serious nuclear ship accidents. (au)

  19. Occupational accidents aboard merchant ships

    DEFF Research Database (Denmark)

    Hansen, H.L.; Nielsen, D.; Frydenberg, Morten

    2002-01-01

    Objectives: To investigate the frequency, circumstances, and causes of occupational accidents aboard merchant ships in international trade, and to identify risk factors for the occurrence of occupational accidents as well as dangerous working situations where possible preventive measures may...... be initiated. Methods: The study is a historical follow up on occupational accidents among crew aboard Danish merchant ships in the period 1993–7. Data were extracted from the Danish Maritime Authority and insurance data. Exact data on time at risk were available. Results: A total of 1993 accidents were...... aboard. Relative risks for notified accidents and accidents causing permanent disability of 5% or more were calculated in a multivariate analysis including ship type, occupation, age, time on board, change of ship since last employment period, and nationality. Foreigners had a considerably lower recorded...

  20. Travelers' Health: Cruise Ship Travel

    Science.gov (United States)

    ... and territories). Zika virus was first reported in Brazil in 2015 and subsequently spread across the Caribbean ... 11. Mouchtouri VA, Rudge JW. Legionnaires’ disease in hotels and passenger ships: a systematic review of evidence, ...

  1. Ship Repair Workflow Cost Model

    National Research Council Canada - National Science Library

    McDevitt, Mike

    2003-01-01

    The effects of intermittent work patterns and funding on the costs of ship repair and maintenance were modeled for the San Diego region in 2002 for Supervisor of Shipbuilding and Repair (SUPSHIP) San Diego...

  2. The systemic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho's report for project RISCOM

    International Nuclear Information System (INIS)

    Espejo, R.; Gill, A.

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions

  3. Annual report 1977

    International Nuclear Information System (INIS)

    1978-01-01

    The GKSS (Society for the Utilization of Nuclear Energy in Shipbuilding and Nautics) gives in this annual report a comprehensive survey of the research and development efforts carried out and a survey on the organisation and its sociological position. More detailed and generally explicable presentations of selected spheres of research deal this year with solid combustible neutron poisons, water desalination systems, pollution at the Elbe-mouth, trace analysis with x-ray fluor essence, heat conduction in water and under-water systems. The research and development programme is, in comparison with previous years better understandable. The range of tasks, 'utilization of nuclear energy', especially covers projects on the field of reactor safety research which were comprised in one project and fully integrated in the reactor safety programme of the Fed. Ministry for Research and Technology. Furthermore, nuclear energy ship development and works concerning working material technology are being carried out, to a smaller extent. The project of a nuclear container ship which run over a period of 5 years, was finished in 1977. Profitability calculations show that nuclear trade ships can be used in a profitable way, when the oil price has increased three-fold. This might be the case in about 15-20 years. Further plans of the GKSS on the field of nuclear energy ship development take into account this result. The range of tasks 'utilization of the sea and the shores' was comprised in a frame programme and divided in the research, fields of environment technique, water desalination, resources, and sea technique. These works are, beside reactor safety research, the main range of works of the GKSS. (orig./HK) [de

  4. SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report

    International Nuclear Information System (INIS)

    2003-10-01

    The Repository for Radioactive Operational Waste (SFR 1) is now the object of a new review by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). One of the stipulations for operating SFR 1 was that a new assessment of the long-term performance and environmental consequences of the repository should be conducted once every 10 years by the licensee, the Swedish Nuclear Fuel and Waste Management Co (SKB). During the time that SFR 1 has been in operation, experience has been gained of operating the facility and new knowledge of long-term performance of SFR 1 has been obtained. New regulations for nuclear facilities have been promulgated since SFR 1 was taken into operation (1988). A review committee comprising employees from SKI and SSI has conducted the review of SSR 2001. This review report has resulted in the committee's evaluation of the safety of SFR 1 and is the basis of the regulatory authorities' decision concerning any amendments to the stipulations for the operation of SFR 1. However, the review has found deficiencies in the follow up of the development of design basis norms since the facility was constructed as well as deficiencies in learning from operating experience. However, the overall evaluation is that the facility is being operated in an acceptable manner from the standpoint of safety. With respect to the long-term performance of the repository, it is a deficiency that SSR 2001 does not describe how compliance with the stipulated radiation protection requirements on optimisation and use of the best available technology (BAT) is achieved during operation. In the opinion of the review committee, issues relating to occupational radiation protection are being handled satisfactorily and the operational releases of radioactive substances are very small. Safety and Radiation Protection after Closure SKB's long-term repository performance assessment contains essential updates and improvements compared with the

  5. SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results

    Directory of Open Access Journals (Sweden)

    Francesca Ceroni

    2014-11-01

    Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.

  6. [Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].

    Science.gov (United States)

    Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria

    2011-08-01

    The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.

  7. TMI-2 spent fuel shipping

    International Nuclear Information System (INIS)

    Quinn, G.J.; Burton, H.M.

    1985-01-01

    TMI-2 failed fuel will be shipped to the Idaho National Engineering Laboratory for use in the DOE Core Examination Program. The fuel debris will be loaded into three types of canisters during defueling and dry loaded into a spent fuel shipping cask. The cask design accommodates seven canisters per cask and has two separate containment vessels with ''leaktight'' seals. Shipments are expectd to begin in early 1986

  8. The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions

    Science.gov (United States)

    Li, Q.

    2016-12-01

    The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study

  9. Long-term housing subsidies and SSI/SSDI income: Creating health-promoting contexts for families experiencing housing instability with disabilities.

    Science.gov (United States)

    Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R

    2018-04-01

    Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.

  10. On impact mechanics in ship collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship–ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived ...

  11. Development of the nuclear ship MUTSU spent fuel shipping cask

    International Nuclear Information System (INIS)

    Ishizuka, M.; Umeda, M.; Nawata, Y.; Sato, H.; Honami, M.; Nomura, T.; Ohashi, M.; Higashino, A.

    1989-01-01

    After the planned trial voyage (4700 MWD/MTU) of the nuclear ship MUTSU in 1990, her spent fuel assemblies, initially made of two types of enriched UO 2 (3.2wt% and 4.4wt%), will be transferred to the reprocessing plant soon after cooling down in the ship reactor for more than one year. For transportation, the MUTSU spent fuel shipping casks will be used. Prior to transportation to the reprocessing plant, the cooled spent fuel assemblies will be removed from the reactor to the shipping casks and housed at the spent fuel storage facility on site. In designing the MUTSU spent fuel shipping cask, considerations were given to make the leak-tightness and integrity of the cask confirmable during storage. The development of the cask and the storage function demonstration test were performed by Japan Atomic Energy Research Institute (JAERI) and Mitsubishi Heavy Industries, Ltd. (MHI). One prototype cask for the storage demonstration test and licensed thirty-five casks were manufactured between 1987 and 1988

  12. Total Analysis System for Ship Structural Strength

    OpenAIRE

    Takuya, Yoneya; Hiroyuki, Kobayashi; Abdul M., Rahim; Yoshimichi, Sasaki; Masaki, Irisawa; Technical Investigation and Information Department, Research Center; Technical Investigation and Information Department, Research Center; Singapore Office; Technical Investigation and Information Department, Research Center; Technical Investigation and Information Department, Research Center

    2001-01-01

    This paper outlines a total analysis system for ship hull structures, which integrates a wide variety of analysis functions to realise practical applications of rational methods for assessing ship structural strength. It is based on direct calculation of wave-induced loads as well as three-dimensional structural analysis of an entire-ship or hold structure. Three major analysis functions of the total system are ship motion and wave load analysis, ship structural analysis and statistical analy...

  13. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    International Nuclear Information System (INIS)

    Wilmot, R.D.; Galson, D.A.; Hora, S.C.

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to

  14. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session

  15. Occupational noise exposure in small scale hand tools manufacturing (forging) industry (SSI) in Northern India.

    Science.gov (United States)

    Singh, Lakhwinder Pal; Bhardwaj, Arvind; Deepak, K K; Bedi, Raman

    2009-08-01

    Occupational noise has been recognized as hazardous for the human beings. A high noise level in forging shops is considered to lower the labour productivity and cause illness however occupational noise is being accepted as an integral part of the job. The present study has been carried out in 5 small scale hand tool forging units (SSI) of different sizes in Northern India in Punjab. Noise levels at various sections were measured. OSHA norms for hearing conservation has been incorporated which includes an exchange rate of 5 dB (A), criterion level at 90 dB (A), criterion time of 8 h, threshold level=80 dB (A), upper limit=140 dB (A) and with F/S response rate. Equivalent sound pressure level (L(eq)) has been measured in various sections of these plants. Noise at various sections like hammer section, cutting presses, punching, grinding and barrelling process was found to be >90 dB (A), which is greater than OSHA norms. A cross-sectional study on the basis of questionnaire has been carried out. The results of which revealed that 68% of the workers are not wearing ear protective equipments out of these 50% were not provided with PPE by the company. About 95% of the workers were suffering speech interference though high noise annoyance was reported by only 20%. It has been established that the maximum noise exposure is being taken by the workers as they are working more than 8h a day for six days per week. More than 90% workers are working 12 to 24 h over time per week which lead to very high noise exposure i.e. 50 to 80% per week higher than exposure time/week in USA or European countries(15, 16)).

  16. Transnucleaire's experience in ship adaptation

    International Nuclear Information System (INIS)

    Brachet, Y.; Vallette-Fontaine, M.

    2000-01-01

    Due to the application of the new IMDG regulations for the transport of radioactive material by sea, the conditions of transport of MTR spent fuel have drastically changed five years ago. In this paper, TRANSNUCLEAIRE analyses the necessary modifications to apply to existing ships in order to comply with the IMDG/INF regulations as well as with the Japanese KAISA 520 regulation. In the MTR spent fuel transport market characterized by a competitive approach, TRANSNUCLEAIRE has carried out many transports by sea in full compliance with the regulations at a price which is as close as possible to that of other industrial goods and without the need to fully dedicate the BOUGUENAIS ship to nuclear transports. Innovative ship design solutions have been implemented and accepted by different Authorities uncluding the Advisory Committee of the Japanese MOT. Due to efficient finite element calculations, benchmarked by laboratory large scale tests, high performances crushing materials have been developed in order to absorb the energy of collision between ships. These developments have led ta propose an efficient ship design complying with all the existing worldwide nuclear regulations. (author)

  17. Effect of Buffer Bow Structure in Ship-Ship Collision

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup

    2008-01-01

    tankers, the introduction of buffer bulbous bows has been proposed. Relatively soft buffer bows absorb part of the kinetic energy of the striking ship before penetrating the inner hull of the struck vessel. The purpose of the present paper is to verify the effectiveness of a prototype buffer bulbous bow......) and the forward velocity of the struck ship on the collapse mode of the bow of the striking vessel are investigated. Collapse modes, contact forces and energy absorption capabilities of the buffer bows are compared with those of conventional bows....

  18. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64); SSI:s granskning av SKB:s storregionala grundvattenmodellering foer oestra Smaaland (SKB Rapport 06-64)

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjorrn

    2007-09-15

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.

  19. EX1001 Ship Shakedown (EX1001, EM302) on NOAA Ship Okeanos Explorer in Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The ship has been alongside for repairs and leave since November, 2009. The ship shakedown cruise is scheduled to provide an opportunity for the ship to get underway...

  20. Reliability Based Ship Structural Design

    DEFF Research Database (Denmark)

    Dogliani, M.; Østergaard, C.; Parmentier, G.

    1996-01-01

    This paper deals with the development of different methods that allow the reliability-based design of ship structures to be transferred from the area of research to the systematic application in current design. It summarises the achievements of a three-year collaborative research project dealing...... with developments of models of load effects and of structural collapse adopted in reliability formulations which aim at calibrating partial safety factors for ship structural design. New probabilistic models of still-water load effects are developed both for tankers and for containerships. New results are presented...... structure of several tankers and containerships. The results of the reliability analysis were the basis for the definition of a target safety level which was used to asses the partial safety factors suitable for in a new design rules format to be adopted in modern ship structural design. Finally...

  1. Design of Crashworthy Ship Strucures

    DEFF Research Database (Denmark)

    Toernqvist, Rikard

    2003-01-01

    The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration of the str......The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration...... in collision and grounding analysis is the prediction of the onset of fracture and crack propagation in the shell plating. In simulations of accidental loading on ships it is crucial that fracture is determined correctly, as it will influence the global deformation mode and the amount of damage to the hull...

  2. On Grounding of Fast Ships

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup; Pedersen, Preben Terndrup

    1997-01-01

    The paper deals with analysis of grounding of high-speed crafts. It is the purpose to present a comprehensive mathematical model for calculation of the overall dynamic ship response during grounding. This procedure is applied to derive the motions, the time varying sectional forces and the local...... loads during grounding on plane, sloping, sandy bottoms for six different designs of fast monohull ships made from steel, aluminium or GRP sandwich materials. The results show that the effect of the hull flexibility is to reduce the overall dynamic sectional loads on the hull girder. The considered...... numerical examples also indicate that, even with impact speeds of 40 knots against a 1:10 sloping bottom, the global strength of the hull girder is not exceeded by the grounding induced loads.For the local deformation of high-speed ship hulls at the point of contact with the ground, the paper presents...

  3. Fuel exchanger for nuclear ships

    International Nuclear Information System (INIS)

    Suda, Koji; Kanbara, Takahisa; Watanabe, Masaharu.

    1984-01-01

    Purpose: To prevent enviromental contamination landing radioactive materials from the inside of a ship. Constitution: A provisional cabin having a shape covering a reactor hatch and a hatch cover is disposed on the upper deck of a ship body. A ceiling shutter is disposed to the cabin. A protection cylinder having a shutter and a filter fan is attached on the cabin. Materials to be discharged out of the ship are transported to a fuel exchange tower on land by using a crane while being contained in the protection cylinder with the shutter being closed. The protection cylinder is connected by means of a wire rope to a loop-wheel machine which disposed on the trolly of a crane. While the bellows through which the suspending wire for the discharged products passes is perforated, since the inside of the cylinder is depressurized by a filter fan, there is no air leakage through the perforation to the outside. (Ikeda, J.)

  4. Fuel exchanger for nuclear ships

    Energy Technology Data Exchange (ETDEWEB)

    Suda, Koji; Kanbara, Takahisa; Watanabe, Masaharu

    1984-11-29

    To prevent enviromental contamination by radioactive materials from the inside of a ship a provisional cabin having a shape covering a reactor hatch and a hatch cover is disposed on the upper deck of a ship body. A ceiling shutter is disposed to the cabin. A protection cylinder having a shutter and a filter fan is attached on the cabin. Materials to be discharged out of the ship are transported to a fuel exchange tower on land by using a crane while being contained in the protection cylinder with the shutter being closed. The protection cylinder is connected by means of a wire rope to a loop-wheel machine which is disposed on the trolly of a crane. While the bellows through which the suspending wire for the discharged products passes is perforated, since the inside of the cylinder is depressurized by a filter fan, there is no air leakage through the perforation to the outside.

  5. Ships - inspiring objects in architecture

    Science.gov (United States)

    Marczak, Elzbieta

    2017-10-01

    Sea-going vessels have for centuries fascinated people, not only those who happen to work at sea, but first and foremost, those who have never set foot aboard a ship. The environment in which ships operate is reminiscent of freedom and countless adventures, but also of hard and interesting maritime working life. The famous words of Pompey: “Navigare necesseest, vivere non estnecesse” (sailing is necessary, living - is not necessary), which he pronounced on a stormy sea voyage, arouse curiosity and excitement, inviting one to test the truth of this saying personally. It is often the case, however, that sea-faring remains within the realm of dreams, while the fascination with ships demonstrates itself through a transposition of naval features onto land constructions. In such cases, ship-inspired motifs bring alive dreams and yearnings as well as reflect tastes. Tourism is one of the indicators of people’s standard of living and a measure of a society’s civilisation. Maritime tourism has been developing rapidly in recent decades. A sea cruise offers an insight into life at sea. Still, most people derive their knowledge of passenger vessels and their furnishings from the mass media. Passenger vessels, also known as “floating cities,” are described as majestic and grand, while their on-board facilities as luxurious, comfortable, exclusive and inaccessible to common people on land. Freight vessels, on the other hand, are described as enormous objects which dwarf the human being into insignificance. This article presents the results of research intended to answer the following questions: what makes ships a source of inspiration for land architecture? To what extent and by what means do architects draw on ships in their design work? In what places can we find structures inspired by ships? What ships inspire architects? This article presents examples of buildings, whose design was inspired by the architecture and structural details of sea vessels. An analysis of

  6. Wind Forces on Container Ships

    DEFF Research Database (Denmark)

    Andersen, Ingrid Marie Vincent

    2012-01-01

    An investigation of the wind forces acting on a 9,000+ TEU container ship has been carried out through a series of wind tunnel tests. It was investigated how the wind forces depend on the container configuration on the deck using a 1:450 scale model and a series of appropriate container...... are presented as nondimensional coefficients. It is concluded, that the measured forces and moment depend on the container configuration on deck, and the results may provide a general idea of how the magnitude of the wind forces is affected by a given container stacking configuration on a similar container ship....

  7. Quality management in shipping companies

    Directory of Open Access Journals (Sweden)

    Đergović Dragana M.

    2017-01-01

    Full Text Available As international business becomes more competitive, companies are finding that they need to work more effectively to stay in business. Quality assurance has become very important to the majority of production and service companies with international activity. Shipping companies were also required to implement a quality management system. The huge importance of safety in maritime transport operations resulted in the International Safety Management Code (ISM Code by the International Maritime Organization. The general management system principles embodied by the maritime ISM Code and generics ISO standards, have enabled their complementary application in establishing a quality management system in shipping companies, within a safety management system as its subset.

  8. Annual report 1999-2000

    International Nuclear Information System (INIS)

    2000-01-01

    This annual report describes the duties and responsibilities of the Ship-source Oil Pollution (SOPF) Administrator of Canada, which includes investigating and assessing all claims filed against SOPF, and reviewing the activities of the the International Oil Pollution Compensation (IOPC) Fund in his capacity as leader of the Canadian delegation to the Assembly of IOPC Funds. The annual review also provides a summary of all active Canadian ship-source oil spill claims. A variety of issues and challenges facing SOPF are highlighted. Among these are the Arctic Response Strategy of the Canadian Coast Guard; port reception facilities for oily waste; illegal discharge of oily waste at sea; oil spill response regime changes; limitations of ship-owners' liability; and changes in IOPC regime and its impact on SOPF. Various visits to Canadian response organizations, and attendance by the SOPF Administrator during the year at seminars on oil spills, freshwater spills, and natural resource damage assessment are reviewed. There is also a review of SOPF financial obligations to the IOPC Fund, and a summary of expenditures incurred. Appendices contain extended summaries of the International Compensation regime, brief summaries of the meetings of the 1971 and the 1992 IOPC Fund Executive Committee and Assembly sessions, changes introduced by the 1992 protocols, and lists of contracting states to the 1992 and the 1969/1971 protocols. 6 appendices

  9. LNG demand, shipping will expand through 2010

    International Nuclear Information System (INIS)

    True, W.R.

    1998-01-01

    The 1990s, especially the middle years, have witnessed a dramatic turnaround in the growth of liquefied-natural-gas demand which has tracked equally strong natural-gas demand growth. This trend was underscored late last year by several annual studies of world LNG demand and shipping. As 1998 began, however, economic turmoil in Asian financial markets has clouded near-term prospects for LNG in particular and all energy in general. But the extent of damage to energy markets is so far unclear. A study by US-based Institute of Gas Technology, Des Plaines, IL, reveals that LNG imports worldwide have climbed nearly 8%/year since 1980 and account for 25% of all natural gas traded internationally. In the mid-1970s, the share was only 5%. In 1996, the most recent year for which complete data are available, world LNG trade rose 7.7% to a record 92 billion cu m, outpacing the overall consumption for natural gas which increased 4.7% in 1996. By 2015, says the IGT study, natural-gas use would surpass coal as the world''s second most widely used fuel, after petroleum. Much of this growth will occur in the developing countries of Asia where gas use, before the current economic crisis began, was projected to grow 8%/year through 2015. Similar trends are reflected in another study of LNG trade released at year end 1997, this from Ocean Shipping Consultants Ltd., Surrey, U.K. The study was done too early, however, to consider the effects of the financial problems roiling Asia

  10. Helicopter-Ship Qualification Testing

    NARCIS (Netherlands)

    Hoencamp, A.

    2015-01-01

    The goal of this research project is to develop a novel test methodology which can be used for optimizing cost and time efficiency of helicopter-ship qualification testing without reducing safety. For this purpose, the so-called “SHOL-X” test methodology has been established, which includes the

  11. Container for shipping dangerous material

    International Nuclear Information System (INIS)

    Blum, P.T.

    1987-01-01

    This container for shipping dangerous material is made by a cylindrical casing of austenitic stainless steel with rounded ends and walls of uniform thickness with welded joins, a tubular metal shock absorber fixed over each end of the casing, removable lugs fixed to the casing, optionally retainers for the material within the casing [fr

  12. Modeling of Ship Propulsion Performance

    DEFF Research Database (Denmark)

    Pedersen, Benjamin Pjedsted; Larsen, Jan

    2009-01-01

    Full scale measurements of the propulsion power, ship speed, wind speed and direction, sea and air temperature, from four different loading conditions has been used to train a neural network for prediction of propulsion power. The network was able to predict the propulsion power with accuracy...

  13. Lifecycle Readiness and Ship Deployment

    Science.gov (United States)

    2013-06-01

    incidence of vomiting reported on military transport ships traveling across the Atlantic to vary from 8.5% to 22.1% on three crossings. Bruner (1955...Butterworth (pp. 455-471). Bruner , J. M. (1955). Seasickness in a destroyer escort squadron. United States Armed Forces Medical Journal, 6(4), 469-490

  14. Rudder roll stabilization for ships

    NARCIS (Netherlands)

    van Amerongen, J.; van der Klugt, P.G.M.; van Nauta lemke, H.R.

    1990-01-01

    This paper describes the design of an autopilot for rudder roll stabilization for ships. This autopilot uses the rudder not only for course keeping but also for reduction of the roll. The system has a series of properties which make the controller design far from straightforward: the process has

  15. Designing Indonesian Liner Shipping Network

    Directory of Open Access Journals (Sweden)

    Armand Omar Moeis

    2017-06-01

    Full Text Available As the largest archipelago nation in the world, Indonesia’s logistics system has not shown excellence according to the parameters of logistics performance index and based on logistics costs percentages from overall GDP. This is due to the imbalances of trading on the western and eastern regions in Indonesia, which impacts the transportation systems costs to and from the eastern regions. Therefore, it is imperative to improve the competitiveness of Indonesian maritime logistics through maritime logistics network design. This research will focus on three levels of decision making in logistics network design, which include type of ships in the strategic level, shipping routes in the tactical level, and container allocation in the operational level with implementing butterfly routes in Indonesia’s logistics networking problems. Furthermore, this research will analyze the impact of Pendulum Nusantara and Sea Toll routes against the company profits and percentages of containers shipped. This research will also foresee how demand uncertainties and multi-period planning should affect decision making in designing the Indonesian Liner Shipping Network.

  16. Legal risk management in shipping

    DEFF Research Database (Denmark)

    Siig, Kristina

    The book discusses the most typical legal challenges met in the chartering, broker, agent or port management part of the shipping industry. It discusses these issues in both English and Scandinavian law and gives indications on how to best ensure your legal risk management in these parts...

  17. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64)

    International Nuclear Information System (INIS)

    Dverstorp, Bjorrn

    2007-09-01

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009

  18. SSI sensitivity studies and model improvements for the US NRC Seismic Safety Margins Research Program. Rev. 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.

    1984-10-01

    The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables

  19. Small, simple but useful: the SSI approach to a real-time system for decision making support

    International Nuclear Information System (INIS)

    Baeverstam, U.

    1993-01-01

    In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)

  20. Climate and air quality trade-offs in altering ship fuel sulfur content

    Science.gov (United States)

    Partanen, A.-I.; Laakso, A.; Schmidt, A.; Kokkola, H.; Kuokkanen, T.; Pietikäinen, J.-P.; Kerminen, V.-M.; Lehtinen, K. E. J.; Laakso, L.; Korhonen, H.

    2013-08-01

    Aerosol particles from shipping emissions both cool the climate and cause adverse health effects. The cooling effect is, however, declining because of shipping emission controls aiming to improve air quality. We used an aerosol-climate model ECHAM-HAMMOZ to test whether by altering ship fuel sulfur content, the present-day aerosol-induced cooling effect from shipping could be preserved while at the same time reducing premature mortality rates related to shipping emissions. We compared the climate and health effects of a present-day shipping emission scenario with (1) a simulation with strict emission controls in the coastal waters (ship fuel sulfur content of 0.1%) and twofold ship fuel sulfur content compared to current global average of 2.7% elsewhere; and (2) a scenario with global strict shipping emission controls (ship fuel sulfur content of 0.1% in coastal waters and 0.5% elsewhere) roughly corresponding to international agreements to be enforced by the year 2020. Scenario 1 had a slightly stronger aerosol-induced radiative flux perturbation (RFP) from shipping than the present-day scenario (-0.43 W m-2 vs. -0.39 W m-2) while reducing premature mortality from shipping by 69% (globally 34 900 deaths avoided per year). Scenario 2 decreased the RFP to -0.06 W m-2 and annual deaths by 96% (globally 48 200 deaths avoided per year) compared to present-day. A small difference in radiative effect (global mean of 0.04 W m-2) in the coastal regions between Scenario 1 and the present-day scenario imply that shipping emission regulation in the existing emission control areas should not be removed in hope of climate cooling. Our results show that the cooling effect of present-day emissions could be retained with simultaneous notable improvements in air quality, even though the shipping emissions from the open ocean clearly have a significant effect on continental air quality. However, increasing ship fuel sulfur content in the open ocean would violate existing

  1. GKSS annual report 1980

    International Nuclear Information System (INIS)

    1981-01-01

    This annual report of the GKSS-Research Centre Geesthacht GmbH contains a survey of the research- and development work done in the year of the report and a survey on the organisation and situation of the society. The R and D programme can be divided in two parts: utilization of nuclear energy; utilization of the sea and the coasts. The first part concerns tasks on the sector of reactor safety compiled to a project which is fully integrated into the programme Reactor Safety of the Federal Ministy for Research and Technology. Development of nuclear-energy propelled vessels is continued to a smaller extent than before. The NS OTTO HAHN stopped operations in 1979. In 1980 a waste-disposed concept for the nuclear waste was developed, on the basis of which the GKSS received permission to put the ship out of service. (orig./RW) [de

  2. Logistical Analysis of the Littoral Combat Ship

    National Research Council Canada - National Science Library

    Rudko, David

    2003-01-01

    The purpose of the Littoral Combat Ship (LCS) is to provide the Navy with an affordable, small, multi-mission ship capable of independent, interdependent, and integrated operations inside the littorals...

  3. Facts about Noroviruses on Cruise Ships

    Science.gov (United States)

    ... Cruise Tips for Healthy Cruising Related Resources Cruise Ship Inspection Scores & Information Inspection Scores Cruise Line Directory Green ... 800-CDC-INFO ( 1-800-232-4636 ). Cruise Ship Inspection Scores & Information Inspection Scores Cruise Line Directory Green ...

  4. New Zealand code for nuclear powered shipping

    International Nuclear Information System (INIS)

    1976-06-01

    This report recommends guidelines for the safety precautions and procedures to be implemented when New Zealand ports and approaches are used by nuclear powered merchant ships and nuclear powered naval ships

  5. International climate policy : consequences for shipping

    OpenAIRE

    Mæstad, Ottar; Evensen, Annika Jaersen; Mathiesen, Lars; Olsen, Kristian

    2000-01-01

    This report summarises the main results from the project Norwegian and international climate policy consequences for shipping. The aim of the project has been to shed light on how climate policies might affect shipping, both from the cost side and from the demand side. The project has been divided into three sub-projects, investigating the consequences of climate policies for 1. Optimal shipping operations and management 2. The competitiveness of shipping relative to land transport 3. The tra...

  6. Note from the radioprotection group's shipping service

    CERN Multimedia

    2006-01-01

    The service for the import/export of radioactive materials reminds you that shipping requests for potentially radioactive materials must be made via the EDH request form by ticking the box 'radioactive material'. All the necessary information is given on the web site: http://cern.ch/service-rp-shipping Requests not complying with the above procedure will not be taken into account. Radioactive Shipping Service http://cern.ch/service-rp-shipping Tel. 73171 Fax: 69200

  7. Real-Time Simulation of Ship-Structure and Ship-Ship Interaction

    DEFF Research Database (Denmark)

    Lindberg, Ole; Glimberg, Stefan Lemvig; Bingham, Harry B.

    2013-01-01

    , because it is simple, easy to implement and computationally efficient. Multiple many-core graphical processing units (GPUs) are used for parallel execution and the model is implemented using a combination of C/C++, CUDA and MPI. Two ship hydrodynamic cases are presented: Kriso Container Carrier at steady...

  8. Ship-to-Ship Radiocommunication Trial by Using Wireless LAN

    Directory of Open Access Journals (Sweden)

    Yasuyuki Niwa

    2015-12-01

    In a former field radiocommunication trial, omni-directional antennas were used and a few hundred kbps throughput between two ships was measured, which was not enough for our research target (over 1Mbps. In order to get faster throughput, a field radiocommunication trial was carried out again with a few types of directional antennas and RSSI (Received Signal Strength Indication and the throughput between two ships was measured simultaneously. As a result, multi-path (2-path model affected by the reflection of the sea surface was confirmed and also the characteristics of the directional antennas such as half-power angle were confirmed, but the measured throughput was fast enough to meet our expectation.

  9. Accidents on ships in the Danish International Ship register

    DEFF Research Database (Denmark)

    Ádám, Balázs; Rasmussen, Hanna Barbara

    to report accidents causing at least one day off work beyond the day of accident but the first source contains several accidents not fulfilling this criterion, too. Radio Medical is an independent service where all Danish ships may seek medical advice. The data sets were merged by identification number...... of our study is to describe trend of accidents and their contributing factors, with special focus on nationality, occurring in ships under Danish flag in the period 2010-2012. The study used two independent data sources, the Danish Maritime Authority and the Danish Radio Medical. It is mandatory...... to create a single database that has been studied by descriptive statistics and regression analysis. Findings show a stabilised number of accidents in the analysed period. The occurrence of accidents is influenced by nationality. There is a higher frequency of reported injuries found among Danish and other...

  10. 19 CFR 4.69 - Shipping articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Shipping articles. 4.69 Section 4.69 Customs... VESSELS IN FOREIGN AND DOMESTIC TRADES Foreign Clearances § 4.69 Shipping articles. No vessel of the U.S... officer, of the shipping articles agreements, including any seaman's allotment agreement, required by 46 U...

  11. 15 CFR 750.11 - Shipping tolerances.

    Science.gov (United States)

    2010-01-01

    ... in the ECCN applicable to your item reads “ $ value” or “in $ value”, there is no shipping tolerance... is no shipping tolerance with respect to the number of units. However, the value of all of your... shipping tolerance on this license because the items are controlled by an ECCN where “$ value” is the...

  12. 29 CFR 1915.162 - Ship's boilers.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's boilers. 1915.162 Section 1915.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.162 Ship's boilers. (a) Before...

  13. 27 CFR 44.187 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44... Shipping containers. Each shipping case, crate, or other container in which tobacco products, or cigarette... same containers in which they were received from the factory. (72 Stat. 1418, as amended; 26 U.S.C...

  14. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...

  15. 49 CFR 176.24 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 176.24 Section 176.24... Requirements § 176.24 Shipping papers. (a) A person may not accept a hazardous material for transportation or transport a hazardous material by vessel unless that person has received a shipping paper prepared in...

  16. 49 CFR 177.817 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 177.817 Section 177.817... Information and Regulations § 177.817 Shipping papers. (a) General requirements. A person may not accept a... received a shipping paper prepared in accordance with part 172 of this subchapter or the material is...

  17. 49 CFR 174.24 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 174.24 Section 174.24... Requirements § 174.24 Shipping papers. (a) A person may not accept a hazardous material for transportation or transport a hazardous material by rail unless that person receives a shipping paper prepared in accordance...

  18. Improving the competitiveness of green ship recycling

    NARCIS (Netherlands)

    Jain, K.P.

    2017-01-01

    The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and

  19. 46 CFR 2.10-105 - Prepayment of annual vessel inspection fees.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Prepayment of annual vessel inspection fees. 2.10-105... VESSEL INSPECTIONS Fees § 2.10-105 Prepayment of annual vessel inspection fees. (a) Vessel owners may prepay the annual vessel inspection fee for any period of not less than three years, and not more than...

  20. Pengaruh Learning Cycle–5E Berkonteks SSI Terhadap Pemahaman Hakikat Sains Pada Materi Larutan Penyangga Dan Hidrolisis Garam Siswa SMA

    Directory of Open Access Journals (Sweden)

    Eris Ratnawati

    2017-03-01

    Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis   Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam

  1. Intelligent Prediction of Ship Maneuvering

    Directory of Open Access Journals (Sweden)

    Miroslaw Lacki

    2016-09-01

    Full Text Available In this paper the author presents an idea of the intelligent ship maneuvering prediction system with the usage of neuroevolution. This may be also be seen as the ship handling system that simulates a learning process of an autonomous control unit, created with artificial neural network. The control unit observes input signals and calculates the values of required parameters of the vessel maneuvering in confined waters. In neuroevolution such units are treated as individuals in population of artificial neural networks, which through environmental sensing and evolutionary algorithms learn to perform given task efficiently. The main task of the system is to learn continuously and predict the values of a navigational parameters of the vessel after certain amount of time, regarding an influence of its environment. The result of a prediction may occur as a warning to navigator to aware him about incoming threat.

  2. Competitive Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad

    .The contributions of this thesis cover modeling, methodology, and applications.The developed methods address operational (cargo routing), tactical (speed optimization and service selection), and strategic (network design) planning problems faced by liner shipping companies. Ultimately, the proposed methods help...... take the container transportation times that can be realized in the network nor the number of transshipments into consideration. This is mainly because the optimization problem is based on other transportation networks where these constraints are not decisive to the quality of the network. Furthermore......, the problem in itself is challenging to optimize due to its size and complexity. However, the field has seen crucial progress and is mature to include handling of competitiveness in the actual design of the network.As a liner shipping network is an organic entity, which is constantly changed to reflect...

  3. Approximate Method of Calculating Forces on Rudder During Ship Sailing on a Shipping Route

    Directory of Open Access Journals (Sweden)

    K. Zelazny

    2014-09-01

    Full Text Available Service speed of a ship in real weather conditions is a basic design parameter. Forecasting of this speed at preliminary design stage is made difficult by the lack of simple but at the same accurate models of forces acting upon a ship sailing on a preset shipping route. The article presents a model for calculating forces and moment on plane rudder, useful for forecasting of ship service speed at preliminary stages of ship design.

  4. Evaluation of the Service Performance of Ships

    DEFF Research Database (Denmark)

    Andersen, Poul; Borrod, Anne-Sophie; Blanchot, Hervé

    2005-01-01

    A simple method has been established for the evaluation of the service performance of ships. Input data are easily collected daily on board and transformed to a well-defined condition that makes possible the comparison between ships, for instance, sister ships, and between different time periods...... of voyages for the same ship. The procedure has been applied to two ships that are identical, with the exception that one has a conventional propeller, whereas the other one is fitted with a high-efficiency propeller of the KAPPEL type. The results are obtained from a period of 2 years steaming for both...

  5. SKI's and SSI's joint review of SKB's safety assessment report, SR 97. Summary

    International Nuclear Information System (INIS)

    2001-01-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) has a programme for the siting of a repository for spent nuclear fuel in Swedish bedrock. In 1996, the Swedish Government decided that SKB must perform an assessment of the repository's long-term safety before undertaking the next step of the programme which entails drilling in a minimum of two municipalities (site investigations). SKB has presented such a safety assessment in SR 97 Post-closure Safety (henceforth referred to as SR 97). SR 97 is one of the documents in the comprehensive reporting that SKB must provide when it proposes sites for investigation. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) have evaluated SR 97 in terms of its purposes which are to demonstrate a methodology for safety assessment, to show that Swedish bedrock can provide a safe repository using SKB's method, to provide a basis for specifying the factors that are important for site selection and to derive preliminary requirements on the function of the engineered barriers. The authorities have reached the following conclusions: SR 97 does not indicate any conditions that would mean that geological final disposal in accordance with SKB's method would have significant deficiencies in relation to the safety and radiation protection requirements of the authorities. SR 97 contains the elements required for a comprehensive assessment of safety and radiation protection. SKB's safety assessment methodology has improved within several important areas, such as the documentation of processes and properties that can affect repository performance and the development of models for safety assessment calculations. The methodology used in SR 97 has some deficiencies, for example, the specification of future events to be described in the safety assessment. SR 97 has not, to an adequate extent, dealt with unfavourable conditions that can affect the future safety of a repository. SKB states that the

  6. The role of Swedish Radiation Protection Authority in the field of public health; SSI:s roll i folkhaelsoarbetet - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna

    2004-09-01

    The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.

  7. The role of Swedish Radiation Protection Authority in the field of public health 2008; SSI:s roll i folkhaelsoarbetet 2008 - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf

    2008-04-15

    The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures

  8. Naval Ship Database: Database Design, Implementation, and Schema

    Science.gov (United States)

    2013-09-01

    ClassId Class identifier Name Ship name Pendant Ship pendant CommissionDate Ship commission date DecommissionDate Ship decommission date; NULL if still...active FlagshipId Ship Id of the ship Figure 3: Ship table definition Table 3: Ship table example rows Id Prefix ClassId Name Pendant ...computation if required. A bridged connection will allow computation analysis to be done in Matlab and allow the processed data to be imported back

  9. First-in-human safety and immunogenicity investigations of three adjuvanted reduced dose inactivated poliovirus vaccines (IPV-Al SSI) compared to full dose IPV Vaccine SSI when given as a booster vaccination to adolescents with a history of IPV vaccination at 3, 5, 12months and 5years of age.

    Science.gov (United States)

    Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit

    2017-01-23

    There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.

  10. The Human Element and Autonomous Ships

    Directory of Open Access Journals (Sweden)

    Sauli Ahvenjärvi

    2016-09-01

    Full Text Available The autonomous ship technology has become a “hot” topic in the discussion about more efficient, environmentally friendly and safer sea transportation solutions. The time is becoming mature for the introduction of commercially sensible solutions for unmanned and fully autonomous cargo and passenger ships. Safety will be the most interesting and important aspect in this development. The utilization of the autonomous ship technology will have many effects on the safety, both positive and negative. It has been announced that the goal is to make the safety of an unmanned ship better that the safety of a manned ship. However, it must be understood that the human element will still be present when fully unmanned ships are being used. The shore-based control of a ship contains new safety aspects and an interesting question will be the interaction of manned and unmanned ships in the same traffic area. The autonomous ship technology should therefore be taken into account on the training of seafarers. Also it should not be forgotten that every single control algorithm and rule of the internal decision making logic of the autonomously navigating ship has been designed and coded by a human software engineer. Thus the human element is present also in this point of the lifetime navigation system of the autonomous ship.

  11. 46 CFR 167.05-25 - Nautical school ship.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Nautical school ship. 167.05-25 Section 167.05-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-25 Nautical school ship. The term nautical school ship means a vessel operated by or in connection with a nautical school...

  12. Translation, Assessment and Deployment of Stuttering Instruments into Different Languages: Comments Arising from Bakhtiar et al., "Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter" ["J. Fluency Disord." 35 (2010) 87-91

    Science.gov (United States)

    Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter

    2011-01-01

    Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…

  13. Development of nuclear powered ship in Japan

    International Nuclear Information System (INIS)

    Sato, Hiroshi

    1976-01-01

    The development of nuclear merchant ship in Japan was started in 1955 by the establishment of Nuclear Ship Study Group, and since then, the investigation, test and research on nuclear ships have been continued. As a result, a nuclear ocean observation and supply ship was designed for trial. Researches were carried out also in JAERI and Institute for Technical Research of Ships. Meanwhile, the nuclear icebreaker Lenin was completed in Soviet Union in 1959, the nuclear ship Savannah set out for maiden voyage in U.S. in 1962, and the construction of the nuclear ore carrier Otto Hahn was prepared in FRG. Japan Nuclear Ship Development Corp. was established in 1963, and started the design and construction of the first nuclear ship in Japan, Mutsu. The basic policy in the construction is the improvement of nuclear ship technology, the securing of safety, and the use of domestic technologies as far as possible. The progress of the design, construction and test of the Mutsu is described. Owing to the problem of radiation leak, the development of nuclear ships stagnated for a while, but the nuclear plant of the Mutsu demonstrated the expected performance in the functional test, land criticality test and zero output test, and it is expected that the bud of the independent development brought up so far can bear valuable fruit. The independent development of marine nuclear reactors should be continued by selecting the way most suitable to Japan. (Kako, I.)

  14. Environmental monitoring at the nuclear power plants and Studsvik 1992-1993. Results from measurements of radionuclide contents of environmental samples, and from random checks by SSI

    International Nuclear Information System (INIS)

    Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.

    1995-09-01

    Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs

  15. The association between Bacillus Calmette-Guérin vaccination (1331 SSI) skin reaction and subsequent scar development in infants

    DEFF Research Database (Denmark)

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica

    2017-01-01

    BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) against tuberculosis is administered intradermally, and vaccination is often followed by a scar at the injection site. Among BCG-vaccinated individuals, having a scar has been associated with lower mortality. We aimed to examine the impact...... of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...

  16. Analytical support management shipping company

    Directory of Open Access Journals (Sweden)

    S.V. Tarasenko

    2016-12-01

    Full Text Available The article to determine areas of improvement of the economic analysis of the shipping companies tested, allowing to identify the problems of organization and methods, which are as follows: lack of regulation of economic analysis, unregulated and methods of economic analysis, using methods such as coefficient method, absolute differences method relative differences groupings balance method, while as factor analysis and correlation are ignored. Proved that today the priority targets of management that should be subject to economic analysis are: analysis of the efficiency of the fleet; analysis of the efficiency of transport services; analysis of the cost of transport services and costs; analysis of the efficiency of resource use.

  17. Japan nuclear ship sea trial

    International Nuclear Information System (INIS)

    Yamazaki, Hiroshi; Kitamura, Toshikatus; Mizushima, Toshihiko

    1992-01-01

    The sea trial of the first Japan nuclear Ship 'MUTSU' was conducted from the end of October to December in 1990. The purpose of the sea trial was to verify the nuclear propulsive performances and maneuverabilities. The present report describes the results of the sea trial. These results are classified into four items: 1. Speed test and engineering performance tests 2. Maneuvering performance tests 3. Vibration tests 4. Other tests. Acceptable performances were demonstrated, as expected in the original design. The experience of the use of the Global Positioning System (GPS), which were newly adopted for the sea trial, is also reported. (author)

  18. Competitive Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad; Brouer, Berit Dangaard; Pisinger, David

    2017-01-01

    We present a solution method for the liner shipping network design problem which is a core strategic planning problem faced by container carriers. We propose the first practical algorithm which explicitly handles transshipment time limits for all demands. Individual sailing speeds at each service...... leg are used to balance sailing speed against operational costs, hence ensuring that the found network is competitive on both transit time and cost. We present a matheuristic for the problem where a MIP is used to select which ports should be inserted or removed on a route. Computational results...

  19. Competitive Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad; Brouer, Berit Dangaard; Pisinger, David

    We present a solution method for the liner shipping network design problem which is a core strategic planning problem faced by container carriers. We propose the first practical algorithm which explicitly handles transshipment time limits for all demands. Individual sailing speeds at each service...... leg are used to balance sailings speed against operational costs, hence ensuring that the found network is competitive on both transit time and cost. We present a matheuristic for the problem where a MIP is used to select which ports should be inserted or removed on a route. Computational results...

  20. Decommission of nuclear ship 'MUTSU'

    International Nuclear Information System (INIS)

    Tateyama, Takeshi

    1996-01-01

    The nuclear-powered ship 'MUTSU' was decommissioned by removing the reactor room in June 1995, which was hoisted and transported by a floating crane to a shore storage room at Sekinehama, Aomori Prefecture. This work was carried out in three stages: extraction of the spent fuel assemblies and neutron sources, dismantling of the machinery in the reactor auxiliary room, and separation and transportation of the reactor together with the secondary shielding structure and surrounding hull. IHI mainly conducted the third stage work. The separation work of the reactor room structure using a semisubmersible barge is outlined. Stress analysis and design of the reactor room for lifting work is also described. (author)

  1. TMI-2 Core Shipping Preparations

    International Nuclear Information System (INIS)

    Ball, L.J.; Barkanic, R.J.; Conaway, W.T. II; Schmoker, D. S.; Post, Roy G.

    1988-01-01

    Shipping the damaged core from the Unit 2 reactor of Three Mile Island Nuclear Power Station near Harrisburg, PA, to the Idaho National Engineering Laboratory near Idaho Falls, ID, required development and implementation of a completely new spent fuel transportation system. This paper describes of the equipment developed, the planning and activities used to implement the hard-ware-systems into the facilities, and the planning involved in making the rail shipments. It also includes a summary of recommendations resulting from this experience. (author)

  2. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    International Nuclear Information System (INIS)

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  3. Development of a nuclear ship safety philosophy

    International Nuclear Information System (INIS)

    Thompson, T.E.

    1978-01-01

    A unique safety philosophy must be recognized and accepted as an integral part of the design and operation of a nuclear ship. For the nuclear powered ship, the ultimate safety of the reactor and therefore the crew and the environment lies with the safety of the ship itself. The basis for ship safety is its ability to navigate and survive the conditions or the environment in which it may find itself. The subject of traditional ship safety is examined along with its implication for reactor protection and safety. Concepts of reactor safety are also examined. These two philosophies are combined in a manner so as to provide a sound philosophy for the safety of nuclear ships, their crews, and the environment

  4. Ship emissions and air pollution in Denmark

    DEFF Research Database (Denmark)

    Olesen, Helge Rørdam; Winther, Morten; Ellermann, Thomas

    A project has been carried out to map the contribution from ship traffic to air pollution in Denmark. A main element in the project is the establishment of a new, improved inventory of ship emissions for the waters around Denmark. The inventory makes use of the so-called AIS system, which...... continuously keeps track of ship positions. The inventory provides basis for model calculations of air quality in Denmark for the years 2007, 2011 and 2020. The study has focus on identifying the contribution from ships, and on assessing the effect of international regulations of ship pollution. A minor...... component of the study concerns the contribution to local air pollution from ships at port....

  5. On the collision protection of ships

    International Nuclear Information System (INIS)

    Jones, N.

    1976-01-01

    A brief survey of the literature extant on the collision protection of ships is presented herein. An examination of the characteristics of different energy-absorbing methods suggests that honeycomb structures provide an alternative to deck structures which are currently used to achieve the collision protection of ships. Various features of honeycomb panels are explored and a particular structural arrangement which utilizes both sides of a hull and incorporates honeycomb panels is proposed for the collision protection of a ship. (Auth.)

  6. Auxiliary facilities on nuclear ship 'MUTSU'

    International Nuclear Information System (INIS)

    Tsujimura, Shotaro; Takigami, Yoshio.

    1989-01-01

    The nuclear ship 'MUTSU' has been moored at SEKINEHAMA, MUTU City in AOMORI Prefecture and several tests and works are being carried out on the ship. The construction of the auxiliary facilities for these works on the ship was completed in safety in August 1988. After that the facilities have fulfilled their function. The outlines of design, fabrication and construction of the facilities are described in this paper. (author)

  7. MASTER OF THE SHIP, MANAGER AND INSTRUCTOR

    OpenAIRE

    Florin IORDANOAIA

    2010-01-01

    The master of the ship is the person on the board who has the qualification and the necessary certificate of competency for running a maritime transport ship. He is the one who takes the ship into administration from the ship-owner, he is the only leader, the legal and direct chief of the entire crew, being invested with authority upon all the members of the crew. The master fulfils the attributes and displays his activity according to the legal laws of his flag, of the marine regulations and...

  8. Nuclear powered freight ships - safe and reliable

    International Nuclear Information System (INIS)

    Schafstall, H.C.

    1978-12-01

    The five nuclear-powered ships built in the world so far have entered over 100 ports in 14 countries about 1000 times in 15 years, during which there were no accidents endangering the safety of a ship. However, for the expansion of freight shipping with nuclear power, comprehensive international regulations for safety requirements, responsibility etc., are necessary. Although the NEA/IAEO symposium excluded economic questions on the safety of nuclear powered ships, the trends regarding further development in individual countries became clear

  9. Shipping/Receiving and Quality Control

    Data.gov (United States)

    Federal Laboratory Consortium — Shipping receiving, quality control, large and precise inspection and CMM machines. Coordinate Measuring Machines, including "scanning" probes, optical comparators,...

  10. Potential of biofuels for shipping. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Florentinus, A.; Hamelinck, C.; Van den Bos, A.; Winkel, R.; Cuijpers, M. [Ecofys Netherlands, Utrecht (Netherlands)

    2012-01-15

    Biofuels could be one of the options to realize a lower carbon intensity in the propulsion of ships and also possibly reduce the effect of ship emissions on local air quality. Therefore, EMSA, the European Maritime Safety Agency, is evaluating if and how biofuels could be used in the shipping sector as an alternative fuel. To determine the potential of biofuels for ships, a clearer picture is needed on technical and organizational limitations of biofuels in ships, both on board of the ship as in the fuel supply chain to the ship. Economic and sustainability analysis of biofuels should be included in this picture, as well as an overview on current and potential policy measures to stimulate the use of biofuels in shipping. Ecofys has determined the potential of biofuels, based on analysis of collected data through literature review, own expertise and experiences, direct communication with EMSA, research publications, market developments based on press and other media, and consultations with relevant stakeholders in the shipping market.

  11. Note from the radioprotection group's shipping service

    CERN Multimedia

    2006-01-01

    Le service SHIPPING du groupe de radioprotection souhaite vous rappeler qu'avant toute expédition de matériel susceptible d'être radioactif, une demande de transport doit être établie par EDH en cochant la case appropriée (danger radioactif). Merci de bien vouloir prendre note des informations figurant dans le site Web: http://cern.ch/service-rp-shipping Toute demande non conforme ne sera pas prise en compte. Radioactive Shipping Service http://cern.ch/service-rp-shippingTél: 73171Fax: 69200

  12. International Standardization in the Design of "Shore to Ship" - Power Supply Systems of Ships in Port

    Science.gov (United States)

    Tarnapowicz, Dariusz; German-Galkin, Sergiej

    2018-03-01

    The decisive source of air pollution emissions in ports is the berthed ships. This is primarily caused by the work of ship's autonomous generator sets. One way of reducing the air pollution emissions in ports is the supply of ships from electricity inland system. The main problem connected with the power connection of ships to the inland network is caused by different values of levels and frequencies of voltages in these networks (in various countries) in relation to different values of levels and frequencies of voltages present in the ship's network. It is also important that the source power can range from a few hundred kW up to several MW. In order to realize a universal „Shore to Ship" system that allows the connection of ships to the electricity inland network, the international standardization is necessary. This article presents the current recommendations, standards and regulations for the design of „Shore to Ship" systems.

  13. Navy Ships: Turning Over Auxiliary Ship Operations to the Military Sealift Command Could Save Millions

    National Research Council Canada - National Science Library

    1997-01-01

    .... One additional multiproduct ship of a new class is currently under construction. The Navy has delegated operational control of 27 of these ships to MSC, the military's single manager for sealift, to better...

  14. Ship Technology Workshop Materials from Collaboration with Mexico to Reduce Emissions from Ships

    Science.gov (United States)

    On September 26, 2012, a ship technology seminar was held to provide Mexican stakeholders with information about some of the ship technologies needed to meet the requirements of MARPOL Annex VI and an ECA.

  15. Ship emissions and the use of current air cleaning technology: contributions to air pollution and acidification in the Baltic Sea

    Science.gov (United States)

    Claremar, Björn; Haglund, Karin; Rutgersson, Anna

    2017-10-01

    The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km × 50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for the marine environment are largely unknown

  16. Advanced ship systems condition monitoring for enhanced inspection, maintenance and decision making in ship operations

    OpenAIRE

    Lazakis, Iraklis; Dikis, Konstantinos; Michala, Anna Lito; Theotokatos, Gerasimos

    2016-01-01

    Structural and machinery failures in the day-to-day ship operations may lead to major accidents, endangering crew and\\ud passengers onboard, posing a threat to the environment, damaging the ship itself and having a great impact in terms of business\\ud losses. In this respect, this paper presents the INCASS (Inspection Capabilities for Enhanced Ship Safety) project which aims\\ud bringing an innovative solution to the ship inspection regime through the introduction of enhanced inspection of shi...

  17. Viking FellowSHIP: Norwegian hydrogen ship on the right course

    International Nuclear Information System (INIS)

    Larssen-Aas, Kari

    2006-01-01

    In the future fuel cells will change the world of shipping's economical conditions, and environmental effects from this industry. A new model of a hydrogen fuelled ship was presented at the ONS exhibition in Stavanger 2006. The technology may revolutionize the shipping industry. A brief description of the project is presented (ml)

  18. LCA-ship. Design tool for energy efficient ships. A Life Cycle Analysis Program for Ships. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Jiven, Karl; Sjoebris, Anders [MariTerm AB, Goeteborg (Sweden); Nilsson, Maria [Lund Univ. (Sweden). Stiftelsen TEM; Ellis, Joanne; Traegaardh, Peter; Nordstroem, Malin [SSPA Sweden AB, Goeteborg (Sweden)

    2004-05-01

    In order to make it easier to include aspects during ship design that will improve environmental performance, general methods for life cycle calculations and a prototype tool for LCA calculations of ships and marine transportation have been developed. The base of the life cycle analyses is a comprehensive set of life cycle data that was collected for the materials and consumables used in ship construction and vessel operations. The computer tool developed makes it possible to quickly and simply specify (and calculate) the use of consumables over the vessel's life time cycle. Special effort has been made to allow the tool to be used for different types of vessels and sea transport. The main result from the project is the computer tool LCA ship, which incorporates collected and developed life cycle data for some of the most important materials and consumables used in ships and their operation. The computer application also contains a module for propulsion power calculations and a module for defining and optimising the energy system onboard the vessel. The tool itself is described in more detail in the Computer application manual. The input to the application should, as much as possible, be the kind of information that is normally found in a shipping company concerning vessel data and vessel movements. It all starts with defining the ship to be analysed and continues with defining how the ship is used over the lifetime. The tool contains compiled and processed background information about specific materials and processes (LCA data) connected to shipping operations. The LCA data is included in the tool in a processed form. LCA data for steel will for example include the environmental load from the steel production, the process to build the steel structure of the ship, the scrapping and the recycling phase. To be able to calculate the environmental load from the use of steel the total amount of steel used over the life cycle of the ship is also needed. The

  19. Simple analytical relations for ship bow waves

    Science.gov (United States)

    Noblesse, Francis; Delhommeau, G.?Rard; Guilbaud, Michel; Hendrix, Dane; Yang, Chi

    Simple analytical relations for the bow wave generated by a ship in steady motion are given. Specifically, simple expressions that define the height of a ship bow wave, the distance between the ship stem and the crest of the bow wave, the rise of water at the stem, and the bow wave profile, explicitly and without calculations, in terms of the ship speed, draught, and waterline entrance angle, are given. Another result is a simple criterion that predicts, also directly and without calculations, when a ship in steady motion cannot generate a steady bow wave. This unsteady-flow criterion predicts that a ship with a sufficiently fine waterline, specifically with waterline entrance angle 2, may generate a steady bow wave at any speed. However, a ship with a fuller waterline (25E) can only generate a steady bow wave if the ship speed is higher than a critical speed, defined in terms of αE by a simple relation. No alternative criterion for predicting when a ship in steady motion does not generate a steady bow wave appears to exist. A simple expression for the height of an unsteady ship bow wave is also given. In spite of their remarkable simplicity, the relations for ship bow waves obtained in the study (using only rudimentary physical and mathematical considerations) are consistent with experimental measurements for a number of hull forms having non-bulbous wedge-shaped bows with small flare angle, and with the authors' measurements and observations for a rectangular flat plate towed at a yaw angle.

  20. 46 CFR 148.02-1 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 148.02-1 Section 148.02-1 Shipping... MATERIALS IN BULK Vessel Requirements § 148.02-1 Shipping papers. (a) Carriers may not accept for..., unless the hazardous materials offered for such shipment is accompanied by a shipping paper on which the...

  1. 46 CFR 151.45-7 - Shipping papers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 151.45-7 Section 151.45-7 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Operations § 151.45-7 Shipping papers. Each barge carrying... towing vessel shall either have a copy of the shipping papers for each barge in his tow or he shall make...

  2. 46 CFR 173.051 - Public nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school ships. 173.051 Section 173.051 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES PERTAINING TO VESSEL USE School Ships § 173.051 Public nautical school ships. Each public nautical school...

  3. SNF shipping cask shielding analysis

    International Nuclear Information System (INIS)

    Johnson, J.O.; Pace, J.V. III.

    1996-01-01

    The Waste Management and Remedial Action Division has planned a modification sequence for storage facility 7827 in the Solid Waste Storage Area (SWSA). The modification cycle is: (1) modify an empty caisson, (2) transfer the spent nuclear fuel (SNF) of an occupied caisson to a hot cell in building 3525 for inspection and possible repackaging, and (3) return the package to the modified caisson in the SWSA. Although the SNF to be moved is in the solid form, it has different levels of activity. Thus, the following 5 shipping casks will be available for the task: the Loop Transport Carrier, the In- Pile Loop LITR HB-2 Carrier, the 6.5-inch HRLEL Carrier, the HFIR Hot Scrap Carrier, and the 10-inch ORR Experiment Removal Shield Cask. This report describes the shielding tasks for the 5 casks: determination of shielding characteristics, any streaming avenues, estimation of thermal limits, and shielding calculational uncertainty for use in the transportation plan

  4. Impact analysis of shipping casks

    International Nuclear Information System (INIS)

    Pfeiffer, P.A.; Kennedy, J.M.

    1989-01-01

    Shipping casks are being used in the United States Department of Energy to transport irradiated experiments, reactor fuel, radioactive waste, etc. One of the critical requirements in shipping cask analysis is the necessity to withstand severe impact environments. It is still conventional to develop the design and to verify the design requirements by hand calculations. Full three dimensional computations of impact scenarios have been performed but they are too expensive and time consuming for design purposes. Typically, on the order of more than an hour of CRAY time is required for a detailed, three dimensional analysis. The paper describes how simpler two- and three-dimensional models can be used to provide an intermediate level of detail between full three dimensional finite element calculations and hand calculations. The regulation that is examined here is: 10 CFR-71.73 hypothetical accident conditions, free drop. Free drop for an accident condition of a Class I package (approximate weight of 22,000 lb) is defined as a 30 foot drop onto a flat, essentially unyielding, horizontal surface, striking the surface in a position for which maximum damage is expected. Three free drop scenarios are analyzed to assess the integrity of the cask when subjected to large bending and axial stresses. These three drop scenarios are: (1) a thirty foot axial drop on either end, (2) a thirty foot oblique angle drop with the cask having several different orientations from the vertical with impact on the top end cask corner, and (3) a thirty foot side drop with simultaneous impact on the strength of the various components that comprise the cask. The predicted levels of deformation and stresses in the cask will be used to assess the potential damage level. 5 refs., 5 figs., 1 tab

  5. The mechanics of ship impacts against bridges

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    a glancing blow between the ship and the bridge structure. This model is based on rigid body mechanics and well suited for inclusion in a probabilistic analysis procedure. Finally, some empirical expressions are presented which relate the energy absorbed by crushing of ship structures to the maximum impact...

  6. Mathematical Ship Modeling for Control Applications

    DEFF Research Database (Denmark)

    Perez, Tristan; Blanke, Mogens

    2002-01-01

    In this report, we review the models for describing the motion of a ship in four degrees of freedom suitable for control applications. We present the hydrodynamic models of two ships: a container and a multi-role naval vessel. The models are based on experimental results in the four degrees...

  7. Some concepts of future nuclear ship

    International Nuclear Information System (INIS)

    Fujino, Masataka

    2000-01-01

    Characteristic features of nuclear power generation are as follows: (1) Thermal energy can be continuously extracted for a long time without fuel feed, (2) Nuclear energy is suitable for generating huge power, (3) Oxygen is unnecessary for combustion of fuel, and (4) Unlike fossil fuel, nuclear power generation does not exhaust NOx, SOx, and CO 2 : it can be considered environmentally friendly. In view of these features, the Japan Atomic Energy Research Institute commissioned the Shipbuilding Research Association of Japan (JSRA) to survey what kinds of nuclear ship would be put to practical use in the near future. For this purpose, a research committee was organized in 1992 by the JSRA, and concluded its investigation in 1996. The main aim of this research was to clarify the requirements of ship performance as nuclear ships, and then to extract the technical issues of the marine reactor installed in nuclear ships to be solved. As a result of the survey, it was suggested that displacement-type large high-speed container ship would be one of the promising future nuclear merchant ships, and 6500 m deep-sea and 600 m undersea scientific research submersibles would be other promising nuclear special purpose ships. At the same time, various requirements of marine reactors, which are expected to be installed in these ships, were clarified mainly from the technical viewpoints. (author)

  8. Detecting potential ship objects from satellite pictures

    International Nuclear Information System (INIS)

    Luo, B.; Yang, C.C.; Chang, S.K.; Yang, M.C.K.

    1984-01-01

    Heuristic techniques are presented to detect potential ship objects from satellite pictures. These techniques utilize some noise structures of the pixel gray levels, and certain inherent features of a ship in a satellite picture. The scheme has been implemented and successfully tested on SEASAT satellite pictures. A general approach for database-oriented object detection is also suggested

  9. Infrared ship signature analysis and optimisation

    NARCIS (Netherlands)

    Neele, F.P.

    2005-01-01

    The last decade has seen an increase in the awareness of the infrared signature of naval ships. New ship designs show that infrared signature reduction measures are being incorporated, such as exhaust gas cooling systems, relocation of the exhausts and surface cooling systems. Hull and

  10. India's ship recycling trade-off

    NARCIS (Netherlands)

    Worrell, E.; Athanasopoulou, V.

    2014-01-01

    The special nature of India's steel industry lends particular importance to ship recycling as a source of scrap. Ship recycling in upgraded 'green' facilities can substitute other 'dirty' ironmaking processes, resulting in energy savings and air pollutant emission reductions for the Indian steel

  11. Automatic temperature control method of shipping can

    International Nuclear Information System (INIS)

    Nishikawa, Kaoru.

    1992-01-01

    The present invention provides a method of rapidly and accurately controlling the temperature of a shipping can, which is used upon shipping inspection for a nuclear fuel assembly. That is, a measured temperature value of the shipping can is converted to a gas pressure setting value in a jacket of the shipping can by conducting a predetermined logic calculation by using a fuzzy logic. A gas pressure control section compares the pressure setting value of a fuzzy estimation section and the measured value of the gas pressure in the jacket of the shipping can, and conducts air supply or exhaustion of the jacket gas so as to adjust the measured value with the setting value. These fuzzy estimation section and gas pressure control section control the gas pressure in the jacket of the shipping can to control the water level in the jacket. As a result, the temperature of the shipping can is controlled. With such procedures, since the water level in the jacket can be controlled directly and finely, temperature of the shipping can is automatically controlled rapidly and accurately compared with a conventional case. (I.S.)

  12. Underactuated ship tracking control : theory and experiments

    NARCIS (Netherlands)

    Pettersen, K.Y.; Nijmeijer, H.

    2001-01-01

    We consider complete state tracking feedback control of a ship having two controls, namely surge force and yaw moment. The ship model has similarities with chained form systems but cannot directly be transformed in chained form. In particular, the model has a drift vector field as opposed to the

  13. Strength of Ship Plates under Combined Loading

    DEFF Research Database (Denmark)

    Cui, W.; Wang, Y.; Pedersen, Preben Terndrup

    2002-01-01

    Strength of ship plates plays a significant role in the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified analytical methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates subjec...

  14. Strength of ship plates under combined loading

    DEFF Research Database (Denmark)

    Cui, Weiching; Wang, Yongjun; Pedersen, Preben Terndrup

    2000-01-01

    Strength of ship plates plays a significant role for the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates subjected to lon...

  15. SKB annual report 1992

    International Nuclear Information System (INIS)

    1993-05-01

    This is the annual report on the activities of the Swedish Nuclear Fuel and Waste Management Co, SKB. It contains in part 1 an overview of SKB activities in different fields. Part 2 gives a description of the research and development work on nuclear waste disposal performed during 1992. Lectures and publications during 1992 as well as reports issued in the SKB technical report series are listed in part 4. Part 5 contains the summaries of all technical reports issued during 1992. SKB is the owner of CLAB, the Central Facility for Interim Storage of Spent Nuclear Fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and to the end of 1992 in total 1684 tonnes of spent fuel (measured as uranium) has been received. Transportation from the nuclear site to CLAB is made by a special ship, M/S Sigyn. At Forsmark the final repository for Radioactive Waste -SFR- was taken in operation in April 1988. At the end of 1992 a total of 11000 m 3 of waste have been deposited in SFR. The total cost for R and D during 1992 was 192.3 MSEK of which 24.8 MSEK came from participants outside Sweden. Some of the main areas for SKB research are: groundwater movements, bedrock stability, groundwater chemistry and nuclide migration, method and instruments for in situ characterization of crystalline bedrock, characterization and leaching of spent nuclear fuel, properties of bentonite for buffer, backfilling and sealing, radionuclide transport in biosphere and dose evaluations, development of performance and safety assessment methodology and assessment models, construction of an underground research laboratory. Cost calculations for the total nuclear waste management system, including decommissioning of all reactors, are updated annually. The total cost is estimated to 55 billion SEK

  16. Control mechanisms for Nordic ship emissions

    Energy Technology Data Exchange (ETDEWEB)

    Martinsen, K. [DNV, Oslo (Norway); Torvanger, A. [Cicero, Oslo (Norway)

    2013-04-15

    Shipping today operates under a complex set of international and domestic regulations. However, the environmental regulations have lagged behind those of other industries. This situation is now changing quite dramatically. The increased focus on environmental issues, combined with the growing realisation of the actual pollution burden imposed by shipping, has led to an upsurge in both international and national regulations. Some are ready and will enter into force in the near future, while others are still being developed. On behalf of the Nordic Council of Ministers DNV has carried out a study on possible control mechanisms for Nordic ship emission. The aim is to assess the baseline shipping emissions and reduction potential and the possible controlling mechanisms (both incentives and regulations) available for reducing the emissions to air from shipping within the Nordic region. (Author)

  17. Spent fuel shipping cask sealing concepts

    International Nuclear Information System (INIS)

    Sonnier, C.S.

    1989-05-01

    In late 1985, the International Atomic Energy Agency (IAEA) requested the US Program for Technical Assistance to IAEA Safeguards (POTAS) to provide a study which examined sealing concepts for application to spent fuel shipping casks. This request was approved, and assigned to Sandia National Laboratories (Sandia). In the course of this study, discussions were held with personnel in the International Safeguards Community who were familiar with the shipping casks used in their States. A number of shipping casks were examined, and discussions were held with two shipping cask manufacturers in the US. As a result of these efforts, it was concluded that the shipping casks provided an extremely good containment, and that many of the existing casks can be effectively sealed by applying the seal to the cask closure bolts/nuts

  18. The mortality effect of ship-related fine particulate matter in the Sydney greater metropolitan region of NSW, Australia.

    Science.gov (United States)

    Broome, Richard A; Cope, Martin E; Goldsworthy, Brett; Goldsworthy, Laurie; Emmerson, Kathryn; Jegasothy, Edward; Morgan, Geoffrey G

    2016-02-01

    This study investigates the mortality effect of primary and secondary PM2.5 related to ship exhaust in the Sydney greater metropolitan region of Australia. A detailed inventory of ship exhaust emissions was used to model a) the 2010/11 concentration of ship-related PM2.5 across the region, and b) the reduction in PM2.5 concentration that would occur if ships used distillate fuel with a 0.1% sulfur content at berth or within 300 km of Sydney. The annual loss of life attributable to 2010/11 levels of ship-related PM2.5 and the improvement in survival associated with use of low-sulfur fuel were estimated from the modelled concentrations. In 2010/11, approximately 1.9% of the region-wide annual average population weighted-mean concentration of all natural and human-made PM2.5 was attributable to ship exhaust, and up to 9.4% at suburbs close to ports. An estimated 220 years of life were lost by people who died in 2010/11 as a result of ship exhaust-related exposure (95% CIβ: 140-290, where CIβ is the uncertainty in the concentration-response coefficient only). Use of 0.1% sulfur fuel at berth would reduce the population weighted-mean concentration of PM2.5 related to ship exhaust by 25% and result in a gain of 390 life-years over a twenty year period (95% CIβ: 260-520). Use of 0.1% sulfur fuel within 300 km of Sydney would reduce the concentration by 56% and result in a gain of 920 life-years over twenty years (95% CIβ: 600-1200). Ship exhaust is an important source of human exposure to PM2.5 in the Sydney greater metropolitan region. This assessment supports intervention to reduce ship emissions in the GMR. Local strategies to limit the sulfur content of fuel would reduce exposure and will become increasingly beneficial as the shipping industry expands. A requirement for use of 0.1% sulfur fuel by ships within 300 km of Sydney would provide more than twice the mortality benefit of a requirement for ships to use 0.1% sulfur fuel at berth. Copyright © 2015 Elsevier

  19. SKB Annual Report 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-05-01

    This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m{sup 3} or waste. At the end of 1996 at total of 21000 m{sup 3} of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD).

  20. SKB Annual Report 1996

    International Nuclear Information System (INIS)

    1997-05-01

    This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m 3 or waste. At the end of 1996 at total of 21000 m 3 of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD)

  1. Constraints on Eurasian ship NOx emissions using OMI NO2 observations and GEOS-Chem

    Science.gov (United States)

    Vinken, Geert C. M.; Boersma, Folkert; van Donkelaar, Aaron; Zhang, Lin

    2013-04-01

    Ships emit large quantities of nitrogen oxides (NOx = NO + NO2), important precursors for ozone (O3) and particulate matter formation. Ships burn low-grade marine heavy fuel due to the limited regulations that exist for the maritime sector in international waters. Previous studies showed that global ship NOx emission inventories amount to 3.0-10.4 Tg N per year (15-30% of total NOx emissions), with most emissions close to land and affecting air quality in densely populated coastal regions. Bottom-up inventories depend on the extrapolation of a relatively small number of measurements that are often unable to capture annual emission changes and can suffer from large uncertainties. Satellites provide long-term, high-resolution retrievals that can be used to improve emission estimates. In this study we provide top-down constraints on ship NOx emissions in major European ship routes, using observed NO2 columns from the Ozone Monitoring Instrument (OMI) and NO2 columns simulated with the nested (0.5°×0.67°) version of the GEOS-Chem chemistry transport model. We use a plume-in-grid treatment of ship NOx emissions to account for in-plume chemistry in our model. We ensure consistency between the retrievals and model simulations by using the high-resolution GEOS-Chem NO2 profiles as a priori. We find evidence that ship emissions in the Mediterranean Sea are geographically misplaced by up to 150 km and biased high by a factor of 4 as compared to the most recent (EMEP) ship emission inventory. Better agreement is found over the shipping lane between Spain and the English Channel. We extend our approach and also provide constraints for major ship routes in the Red Sea and Indian Ocean. Using the full benefit of the long-term retrieval record of OMI, we present a new Eurasian ship emission inventory for the years 2005 to 2010, based on the EMEP and AMVER-ICOADS inventories, and top-down constraints from the satellite retrievals. Our work shows that satellite retrievals can

  2. NERSC 2001 Annual Report; ANNUAL

    International Nuclear Information System (INIS)

    Hules, John

    2001-01-01

    The National Energy Research Scientific Computing Center (NERSC) is the primary computational resource for scientific research funded by the DOE Office of Science. The Annual Report for FY2001 includes a summary of recent computational science conducted on NERSC systems (with abstracts of significant and representative projects); information about NERSC's current systems and services; descriptions of Berkeley Lab's current research and development projects in applied mathematics, computer science, and computational science; and a brief summary of NERSC's Strategic Plan for 2002-2005

  3. Simulation of boreal Summer Monsoon Rainfall using CFSV2_SSiB model: sensitivity to Land Use Land Cover (LULC)

    Science.gov (United States)

    Chilukoti, N.; Xue, Y.

    2016-12-01

    The land surface play a vital role in determining the surface energy budget, accurate representation of land use and land cover (LULC) is necessary to improve forecast. In this study, we have investigated the influence of surface vegetation maps with different LULC on simulating the boreal summer monsoon rainfall. Using a National Centres for Environmental Prediction (NCEP) Coupled Forecast System version 2(CFSv2) model coupled with Simplified Simple Biosphere (SSiB) model, two experiments were conducted: one with old vegetation map and one with new vegetation map. The significant differences between new and old vegetation map were in semi-arid and arid areas. For example, in old map Tibetan plateau classified as desert, which is not appropriate, while in new map it was classified as grasslands or shrubs with bare soil. Old map classified the Sahara desert as a bare soil and shrubs with bare soil, whereas in new map it was classified as bare ground. In addition to central Asia and the Sahara desert, in new vegetation map, Europe had more cropped area and India's vegetation cover was changed from crops and forests to wooded grassland and small areas of grassland and shrubs. The simulated surface air temperature with new map shows a significant improvement over Asia, South Africa, and northern America by some 1 to 2ºC and 2 to 3ºC over north east China and these are consistent with the reduced rainfall biases over Africa, near Somali coast, north east India, Bangladesh, east China sea, eastern Pacific and northern USA. Over Indian continent and bay of Bengal dry rainfall anomalies that is the only area showing large dry rainfall bias, however, they were unchanged with new map simulation. Overall the CFSv2(coupled with SSiB) model with new vegetation map show a promising result in improving the monsoon forecast by improving the Land -Atmosphere interactions. To compare with the LULC forcing, experiment was conducted using the Global Forecast System (GFS) simulations

  4. SKI's and SSI's review of SKB's safety report SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjoern; Stroemberg, Bo (and others)

    2008-03-15

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be

  5. Report on the 95th annual meeting of MSNS

    Energy Technology Data Exchange (ETDEWEB)

    1982-09-01

    Coal recovery from coal wastes, acid rain, marketing and shipping Cape Breton coal, and coal blending are discussed briefly in this account of the activities and technical sessions of the Mining Society of Nova Scotia annual meeting that was held at Ingonish Beach, June 23-26, 1982.

  6. Annual report 1994. NV Gemeenschappelijk Kolenbureau Elektriciteitsproduktiebedrijven (GVE)

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    GKE supplies coal for public generation of electricity and heating in the Netherlands. The annual report gives details of GKE's business and activities during the year including information on coal markets, shipping, coal requirements, coal sources, suppliers, contracts, logistics, coal quality, quality control, air pollution control, throughput and coal stocks and inland transportation. Financial data for the year ending 31 December 994 are included

  7. Arctic shipping emissions inventories and future scenarios

    Directory of Open Access Journals (Sweden)

    J. J. Corbett

    2010-10-01

    Full Text Available This paper presents 5 km×5 km Arctic emissions inventories of important greenhouse gases, black carbon and other pollutants under existing and future (2050 scenarios that account for growth of shipping in the region, potential diversion traffic through emerging routes, and possible emissions control measures. These high-resolution, geospatial emissions inventories for shipping can be used to evaluate Arctic climate sensitivity to black carbon (a short-lived climate forcing pollutant especially effective in accelerating the melting of ice and snow, aerosols, and gaseous emissions including carbon dioxide. We quantify ship emissions scenarios which are expected to increase as declining sea ice coverage due to climate change allows for increased shipping activity in the Arctic. A first-order calculation of global warming potential due to 2030 emissions in the high-growth scenario suggests that short-lived forcing of ~4.5 gigagrams of black carbon from Arctic shipping may increase global warming potential due to Arctic ships' CO2 emissions (~42 000 gigagrams by some 17% to 78%. The paper also presents maximum feasible reduction scenarios for black carbon in particular. These emissions reduction scenarios will enable scientists and policymakers to evaluate the efficacy and benefits of technological controls for black carbon, and other pollutants from ships.

  8. MASTER OF THE SHIP, MANAGER AND INSTRUCTOR

    Directory of Open Access Journals (Sweden)

    Florin IORDANOAIA

    2010-01-01

    Full Text Available The master of the ship is the person on the board who has the qualification and the necessary certificate of competency for running a maritime transport ship. He is the one who takes the ship into administration from the ship-owner, he is the only leader, the legal and direct chief of the entire crew, being invested with authority upon all the members of the crew. The master fulfils the attributes and displays his activity according to the legal laws of his flag, of the marine regulations and of the international conventions. In all the relationships which he establishes with physical or juridical people, the master represents the ship-owner, in a double condition, as an officer and as a commercial manager. In this paper, it is analysed the situation of the ship masters, the relationships which these masters have with the crew and the problems which appear during their voyage. At the end of the paper there are proposed measures to increase the quality of the training of the ship masters, to solve the situations connected with the members of the crew.

  9. Report of Nuclear Powered Ship Meeting

    International Nuclear Information System (INIS)

    1984-01-01

    The development of nuclear-powered ships in Japan broke down due to the radiation leak on the nuclear ship ''Mutsu'' in 1974, and the objective has not yet been attained. The Japan Nuclear Ship Research and Development Agency was reorganized to advance the development of nuclear-powered ships and to develop marine nuclear reactors. Recently, various opinions have been expressed regarding the development of nuclear-powered ships and Mutsu, accordingly, it is necessary to clarify the way it should be. The Atomic Energy Commission organized this meeting to discuss the problem. The practical use of nuclear-powered ships is expected at the beginning of the 21st century, but it is only the guess. But it is important to accumulate the technology, knowledge and experience to prepare for the use of nuclear-powered ships. The continuation of the development of Mutsu is important for the future, and the construction of the new home port is unavoidable. The aim of the research and development, and the concrete way of advancing the research and development of Mutsu are discussed. It is scheduled that the Agency is integrated with other atomic energy organizations by March, 1985. The consideration to be given for implementing the integration is described. (Kako, I.)

  10. SSI 2D/3D soil structure interaction: A program system for the calculation of structure-soil interactions using the boundary element method. Project C1

    International Nuclear Information System (INIS)

    Schmid, G.; Willms, G.; Huh, Y.; Gibhardt, M.

    1988-12-01

    SSI 2D/3D is a computer programm to calculate dynamic stiffness matrices for soil-structure-interaction problems in frequency domain. It is applicable to two- or three-dimensional situations. The present report is a detailed manual for the use of the computer code written in FORTRAN 77. In addition it gives a survey of the possibilities of the Boundary Element Method applied to dynamic problems in infinite domains. (orig.) [de

  11. The systematic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho`s report for project RISCOM

    Energy Technology Data Exchange (ETDEWEB)

    Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.

  12. Nuclear fuel shipping inspection device

    International Nuclear Information System (INIS)

    Takahashi, Toshio; Hada, Koji.

    1988-01-01

    Purpose: To provide an nuclear fuel shipping inspection device having a high detection sensitivity and capable of obtaining highly reliable inspection results. Constitution: The present invention concerns a device for distinguishing a fuel assembly having failed fuel rods in LMFBR type reactors. Coolants in a fuel assembly to be inspected are collected by a sampling pipeway and transferred to a filter device. In the filter device, granular radioactive corrosion products (CP) in the coolants are captured, to reduce the background. The coolants, after being passed through the filter device, are transferred to an FP catching device and gamma-rays of iodine and cesium nuclides are measured in FP radiation measuring device. Subsequently, the coolants transferred to a degasing device to separate rare gas FP in the coolants from the liquid phase. In a case if rare gas fission products are detected by the radiation detector, it means that there is a failed fuel rod in the fuel assembly to be inspected. Since the CP and the soluble FP are separated and extracted for the radioactivity measurement, the reliability can be improved. (Kamimura, M.)

  13. Merchant shipping (Safety Convention) Act 1977

    International Nuclear Information System (INIS)

    1977-01-01

    When this Act comes into force, it will enable the United Kingdom to ratify and to give effect to the 1974 International Convention for the Safety of Life at Sea (the SOLAS Convention) which replaces the SOLAS Convention of 1960. Under the Act, the Secretary of State may make such rules as he considers appropriate regarding ships provided with nuclear power plants in accordance with Chapter VIII of the Annex to the 1974 Convention and to Recommendations attached to it, dealing with nuclear ships, and insofar as those provisions have not been implemented by the Merchant Shipping Acts 1894 to 1974. (NEA) [fr

  14. Improving the competitiveness of green ship recycling

    OpenAIRE

    Jain, K.P.

    2017-01-01

    The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and artificial reefs. As the decision is a commercial one, the selection of a yard is predominantly based on the offer price, which depends on the location of the yard and the recycling process employed.Among...

  15. Cleaner fuels for ships provide public health benefits with climate tradeoffs.

    Science.gov (United States)

    Sofiev, Mikhail; Winebrake, James J; Johansson, Lasse; Carr, Edward W; Prank, Marje; Soares, Joana; Vira, Julius; Kouznetsov, Rostislav; Jalkanen, Jukka-Pekka; Corbett, James J

    2018-02-06

    We evaluate public health and climate impacts of low-sulphur fuels in global shipping. Using high-resolution emissions inventories, integrated atmospheric models, and health risk functions, we assess ship-related PM 2.5 pollution impacts in 2020 with and without the use of low-sulphur fuels. Cleaner marine fuels will reduce ship-related premature mortality and morbidity by 34 and 54%, respectively, representing a ~ 2.6% global reduction in PM 2.5 cardiovascular and lung cancer deaths and a ~3.6% global reduction in childhood asthma. Despite these reductions, low-sulphur marine fuels will still account for ~250k deaths and ~6.4 M childhood asthma cases annually, and more stringent standards beyond 2020 may provide additional health benefits. Lower sulphur fuels also reduce radiative cooling from ship aerosols by ~80%, equating to a ~3% increase in current estimates of total anthropogenic forcing. Therefore, stronger international shipping policies may need to achieve climate and health targets by jointly reducing greenhouse gases and air pollution.

  16. Cleaner shipping. Trade off between air pollution, costs and refinery CO2 emissions

    International Nuclear Information System (INIS)

    De Wilde, H.P.J.; Kroon, P.

    2008-05-01

    Still subject to final approval in October 2008, the International Maritime Organisation (IMO) agreed on a maximum sulphur content of 0.5% for shipping fuels in 2020. This target will induce major changes in the global refinery industry. We have estimated the impact on the Dutch refinery industry, which annually produces about 8 million tons of heavy fuel oil for sea shipping, with refinery residues as main component. It is technically possible to convert all residues, although this process will cause an additional energy use of about one million tons of crude oil and a related CO2 emission of about 4 million tons. The investment costs for these major changes in the Dutch refinery industry are estimated at about 1.5 tot 2 billion euros. The recent IMO agreement enables a gradual introduction of cleaner shipping fuels, which will reduce market disruptions and peak prices. Nevertheless, Rotterdam may not necessarily be able to develop a similar position in import, export and bunkering of future low sulphur fuels, compared to its present strong position in the market of heavy marine bunkers. Extrapolation of our national study to the global scale suggests that the deep conversion of 350 million tons of heavy fuel oil for shipping would require refinery investments in the order of 70-100 billion euros. The associated CO2 emissions would amount up to 175 Mton. The net additional CO2 emission, however, would be smaller since lighter shipping fuels result in less CO2 emissions at sea. On balance, we expect that the improvements in fuel economy, driven by the expensive low-carbon shipping fuels, will decrease CO2 emissions more than the increase in CO2 emissions from additional desulphurization in the refineries. Nevertheless CO2 emissions from sea shipping will continue to increase since marine transport is rapidly growing

  17. Annual report

    International Nuclear Information System (INIS)

    1986-01-01

    This is the thirty-ninth annual report of the Atomic Energy Control Board. The period covered by this report is the year ending March 31, 1986. The Atomic Energy Control Board (AECB) was established in 1946, by the Atomic Energy Control Act (AEC Act), (Revised Statues of Canada (R.S.C.) 1970 cA19). It is a departmental corporation (Schedule B) within the meaning and purpose of the Financial Administration Act. The AECB controls the development, application and use of atomic energy in Canada, and participates on behalf of Canada in international measures of control. The AECB is also repsonsible for the administration of the Nuclear Liability Act, (R.S.C. 1970 c29 1st Supp) as amended, including the designation of nuclear installations and the prescription of basic insurance to be carried by the operators of such nuclear installations. The AECB reports to Parliament through a designated Minister, currently the Minister of Energy, Mines and Resources

  18. Contribution of ship emissions to the concentration and deposition of air pollutants in Europe

    Directory of Open Access Journals (Sweden)

    S. Aksoyoglu

    2016-02-01

    Full Text Available Emissions from the marine transport sector are one of the least-regulated anthropogenic emission sources and contribute significantly to air pollution. Although strict limits were introduced recently for the maximum sulfur content in marine fuels in the SECAs (sulfur emission control areas and in EU ports, sulfur emissions outside the SECAs and emissions of other components in all European maritime areas have continued to increase in the last two decades. We have used the air quality model CAMx (Comprehensive Air Quality Model with Extensions with and without ship emissions for the year 2006 to determine the effects of international shipping on the annual as well as seasonal concentrations of ozone, primary and secondary components of PM2.5, and the dry and wet deposition of nitrogen and sulfur compounds in Europe. The largest changes in pollutant concentrations due to ship emissions were predicted for summer. Concentrations of particulate sulfate increased due to ship emissions in the Mediterranean (up to 60 %, the English Channel and the North Sea (30–35 %, while increases in particulate nitrate levels were found especially in the north, around the Benelux area (20 %, where there were high NH3 land-based emissions. Our model results showed that not only are the atmospheric concentrations of pollutants affected by ship emissions, but also depositions of nitrogen and sulfur compounds increase significantly along the shipping routes. NOx emissions from the ships, especially in the English Channel and the North Sea, cause a decrease in the dry deposition of reduced nitrogen at source regions by moving it from the gas phase to the particle phase which then contributes to an increase in the wet deposition at coastal areas with higher precipitation. In the western Mediterranean region, on the other hand, model results show an increase in the deposition of oxidized nitrogen (mostly HNO3 due to the ship traffic. Dry deposition of SO2 seems to

  19. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  20. Fuel exchanging machine for a nuclear ship

    International Nuclear Information System (INIS)

    Hayashi, Tetsuji.

    1984-01-01

    Purpose: To prevent atmospheric contaminations upon fuel exchange thereby keep the environmental circumstance clean in the periphery of the nuclear ship. Constitution: A nuclear reactor container is disposed to the inside of a containing vessel in the ship body and a shutter is mounted to the upper opening of the ship body. Further, a landing container having a bottom opening equipped with shutter for alingning the upper opening equipped with shuuter of the ship is elevatably suspended to the trolley of a crane by way of a wire rope and a winch, and a fuel exchange cask is elevatably disposed to the inside of the landing container. Further, airs in the inside of the container is adapted to be discharged externally through a filter by means of a blower and the inside is kept at a negative pressure. Thus, since the containing vessel is covered with the landing container upon fuel exchanging operation, atmospheric contamination can be prevented sufficiently. (Sekiya, K.)

  1. Solvency and Liquidity in Shipping Companies

    Directory of Open Access Journals (Sweden)

    Heejung Yeo

    2016-12-01

    Full Text Available This study examines factors affecting the solvency of shipping firms. The paper uses a panel dataset and employs the GLM and FGLS regression analyses. This study explores the financial structure of top 130 shipping firms provided by the Factiva database during the period between 2009 and 2013. The paper finds that liquidity is closely related to the leverage of shipping companies. The negative association between the asset liquidity and the leverage level implies that there exist conflicts of interest between managers and investors. Shipping firms have a comfortable high liquidity position, but they have a high degree of leverage. They need to take steps to reduce debts. There is evidence of heterogeneity in the determinants of leverage level. The paper also finds that the variables such as profitability, FSIZE, FAGE influence differently the leverage level whether the debt is short-term or long-term.

  2. Review of ship slamming loads and responses

    Science.gov (United States)

    Wang, Shan; Guedes Soares, C.

    2017-12-01

    The paper presents an overview of studies of slamming on ship structures. This work focuses on the hull slamming, which is one of the most important types of slamming problems to be considered in the ship design process and the assessment of the ship safety. There are three main research aspects related to the hull slamming phenomenon, a) where and how often a slamming event occurs, b) slamming load prediction and c) structural response due to slamming loads. The approaches used in each aspect are reviewed and commented, together with the presentation of some typical results. The methodology, which combines the seakeeping analysis and slamming load prediction, is discussed for the global analysis of the hull slamming of a ship in waves. Some physical phenomena during the slamming event are discussed also. Recommendations for the future research and developments are made.

  3. Dynamic Escape Routes for Naval Ships

    National Research Council Canada - National Science Library

    Villalonga, Francisco J

    2005-01-01

    This thesis addresses the problem of optimal evacuation of a naval ship. We propose the use of a dynamic escape-route system which employs a signaling system to adapt the emergency egress process to the instigating contingency...

  4. Ship dynamics for maritime ISAR imaging.

    Energy Technology Data Exchange (ETDEWEB)

    Doerry, Armin Walter

    2008-02-01

    Demand is increasing for imaging ships at sea. Conventional SAR fails because the ships are usually in motion, both with a forward velocity, and other linear and angular motions that accompany sea travel. Because the target itself is moving, this becomes an Inverse- SAR, or ISAR problem. Developing useful ISAR techniques and algorithms is considerably aided by first understanding the nature and characteristics of ship motion. Consequently, a brief study of some principles of naval architecture sheds useful light on this problem. We attempt to do so here. Ship motions are analyzed for their impact on range-Doppler imaging using Inverse Synthetic Aperture Radar (ISAR). A framework for analysis is developed, and limitations of simple ISAR systems are discussed.

  5. Nuclear ship accidents, description and analysis

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-03-01

    In this report available information on 44 reported nuclear ship events is considered. Of these 6 deals with U.S. ships and 38 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/ explosions, sea-water leaks into the submarines and sinking of vessels are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that some of the information of which this report is based, may be of dubious nature. Consequently some of the results of the assessments made may not be correct. (au)

  6. Communication from the Radioactive Shipping Service

    CERN Multimedia

    DDGS Unit

    2011-01-01

    The radioactive materials Import/Export service reminds you that all movements of potentially radioactive material must be declared in advance. For exports, shipping requests must be made via the EDH request form, ticking the box “radioactive material”. For imports, an electronic form must be completed before the arrival of the material. Requests which do not comply with the above procedure and any unauthorized imports of radioactive material will be refused.The same applies to imports/exports of radioactive sources. All necessary information is given in the web site: http://cern.ch/service-rp-shipping Yann Donjoux / Radioactive Shipping Service Phone: +41 22 767.31.71 Fax: +41 22 766.92.00 Email: service-rp-shipping@cern.ch

  7. Ships as future floating farm systems?

    Science.gov (United States)

    Moustafa, Khaled

    2018-04-03

    Environmental and agriculture challenges such as severe drought, desertification, sprawling cities and shrinking arable lands in large regions in the world compel us to think about alternative and sustainable farming systems. Ongoing projects to build floating cities in the sea suggest that building specific ships for farming purposes (as farming ships or farming boats) would also be attainable to introduce new farming surfaces and boost food production worldwide to cope with food insecurity issues.

  8. A Nonlinear Ship Manoeuvering Model: Identification and adaptive control with experiments for a model ship

    Directory of Open Access Journals (Sweden)

    Roger Skjetne

    2004-01-01

    Full Text Available Complete nonlinear dynamic manoeuvering models of ships, with numerical values, are hard to find in the literature. This paper presents a modeling, identification, and control design where the objective is to manoeuver a ship along desired paths at different velocities. Material from a variety of references have been used to describe the ship model, its difficulties, limitations, and possible simplifications for the purpose of automatic control design. The numerical values of the parameters in the model is identified in towing tests and adaptive manoeuvering experiments for a small ship in a marine control laboratory.

  9. Ultimate Strength of Ship Hulls under Torsion

    DEFF Research Database (Denmark)

    Paik, Jeom Kee; Thayamballi, Anil K.; Pedersen, Preben Terndrup

    2001-01-01

    For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength characte......For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength...... characteristics of ships with large hatch openings. The primary aim of the present study is to investigate the ultimate strength characteristics of ship hulls with large hatch openings under torsion. Axial (warping) as well as shear stresses are normally developed for thin-walled beams with open cross sections...... subjected to torsion. A procedure for calculating these stresses is briefly described. As an illustrative example, the distribution and magnitude of warping and shear stresses for a typical container vessel hull cross section under unit torsion is calculated by the procedure. By theoretical and numerical...

  10. Ship design methodologies of preliminary design

    CERN Document Server

    Papanikolaou, Apostolos

    2014-01-01

    This book deals with ship design and in particular with methodologies of the preliminary design of ships. The book is complemented by a basic bibliography and five appendices with useful updated charts for the selection of the main dimensions and other basic characteristics of different types of ships (Appendix A), the determination of hull form  from the data of systematic hull form series (Appendix B), the detailed description of the relational method for the preliminary estimation of ship weights (Appendix C), a brief review of the historical evolution of shipbuilding science and technology from the prehistoric era to date (Appendix D) and finally a historical review of regulatory developments of ship's damage stability to date (Appendix E).  The book can be used as textbook for ship design courses or as additional reading for university or college students of naval architecture courses and related disciplines; it may also serve as a reference book for naval architects, practicing engineers of rel...

  11. Report of Nuclear Powered Ship Council

    International Nuclear Information System (INIS)

    1982-01-01

    From the forecast of energy balance in the world to 21st century, the diversification of energy supply and the technical development enabling it are necessary in Japan. The stable supply of marine fuel is important to maintain and develop the national life. At present, as the marine fuel substituting for petroleum, atomic energy is at the position nearest to practical use. In advanced countries, the basic technology required for the practical use of nuclear-powered merchant ships seems to have been established, but Japan is about 10 years behind them due to the delay of the Mutsu project. In order to maintain and improve the technical level of shipbuilders, the independent technology related to nuclear-powered ships must be established in Japan. In the economical examination of nuclear-powered ships, ice breakers and ice breaking tankers are advantageous, but in other types of ships, a number of conditions must be satisfied to be economical. The Mutsu must be operated to collect the data and experience, and the project of an improved marine prototype reactor must be decided. Also a demonstration ship must be built. The standards for the design, construction and operation of nuclear-powered ships and the public acceptance are necessary. (Kako, I.)

  12. Structural health monitoring for ship structures

    Energy Technology Data Exchange (ETDEWEB)

    Farrar, Charles [Los Alamos National Laboratory; Park, Gyuhae [Los Alamos National Laboratory; Angel, Marian [Los Alamos National Laboratory; Bement, Matthew [Los Alamos National Laboratory; Salvino, Liming [NSWC, CADEROCK

    2009-01-01

    Currently the Office of Naval Research is supporting the development of structural health monitoring (SHM) technology for U.S. Navy ship structures. This application is particularly challenging because of the physical size of these structures, the widely varying and often extreme operational and environmental conditions associated with these ships missions, lack of data from known damage conditions, limited sensing that was not designed specifically for SHM, and the management of the vast amounts of data that can be collected during a mission. This paper will first define a statistical pattern recognition paradigm for SHM by describing the four steps of (1) Operational Evaluation, (2) Data Acquisition, (3) Feature Extraction, and (4) Statistical Classification of Features as they apply to ship structures. Note that inherent in the last three steps of this process are additional tasks of data cleansing, compression, normalization and fusion. The presentation will discuss ship structure SHM challenges in the context of applying various SHM approaches to sea trials data measured on an aluminum multi-hull high-speed ship, the HSV-2 Swift. To conclude, the paper will discuss several outstanding issues that need to be addressed before SHM can make the transition from a research topic to actual field applications on ship structures and suggest approaches for addressing these issues.

  13. The Administrator's Annual Report 2000-2001

    International Nuclear Information System (INIS)

    2001-01-01

    This annual report of the Ship-Source Oil Pollution Fund (SOPF) describes the compensation regime of the Fund which may include claims for oil pollution damage; claims for costs and expenses of oil spill clean-up, including the cost of preventive measures; and claims for oil pollution damage and clean-up costs where the identity of the ship that caused the discharge cannot be established, the so-called 'mystery spills'. The main body of the report consists of descriptions of the status of oil pollution incidents brought to the attention of the Administrator. It does not include incidents which were settled directly with ship owners, hence not requiring intervention by the SOPF Administrator. The current status of recovery action by the Administrator against ship-owners is also discussed, along with the issue of port of refuge for damaged ships at sea; the continuing challenge for classification societies, and others in the marine industry to ensure construction, staffing and management of well-founded ships, so that they can be operated safely to preclude environmental damage; and international safety management principles and guidelines for the safe operation of ships and pollution prevention. Also discussed are various actions by the International Maritime Organization (IMO) to review the effectiveness and impact of the ISM code to date, the IMO's timetable for the accelerated phasing out of single hull oil tankers, the differences in handling compensation for environmental damage under the CSA (Canada Shipping Act), the IOPC (International Oil Pollution Compensation Fund) regime, and the US OPA (Oil Pollution Act). SOPF's liabilities to the International Fund, and SOPF's outreach activities during the reporting period are also discussed. A financial summary is provided. Full financial statement is said to available on request. Seven appendices contain various relevant documentation, including summaries of the proceedings of the 1971 and 1992 IOPC Fund executive

  14. Automatic production planning for the construction of complex ships

    NARCIS (Netherlands)

    Rose, C.D.

    2017-01-01

    European shipyards specialize in building complex ship types including offshore vessels, yachts, dredgers, and cruise ships. One key difference between these ships and the simple cargo ships typically built in the Far East is the amount and variety of mission-related equipment required to operate

  15. Solving the Liner Shipping Fleet Repositioning Problem with Cargo Flows

    DEFF Research Database (Denmark)

    Tierney, Kevin; Askelsdottir, Björg; Jensen, Rune Møller

    2015-01-01

    We solve a central problem in the liner shipping industry called the liner shipping fleet repositioning problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between routes in a liner shipping network. Liner carriers wish...

  16. Computational methods for more fuel-efficient ship

    NARCIS (Netherlands)

    Koren, B.

    2008-01-01

    The flow of water around a ship powered by a combustion engine is a key factor in the ship's fuel consumption. The simulation of flow patterns around ship hulls is therefore an important aspect of ship design. While lengthy computations are required for such simulations, research by Jeroen Wackers

  17. 48 CFR 1371.118 - Changes-ship repair.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Changes-ship repair. 1371.118 Section 1371.118 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.118 Changes—ship repair. Insert clause...

  18. 46 CFR 169.817 - Master to instruct ship's company.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Master to instruct ship's company. 169.817 Section 169.817 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Operations § 169.817 Master to instruct ship's company. The master shall conduct drills and give instructions as necessary to insure that al...

  19. 46 CFR 71.75-5 - Passenger Ship Safety Certificate.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 3 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 71.75-5 Section 71.75-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND... Passenger Ship Safety Certificate. (a) All vessels on an international voyage are required to have a...

  20. Modelling ship operational reliability over a mission under regular inspections

    NARCIS (Netherlands)

    Christer, A.H.; Lee, S.K.

    1997-01-01

    A ship is required to operate for a fixed mission period. Should a critical item of equipment fail at sea, the ship is subject to a costly event with potentially high risk to ship and crew. Given warning of a pending defect, the ship can try to return to port under its own power and thus attempt to

  1. 46 CFR Sec. 5 - Measures to protect ship's payrolls.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Measures to protect ship's payrolls. Sec. 5 Section 5... SHIP'S PERSONNEL Sec. 5 Measures to protect ship's payrolls. (a) General Agents are not required to consider the amount of the payroll delivered to the Master at the conclusion of a voyage in determining the...

  2. 32 CFR 700.872 - Ships and craft in drydock.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Ships and craft in drydock. 700.872 Section 700... Special Circumstances/ships in Naval Stations and Shipyards § 700.872 Ships and craft in drydock. (a) The... ship or craft, not in commission, is in a naval drydock, the provisions of this article shall apply...

  3. A building cost estimation method for inland ships

    NARCIS (Netherlands)

    Hekkenberg, R.G.

    2014-01-01

    There is very little publicly available data about the building cost of inland ships, especially for ships that have dimensions that differ significantly from those of common ships. Also, no methods to determine the building cost of inland ships are described in literature. In this paper, a method

  4. The Liner Shipping Fleet Repositioning Problem with Cargo Flows

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller

    2012-01-01

    We solve an important problem for the liner shipping industry called the Liner Shipping Fleet Repositioning Problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. Shippers wish...

  5. Development of software for handling ship's pharmacy.

    Science.gov (United States)

    Nittari, Giulio; Peretti, Alessandro; Sibilio, Fabio; Ioannidis, Nicholas; Amenta, Francesco

    2016-01-01

    Ships are required to carry a given amount of medicinal products and medications depending on the flag and the type of vessel. These medicines are stored in the so called ship's "medicine chest" or more properly - a ship pharmacy. Owing to the progress of medical sciences and to the increase in the mean age of seafarers employed on board ships, the number of pharmaceutical products and medical devices required by regulations to be carried on board ships is increasing. This may make handling of the ship's medicine chest a problem primarily on large ships sailing on intercontinental routes due to the difficulty in identifying the correspondence between medicines obtained abroad with those available at the national market. To minimise these problems a tool named Pharmacy Ship (acronym: PARSI) has been developed. The application PARSI is based on a database containing the information about medicines and medical devices required by different countries regulations. In the first application the system was standardised to comply with the Italian regulations issued on the 1st October, 2015 which entered into force on the 18 January 2016. Thanks to PARSI it was possible to standardize the inventory procedures, facilitate the work of maritime health authorities and make it easier for the crew, not professional in the field, to handle the 'medicine chest' correctly by automating the procedures for medicines management. As far as we know there are no other similar tools available at the moment. The application of the software, as well as the automation of different activities, currently carried out manually, will help manage (qualitatively and quantitatively) the ship's pharmacy. The system developed in this study has proved to be an effective tool which serves to guarantee the compliance of the ship pharmacy with regulations of the flag state in terms of medicinal products and medications. Sharing the system with the Telemedical Maritime Assistance Service may result in

  6. A Ship Cargo Hold Inspection Approach Using Laser Vision Systems

    OpenAIRE

    SHEN Yang; ZHAO Ning; LIU Haiwei; MI Chao

    2013-01-01

    Our paper represents a vision system based on the laser measurement system (LMS) for bulk ship inspection. The LMS scanner with 2-axis servo system is installed on the ship loader to build the shape of the ship. Then, a group of real-time image processing algorithms are implemented to compute the shape of the cargo hold, the inclination angle of the ship and the relative position between the ship loader and the cargo hold. Based on those computed inspection data of the ship, the ship loader c...

  7. Development of the Nuclear Ship Database. 1. Outline of the Nuclear Ship Experimental Database

    Energy Technology Data Exchange (ETDEWEB)

    Kyouya, Masahiko; Ochiai, Masa-aki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Hashidate, Kouji

    1995-03-01

    We obtained the experimental data on the effects of the ship motions and the change in load and caused by the ship operations, the waves, the winds etc., to the nuclear power plant behavior, through the Power-up Tests and Experimental Voyages of the Nuclear Ship MUTSU. Moreover, we accumulated the techniques, the knowledge and others on the Nuclear Ship development at the each stage of the N.S. MUTSU Research and Development program, such as the design stage, the construction stage, the operation stage and others. These data, techniques, knowledge and others are the assembly of the experimental data and the experiences through the design, the construction and the operation of the first nuclear ship in JAPAN. It is important to keep and pigeonhole these products of the N.S. MUTSU program in order to utilize them effectively in the research and development of the advanced marine reactor, since there is no construction plan of the nuclear ship for the present in JAPAN. We have been carrying out the development of the Nuclear Ship Database System since 1991 for the purpose of effective utilization of the N.S. MUTSU products in the design study of the advanced marine reactors. The part of the Nuclear Ship Database System on the experimental data, called Nuclear Ship Experimental Database, was already accomplished and utilized since 1993. This report describes the outline and the use of the Nuclear Ship Experimental Database.The remaining part of the database system on the documentary data, called Nuclear Ship Documentary Database, are now under development. (author).

  8. Development of the Nuclear Ship Database. 1. Outline of the Nuclear Ship Experimental Database

    International Nuclear Information System (INIS)

    Kyouya, Masahiko; Ochiai, Masa-aki; Hashidate, Kouji.

    1995-03-01

    We obtained the experimental data on the effects of the ship motions and the change in load and caused by the ship operations, the waves, the winds etc., to the nuclear power plant behavior, through the Power-up Tests and Experimental Voyages of the Nuclear Ship MUTSU. Moreover, we accumulated the techniques, the knowledge and others on the Nuclear Ship development at the each stage of the N.S. MUTSU Research and Development program, such as the design stage, the construction stage, the operation stage and others. These data, techniques, knowledge and others are the assembly of the experimental data and the experiences through the design, the construction and the operation of the first nuclear ship in JAPAN. It is important to keep and pigeonhole these products of the N.S. MUTSU program in order to utilize them effectively in the research and development of the advanced marine reactor, since there is no construction plan of the nuclear ship for the present in JAPAN. We have been carrying out the development of the Nuclear Ship Database System since 1991 for the purpose of effective utilization of the N.S. MUTSU products in the design study of the advanced marine reactors. The part of the Nuclear Ship Database System on the experimental data, called Nuclear Ship Experimental Database, was already accomplished and utilized since 1993. This report describes the outline and the use of the Nuclear Ship Experimental Database.The remaining part of the database system on the documentary data, called Nuclear Ship Documentary Database, are now under development. (author)

  9. Feasibility Study on Nuclear Propulsion Ship according to Economic Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Gil, Youngmi; Yoo, Seongjin; Oh, June; Byun, Yoonchul; Woo, Ilguk [Daewoo Shipbuilding and Marine Engineering Co., Ltd, Seoul (Korea, Republic of); Kim, Jiho; Choi, Suhn [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2013-05-15

    The use of nuclear ships has been extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, the relevant regulations need to be considered. In this study, we reviewed the nuclear ship-related regulations. In addition, economic value is one of the most important factors which should be considered in the pre-design phase. To evaluate the economics of the nuclear ship, we calculated Capital Expenditure (abbreviated as CAPEX) and Operation Expenditure (abbreviated as OPEX) for various types of ships. We reviewed the nuclear ship-related regulations and evaluated the economics of the nuclear ship compared to the diesel ship. The calculation result shows that economic feasibility of the nuclear ship depends on the oil price as well as the cost of the nuclear reactor.

  10. Analysis of ship maneuvering data from simulators

    Science.gov (United States)

    Frette, V.; Kleppe, G.; Christensen, K.

    2011-03-01

    We analyze complex manuevering histories of ships obtained from training sessions on bridge simulators. Advanced ships are used in fields like offshore oil exploration: dive support vessels, supply vessels, anchor handling vessels, tugs, cable layers, and multi-purpose vessels. Due to high demands from the operations carried out, these ships need to have very high maneuverability. This is achieved through a propulsion system with several thrusters, water jets, and rudders in addition to standard propellers. For some operations, like subsea maintenance, it is crucial that the ship accurately keeps a fixed position. Therefore, bridge systems usually incorporate equipment for Dynamic Positioning (DP). DP is a method to keep ships and semi submersible rigs in a fixed position using the propulsion systems instead of anchors. It may also be used for sailing a vessel from one position to another along a predefined route. Like an autopilot on an airplane, DP may operate without human involvement. The method relies on accurate determination of position from external reference systems like GPS, as well as a continuously adjusted mathematical model of the ship and external forces from wind, waves and currents. In a specific simulator exercise for offshore crews, a ship is to be taken up to an installation consisting of three nearby oil platforms connected by bridges (Frigg field, North Sea), where a subsea inspection is to be carried out. Due to the many degrees of freedom during maneuvering, including partly or full use of DP, the chosen routes vary significantly. In this poster we report preliminary results on representations of the complex maneuvering histories; representations that allow comparison between crew groups, and, possibly, sorting of the different strategic choices behind.

  11. The Transformation of Swedish Shipping, 1970-2010

    OpenAIRE

    Sjögren, Hans; Taro Lennerfors, Thomas; Taudal Poulsen, Rene

    2012-01-01

    Since the early 1970s, as shipping has undergone a period of structural change, Swedish shipping has rapidly declined from a position of global importance. The Swedish-controlled fleet has dwindled, and the structure of the industry itself has changed. This article explores the influence of shipping markets, shipping regulations, company strategies, maritime know-how, and financial resources on the development of Swedish shipping from 1970 to 2010. A comparison is made between, on the one han...

  12. Quarterly, Bi-annual and Annual Reports

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Quarterly, Bi-annual and Annual Reports are periodic reports issued for public release. For the deep set fishery these reports are issued quarterly and anually....

  13. Analysis of ship life cycles: the impact of economic cycles and ship inspection

    NARCIS (Netherlands)

    Bijwaard, G.E.; Knapp, S.

    2009-01-01

    Due to the shipping industry's international legal framework, there are loopholes in the system, which can increase the risk of incidents with high economic costs due to the substandard operation of vessels. This article uses duration analysis and through the creation of ship life cycles provides

  14. Ship Acquisition of Shipping Companies by Sale & Purchase Activities for Sustainable Growth: Exploratory Fuzzy-AHP Application

    Directory of Open Access Journals (Sweden)

    Keun-Sik Park

    2018-05-01

    Full Text Available Strengthening sale and purchase (S&P capacity has become a fundamental requirement for sustainable growth and corporate competitiveness in the modern shipping market. However, there is a lack of research related to S&P and its priority when shipping companies attempt to implement ship acquisition through S&P activities. To fill this gap, this paper conducts an empirical analysis to analyze priority factors during the acquisition of second-hand ships from the perspective of shipping companies. Business criteria are considered to be the most important factors in the analysis of the priority of ship acquisition and investment in shipping companies. To the best of our knowledge, this research is the first exploration covering Korean shipping companies’ ship acquisition through S&P activities. This study is expected to contribute to the better understanding of the role of S&P in ensuring the sustainability of shipping companies and to provide stakeholders with valuable insights.

  15. Risk Analysis on Ship Wreck and Container Cargo to Ship Navigation

    Directory of Open Access Journals (Sweden)

    Muhammad Badrus Zaman

    2017-03-01

    Full Text Available Wreck of a ship is an incident that must be avoided. Ship accidents are generally caused by a several cases, such as human error, natural disaster, technical errors, missed communication, poor condition of the ship, and many more. Ship wreckage have huge impact for ship navigation, environment, economics, and others. Those impact have many disadvantages for the shipowners, and also for environment. For examples the fuel spills that pollute the environment, make disturbance to sailing ship because the track for those navigation is blocked by the ship wreck and their cargo especially on shallow location (<50 m. These research will discuss the effect the container when it is floats on the sea and its interference other ships. The main objective of this study is to present a risk assessment on the environmental impact of the wreck and container cargo. Wrecks on the seabed is likely to pose a risk to passing ships. container and its contents as well as the possibility of refloat, and also their environmental risks emanating from the wreck and container cargo, such as fuels, lubricants, and chemical cargo. Variations scenario is a collision between ships that pass by floating containers. The frequency of refloating container, and the consequences of the passing ship depends on several factors, which will be the subject of research. However, because of the frequency of refloating containers is unlikely, then the risk is low and does not pose a danger to navigation. These risk assessment using risk matrix 5x5 which is the combined value of the frequency and consequences of the incident. The results of this study indicate the level of risk, whether the risk is accepted, not accepted or received by considering the costs and benefits (ALARP. To consequence, there are two parameters which energy is absorbed and the penetration occurs. The absorbed energy is divided into two, namely the energy absorbed by ship and the energy absorbed by containers. In this

  16. An assessment of simplified methods to determine damage from ship-to-ship collisions

    International Nuclear Information System (INIS)

    Parks, M.B.; Ammerman, D.J.

    1996-01-01

    Sandia National Laboratories (SNL) is studying the safety of shipping, radioactive materials (RAM) by sea, the SeaRAM project (McConnell, et al. 1995), which is sponsored by the US Department of Energy (DOE). The project is concerned with the potential effects of ship collisions and fires on onboard RAM packages. Existing methodologies are being assessed to determine their adequacy to predict the effect of ship collisions and fires on RAM packages and to estimate whether or not a given accident might lead to a release of radioactivity. The eventual goal is to develop a set of validated methods, which have been checked by comparison with test data and/or detailed finite element analyses, for predicting the consequences of ship collisions and fires. These methods could then be used to provide input for overall risk assessments of RAM sea transport. The emphasis of this paper is on methods for predicting- effects of ship collisions

  17. Radiative Forcing Over Ocean by Ship Wakes

    Science.gov (United States)

    Gatebe, Charles K.; Wilcox, E.; Poudyal, R.; Wang, J.

    2011-01-01

    Changes in surface albedo represent one of the main forcing agents that can counteract, to some extent, the positive forcing from increasing greenhouse gas concentrations. Here, we report on enhanced ocean reflectance from ship wakes over the Pacific Ocean near the California coast, where we determined, based on airborne radiation measurements that ship wakes can increase reflected sunlight by more than 100%. We assessed the importance of this increase to climate forcing, where we estimated the global radiative forcing of ship wakes to be -0.00014 plus or minus 53% Watts per square meter assuming a global distribution of 32331 ships of size of greater than or equal to 100000 gross tonnage. The forcing is smaller than the forcing of aircraft contrails (-0.007 to +0.02 Watts per square meter), but considering that the global shipping fleet has rapidly grown in the last five decades and this trend is likely to continue because of the need of more inter-continental transportation as a result of economic globalization, we argue that the radiative forcing of wakes is expected to be increasingly important especially in harbors and coastal regions.

  18. Quantitative analysis method for ship construction quality

    Directory of Open Access Journals (Sweden)

    FU Senzong

    2017-03-01

    Full Text Available The excellent performance of a ship is assured by the accurate evaluation of its construction quality. For a long time, research into the construction quality of ships has mainly focused on qualitative analysis due to a shortage of process data, which results from limited samples, varied process types and non-standardized processes. Aiming at predicting and controlling the influence of the construction process on the construction quality of ships, this article proposes a reliability quantitative analysis flow path for the ship construction process and fuzzy calculation method. Based on the process-quality factor model proposed by the Function-Oriented Quality Control (FOQC method, we combine fuzzy mathematics with the expert grading method to deduce formulations calculating the fuzzy process reliability of the ordinal connection model, series connection model and mixed connection model. The quantitative analysis method is applied in analyzing the process reliability of a ship's shaft gear box installation, which proves the applicability and effectiveness of the method. The analysis results can be a useful reference for setting key quality inspection points and optimizing key processes.

  19. Orchestrating Transnational Environmental Governance in Maritime Shipping

    DEFF Research Database (Denmark)

    Lister, Jane; Taudal Poulsen, René; Ponte, Stefano

    2015-01-01

    Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body—the Interna......Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body......—the International Maritime Organization. Drawing on original empirical evidence and archival data, we introduce a four-factor framework to investigate two main questions: why is shipping lagging in its environmental governance; and what is the potential for the International Maritime Organization to orchestrate......, and growing regulatory fragmentation and uncertainty. The paper concludes with pragmatic recommendations for the International Maritime Organization to acknowledge the regulatory difficulties and seize the opportunity to orchestrate environmental progress....

  20. Report of nuclear powered ship meeting

    International Nuclear Information System (INIS)

    Anon.

    1983-01-01

    The research and development of nuclear powered ships in Japan have been advanced centering around the Japan Nuclear Ship Development Agency established in 1963. It is regretful that the development of ''Mutsu'' is largely behind the schedule due to the radiation leak in 1974, and the expected objective has not yet been attained even today. The government decided to advance the research on the improvement of marine nuclear reactors in 1980, and this new research function was given to the Agency by changing its organization. However, recently various arguments have arisen concerning the way of the research and development of nuclear ships in Japan centering around ''Mutsu'', such as the necessity of developing nuclear ships, the enormous expenditure for the development, the aging of ''Mutsu'' more than 10 years after the construction, the introduction of nuclear ship technology from foreign countries and so on. By the end of fiscal 1984, the Agency is expected to merge with other organization related to atomic energy, therefore, it is necessary to decide the way of research and development. This meeting organized by the Atomic Energy Commission makes this report to show the way of thinking about the above arguments. (Kako, I.)

  1. Capital structure in the global shipping industry

    Directory of Open Access Journals (Sweden)

    Paun Cristian

    2016-01-01

    Full Text Available The current economic crisis emerged from a particular financial crisis that started in the United States and being rapidly propagated all over the world. It did not affect a limited region or a limited economic sector. This crisis induced significant changes in all management areas, including financial management. This study is focused on financing strategies adopted by shipping companies during the crisis, analyzing relevant factors for a specific issue - the capital structure. The research methodology proposed for this analysis on relevant factors that could explain the capital structure of shipping is OLS regression applied on selected variables derived from the financial statements of the major shipping companies. The dependent variables reflecting capital structure are book value to total liabilities ratio and book value to total debt ratio. The explanatory variables are derived from the theory of capital structure. This study empirically illustrates the relevance of the capital structure theory for the studied economic sector and is a useful tool for the shipping companies, providing relevant information about the optimal capital structure adopted by shipping companies and about factors that influence this decision during a crisis period.

  2. Ship information system: overview and research trends

    Directory of Open Access Journals (Sweden)

    Sheng Liu

    2014-09-01

    Full Text Available Ship Information Systems (SISs have been one of the main research focuses in ship design and become a multidisciplinary area. With these growing research trends, it is important to consolidate the latest knowledge and information to keep up with the research needs. In this paper, the SIS and its different forms are introduced and discussed. The beginning of this paper discusses the history and evolution of SIS. The next part of this paper focuses on different fields and research areas such as networking technology, information fusion, information decision, message display, ship control in real-time SISs. A Semi-Physical Simulation Platform (SPSIM designed for SIS research and its running effect through a new Fuzzy-PID fusion algorithm are introduced in this paper then. A brief literature survey and possible future direction concerning each topic is included.

  3. Standardized analyses of nuclear shipping containers

    International Nuclear Information System (INIS)

    Parks, C.V.; Hermann, O.W.; Petrie, L.M.; Hoffman, T.J.; Tang, J.S.; Landers, N.F.; Turner, W.D.

    1983-01-01

    This paper describes improved capabilities for analyses of nuclear fuel shipping containers within SCALE -- a modular code system for Standardized Computer Analyses for Licensing Evaluation. Criticality analysis improvements include the new KENO V, a code which contains an enhanced geometry package and a new control module which uses KENO V and allows a criticality search on optimum pitch (maximum k-effective) to be performed. The SAS2 sequence is a new shielding analysis module which couples fuel burnup, source term generation, and radial cask shielding. The SAS5 shielding sequence allows a multidimensional Monte Carlo analysis of a shipping cask with code generated biasing of the particle histories. The thermal analysis sequence (HTAS1) provides an easy-to-use tool for evaluating a shipping cask response to the accident capability of the SCALE system to provide the cask designer or evaluator with a computational system that provides the automated procedures and easy-to-understand input that leads to standarization

  4. The Two Regimes of Postwar Shipping

    DEFF Research Database (Denmark)

    Iversen, Martin Jes; Tenold, Stig

    2014-01-01

    the bargaining that accompanied the shift from the national regime to the competitive regime. Specifically, we show that the new regime primarily accommodated the interests of private actors such as shipping companies, rather than the interests of the authorities and the trade unions.......The aim of this article is to illustrate the most important changes in the regulatory framework of the shipping sector from the 1960s to 2010, and to analyse the basis for, and effects of, these changes. In order to explain how the transformation has occurred, we use two traditional maritime...... nations—Denmark and Norway—as case studies. First, we introduce the two regimes of Danish and Norwegian shipping: ‘the national regime’ from the early 1960s to the mid-1970s; and ‘the competitive regime’, which was fully established by the middle of the 1990s and still persists. Then, we briefly sketch...

  5. BALTIC CONTAINER SHIPPING MARKET GOES GLOBAL

    Directory of Open Access Journals (Sweden)

    Ernest Czermański

    2016-03-01

    Full Text Available This paper aims at summarizing the last period of the Baltic container shipping mar-ket’s development, especially after 2000. The author, taking especially into account changes that have occurred in 2010, ultimately demonstrate that through the analyzed changes, this market has become a global one - thus being shaped by global determinants influencing its further development. Author selected and analyzed some chosen, most important factors influencing future market development. Secondly, some chances and threats resulting from the described changes were presented, either for the entire market as a base for international trade of Baltic Sea Region countries, and for its actors, mainly shipping owners and operators acting as a supply side of the Baltic container market. Finally, author has tried to verify and questioned the doubts and strong concerns about the future of the Baltic container shipping, especially about the feeder services, as because there are real indications and arguments against these concern.

  6. Malaria infections in crews of Japanese ships.

    Science.gov (United States)

    Shoda, M; Shimizu, K; Nagano, M; Ishii, M

    2001-01-01

    Plasmodium falciparum malaria is the most dangerous infection for seafarers in West Africa. In December 1998, five cases of this infection occurred among Japanese seafarers in West Africa, two of them died, one on board ship, and another died five days after the admission to the hospital in Reunion island, East Africa. Six other cases of falciparum malaria infection occurred among Japanese seafarers on another ship in December 1999. Three infected persons were admitted to hospitals in Abidjan (Ivory Coast) and Point Noire (Congo). In Japan, over 100 cases of imported malaria were recorded each year during the period from 1990 to 1997, and about 40% of these cases were falciparum infections. It is not known how many of them occurred among seafarers. We estimate that at least 5% of all malaria cases in Japan are seafarers. Measures to protect crews of ships against malaria are discussed.

  7. Applicabilities of ship emission reduction methods

    Energy Technology Data Exchange (ETDEWEB)

    Guleryuz, Adem [ARGEMAN Research Group, Marine Division (Turkey)], email: ademg@argeman.org; Kilic, Alper [Istanbul Technical University, Maritime Faculty, Marine Engineering Department (Turkey)], email: enviromarineacademic@yahoo.com

    2011-07-01

    Ships, with their high consumption of fossil fuels to power their engines, are significant air polluters. Emission reduction methods therefore need to be implemented and the aim of this paper is to assess the advantages and disadvantages of each emissions reduction method. Benefits of the different methods are compared, with their disadvantages and requirements, to determine the applicability of such solutions. The methods studied herein are direct water injection, humid air motor, sea water scrubbing, diesel particulate filter, selected catalytic reduction, design of engine components, exhaust gas recirculation and engine replacement. Results of the study showed that the usefulness of each emissions reduction method depends on the particular case and that an evaluation should be carried out for each ship. This study pointed out that methods to reduce ship emissions are available but that their applicability depends on each case.

  8. Soil Surface Runoff Scheme for Improving Land-Hydrology and Surface Fluxes in Simple SiB (SSiB)

    Science.gov (United States)

    Sud, Y. C.; Mocko, David M.

    1999-01-01

    Evapotranspiration on land is hard to measure and difficult to simulate. On the scale of a GCM grid, there is large subgrid-scale variability of orography, soil moisture, and vegetation. Our hope is to be able to tune the biophysical constants of vegetation and soil parameters to get the most realistic space-averaged diurnal cycle of evaporation and its climatology. Field experiments such as First ISLSCP Field Experiment (FIFE), Boreal Ecosystem-Atmosphere Study (BOREAS), and LBA help a great deal in improving our evapotranspiration schemes. However, these improvements have to be matched with, and coupled to, consistent improvement in land-hydrology; otherwise, the runoff problems will intrinsically reflect on the soil moisture and evapotranspiration errors. Indeed, a realistic runoff simulation also ensures a reasonable evapotranspiration simulation provided the precipitation forcing is reliable. We have been working on all of the above problems to improve the simulated hydrologic cycle. Through our participation in the evaluation and intercomparison of land-models under the behest of Global Soil Wetness Project (GSWP), we identified a few problems with Simple SiB (SSIB; Xue et al., 1991) hydrology in regions of significant snowmelt. Sud and Mocko (1999) show that inclusion of a separate snowpack model, with its own energy budget and fluxes with the atmosphere aloft and soil beneath, helps to ameliorate some of the deficiencies of delayed snowmelt and excessive spring season runoff. Thus, much more realistic timing of melt water generation was simulated with the new snowpack model in the subsequent GSWP re-evaluations using 2 years of ISLSCP Initiative I forcing data for 1987 and 1988. However, we noted an overcorrection of the low meltwater infiltration of SSiB. While the improvement in snowmelt timing was found everywhere, the snowmelt infiltration has became excessive in some regions, e.g., Lena river basin. This leads to much reduced runoff in many basins as

  9. Global Loads on FRP Ship Hulls

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1997-01-01

    Fibre reinforced plastic (FRP) composites used for high-speed vessels have lower modulus of elasticity than the conventionally used steels.Therefore, for large fast ships the lowest natural frequencies of the global hull modes can be relatively low compared to the frequency of waveencounter....... As part of the NoKoS project it was decided to investigate the effect of hull flexibility on the wave-induced as well as accidental structural loads on high-speed ships.Especially it was decided to determine whether there is an upper size of FRP and aluminium mono-hulls caused by continuous wave action...

  10. Network Design Models for Container Shipping

    DEFF Research Database (Denmark)

    Reinhardt, Line Blander; Kallehauge, Brian; Nielsen, Anders Nørrelund

    This paper presents a study of the network design problem in container shipping. The paper combines the network design and fleet assignment problem into a mixed integer linear programming model minimizing the overall cost. The major contributions of this paper is that the time of a vessel route...... is included in the calculation of the capacity and that a inhomogeneous fleet is modeled. The model also includes the cost of transshipment which is one of the major cost for the shipping companies. The concept of pseudo simple routes is introduced to expand the set of feasible routes. The linearization...

  11. Code of safety for nuclear merchant ships

    International Nuclear Information System (INIS)

    1982-01-01

    The Code is in chapters, entitled: general (including general safety principles and principles of risk acceptance); design criteria and conditions; ship design, construction and equipment; nuclear steam supply system; machinery and electrical installations; radiation safety (including radiological protection design; protection of persons; dosimetry; radioactive waste management); operation (including emergency operation procedures); surveys. Appendices cover: sinking velocity calculations; seaway loads depending on service periods; safety assessment; limiting dose-equivalent rates for different areas and spaces; quality assurance programme; application of single failure criterion. Initial application of the Code is restricted to conventional types of ships propelled by nuclear propulsion plants with pressurized light water type reactors. (U.K.)

  12. Absorbed Energy in Ship Collisions and Grounding

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    is that the absorbed energy does not depend on the arrangement of the structure, the material properties, and the damage mode.The purpose of the present paper is to establish a new simple relation between the absorbed energy and the destroyed material volume, which can be used as a design tool for analysis of ship...... collisions and grounding. The developed expressions reflect the structural arrangement, the material properties and different damage patterns.The present method is validated against a large number of existing experimental results and detailed numerical simulation results. Applications to full-sale ship...

  13. Transport impacts on atmosphere and climate: Shipping

    Science.gov (United States)

    Eyring, Veronika; Isaksen, Ivar S. A.; Berntsen, Terje; Collins, William J.; Corbett, James J.; Endresen, Oyvind; Grainger, Roy G.; Moldanova, Jana; Schlager, Hans; Stevenson, David S.

    2010-12-01

    Emissions of exhaust gases and particles from oceangoing ships are a significant and growing contributor to the total emissions from the transportation sector. We present an assessment of the contribution of gaseous and particulate emissions from oceangoing shipping to anthropogenic emissions and air quality. We also assess the degradation in human health and climate change created by these emissions. Regulating ship emissions requires comprehensive knowledge of current fuel consumption and emissions, understanding of their impact on atmospheric composition and climate, and projections of potential future evolutions and mitigation options. Nearly 70% of ship emissions occur within 400 km of coastlines, causing air quality problems through the formation of ground-level ozone, sulphur emissions and particulate matter in coastal areas and harbours with heavy traffic. Furthermore, ozone and aerosol precursor emissions as well as their derivative species from ships may be transported in the atmosphere over several hundreds of kilometres, and thus contribute to air quality problems further inland, even though they are emitted at sea. In addition, ship emissions impact climate. Recent studies indicate that the cooling due to altered clouds far outweighs the warming effects from greenhouse gases such as carbon dioxide (CO 2) or ozone from shipping, overall causing a negative present-day radiative forcing (RF). Current efforts to reduce sulphur and other pollutants from shipping may modify this. However, given the short residence time of sulphate compared to CO 2, the climate response from sulphate is of the order decades while that of CO 2 is centuries. The climatic trade-off between positive and negative radiative forcing is still a topic of scientific research, but from what is currently known, a simple cancellation of global mean forcing components is potentially inappropriate and a more comprehensive assessment metric is required. The CO 2 equivalent emissions using

  14. Superconducting DC homopolar motors for ship propulsion

    Energy Technology Data Exchange (ETDEWEB)

    Heiberger, M.; Reed, M.R.; Creedon, W.P.; O' Hea, B.J. [General Atomic (United States)

    2000-07-01

    Superconducting DC homopolar motors have undergone recent advances in technology, warranting serious consideration of their use for ship propulsion. Homopolar motor propulsion is now practical because of two key technology developments: cryogen-free superconducting refrigeration and high performance motor fiber brushes. These compact motors are ideal for podded applications, where reduced drag and fuel consumption are predicted. In addition, the simple DC motor controller is more efficient and reliable compared with AC motor controllers. Military ships also benefit from increased stealth implicit in homopolar DC excitation, which also allows the option for direct hull or pod mounting. (authors)

  15. Probabilistic Damage Stability Calculations for Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    1996-01-01

    The aim of these notes is to provide background material for the present probabilistic damage stability rules fro dry cargo ships.The formulas for the damage statistics are derived and shortcomings as well as possible improvements are discussed. The advantage of the definiton of fictitious...... compartments in the formulation of a computer-based general procedure for probabilistic damaged stability assessment is shown. Some comments are given on the current state of knowledge on the ship survivability in damaged conditions. Finally, problems regarding proper account of water ingress through openings...

  16. Load and Global Response of Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    The present monograph covers wave load and global structural response for ships. It is primary written as a textbook for students with an introductionary background in naval architecture and a basic knowledge of statistics and strength of materials. The subjects are treated in details starting from...... first principles. The aim has been to derive and present the necessary theoretical framework for predicting the extreme loads and the corresponding hull girder stresses the ship may be subjected to during its operational lifetime.Although some account is given to reliabiity analysis, the present...

  17. Nuclear shipping and waste disposal cost estimates

    International Nuclear Information System (INIS)

    Hudson, C.R. II.

    1977-11-01

    Cost estimates for the shipping of spent fuel from the reactor, shipping of waste from the reprocessing plant, and disposal of reprocessing plant wastes have been made for five reactor types. The reactors considered are the light-water reactor (LWR), the mixed-oxide-fueled light-water reactor (MOX), the Canadian deuterium-uranium reactor (CANDU), the fast breeder reactor (FBR), and the high-temperature gas-cooled reactor (HTGR). In addition to the cost estimates, this report provides details on the bases and assumptions used to develop the cost estimates

  18. Time constrained liner shipping network design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad; Brouer, Berit Dangaard; Desaulniers, Guy

    2017-01-01

    We present a mathematical model and a solution method for the liner shipping network design problem. The model takes into account coordination between vessels and transit time restrictions on the cargo flow. The solution method is an improvement heuristic, where an integer program is solved...... iteratively to perform moves in a large neighborhood search. Our improvement heuristic is applicable as a real-time decision support tool for a liner shipping company. It can be used to find improvements to the network when evaluating changes in operating conditions or testing different scenarios...

  19. A numerical study on ship-ship interaction in shallow and restricted waterway

    Directory of Open Access Journals (Sweden)

    Sungwook Lee

    2015-09-01

    Full Text Available In the present study, a numerical prediction method on the hydrodynamic interaction force and moment between two ships in shallow and restricted waterway is presented. Especially, the present study proposes a methodology to overcome the limitation of the two dimensional perturbation method which is related to the moored-passing ship interaction. The validation study was performed and compared with the experiment, firstly. Afterward, in order to propose a methodology in terms with the moored-passing ship interaction, further studies were performed for the moored-passing ship case with a Reynolds Averaged Navier-Stokes (RANS calculation which is using OpenFOAM with Arbitrary Coupled Mesh Interface (ACMI technique and compared with the experiment result. Finally, the present study proposes a guide to apply the two dimensional perturbation method to the moored-passing ship interaction. In addition, it presents a possibility that the RANS calculation with ACMI can applied to the ship-ship interaction without using a overset moving grid technique.

  20. Achieving Energy Efficient Ship Operations Under Third Party Management

    DEFF Research Database (Denmark)

    Taudal Poulsen, René; Sornn-Friese, Henrik

    2015-01-01

    Profitable energy saving measures are often not fully implemented in shipping, causing energy efficiency gaps. The paper identifies energy efficiency gaps in ship operations, and explores their causes. Lack of information on energy efficiency, lack of energy training at sea and onshore and lack...... of time to produce and provide reliable energy efficiency information cause energy efficiency gaps. The paper brings together the energy efficiency and ship management literatures, demonstrating how ship management models influence energy efficiency in ship operations. Achieving energy efficiency in ship...

  1. Prototypic fabrication of TRIGA irradiated fuel shipping casks

    International Nuclear Information System (INIS)

    Kim, B.K.; Lee, Y.W.; Whang, C.K.; Lee, J.B.

    1980-01-01

    This is the safety analysis report on the prototypic fabrication of ''TRIGA Irradiated Fuel Shipping Cask'' conducted by KAERI in 1980. The results of the evaluation show that the shipping cask is in compliance with the applicable regulation for the normal conditions of transport as well as hypothetical accident conditions. The prototypic fabrication of the shipping cask (type B) was carried out for the first time in Korea after getting technical experience from fabrication of the ''TRIGA Spent Fuel Shipping Cask'' and ''the KO-RI Unit 1 surveillance capsule shipping cask'' in 1979. This report contains structural evaluation, thermal evaluation, shielding, criticality, quality assurance, and handling procedures of the shipping cask

  2. Challenges to Ship Hydrodynamics in the XXI Century

    Directory of Open Access Journals (Sweden)

    Lech Kobylinski

    2014-09-01

    Full Text Available The beginning of twenty-first century is characterized with important changes in world shipping and exploitation of ocean resources. Three important trends are clearly visible: environment protection, safety and economy. They materialize in important changes in the structure of world fleet where some existing ship types are going to disappear and new ship types emerge. Increasing the size of some ship types is another visible tendency. Stress on environment protection has serious impact on the hydrodynamic characteristics of ships whether with regard to safety zero accident rate is the goal. Important challenges to ship hydrodynamics caused by those tendencies are discussed in the paper.

  3. Chemical tracers of shipping emissions in a Mediterranean harbour

    Science.gov (United States)

    Viana, M.; Amato, F.; Alastuey, A.; Querol, X.; Román, A.; García, M.

    2009-04-01

    , 30 m3/h) at a rate of 2 samples per week for each size fraction. This resulted in 78 and 77 valid PM10 and PM2.5 samples, respectively. All samples were weighed and analysed for major and trace elements following the methodology described by Querol et al. (2004). The data collected over the annual period was analysed as a function of the wind sectors defining the main PM sources: 0-45° (open sea), 45-135° (harbour) and 135-360° (land). PM levels and chemical composition were evaluated for each of these sectors, and initial results on hourly PM levels (24000 data points) showed striking similarities between the results from the open sea (46 µgPM10/m3, 22 µgPM2.5/m3, 14 µgPM1/m3) and the harbour (44 µgPM10/m3, 21 µgPM2.5/m3, 13 µgPM1/m3) sectors, which were markedly different from those recorded from the land (37 µgPM10/m3, 16 µgPM2.5/m3, 11 µgPM1/m3). This indicated that the impact of shipping emissions on urban background PM levels do not represent only harbour emissions, but also emissions produced during vessel traffic into and out of the harbour, and also across from Melilla and through the Gibraltar Strait. The same kind of analysis was carried out for the levels of tracers species and tracer ratios, in search for a marker of shipping emissions. Results showed that the V/Ni ratio followed a similar pattern to that detected for PM levels, with similar values for the open sea and harbour sectors (4.1 and 4.0, respectively), which differed widely from the ratio obtained from land (12.4). These results evidence the value of the V/Ni ratio as a marker for shipping emissions in Melilla. Further research is ongoing in search of other tracer species and/or tracer ratios. Furthermore, a source apportionment analysis will be carried our by means of PMF, which will be followed by a Multi-linear Engine (ME) analysis with pulling towards the marker V/Ni ratio and aimed at quantifying the impact on urban PM levels of shipping emissions in Melilla. Acknowledgements

  4. Estimation of PV output power in moving and rocking hybrid energy marine ships

    International Nuclear Information System (INIS)

    Liu, Hongda; Zhang, Qing; Qi, Xiaoxia; Han, Yang; Lu, Fang

    2017-01-01

    Highlights: •A mathematical model for characterizing the ship PV output power is developed. •The impacts of the sea condition and ship type on the PV output power are analyzed. •The hybrid energy storage system is used to stabilize the PV fluctuation powers. •A SC configuration method based on maximum half period is applied. -- Abstract: In recent years, the application of solar energy and energy storage to ship power systems has shown promise as a method for both reducing annual carbon and nitrogen oxide emissions and improving ship energy efficiency in the maritime shipping industry. When a ship navigates at sea, it encounters a constant rocking motion that is affected by both the surrounding sea conditions and the ship’s navigation parameters. This motion increases the uncertainty involved in using solar energy and accelerates the aging of the ship’s energy storage battery to some extent. In this study, a universal mathematical model is established for the power generation by photovoltaic (PV) modules in which both the sea conditions and the ship’s integrated motion, including its basic movement along with the motion caused by rocking, are taken into account. Based on this model, the fluctuation characteristics of a ship’s PV output power are studied and determined using three different simulation scenarios. A binary energy storage scheme based on a decoupled PV output power is proposed in order to both stabilize the small-period PV power fluctuations and slow the aging of the actual battery caused by rocking. In addition, a super-capacitor (SC) configuration is constructed based on a maximum half cycle. Finally, the optimal energy storage capacities for this green ship are compared under both rocking and moving motion. In the case of rocking motion, the SCs are able to achieve an approximately 24.8–35.0% reduction in battery replacement. A shipping route between Shanghai, China and Sydney, Australia is considered to validate the practicality

  5. Carrier portfolio management for shipping seasonal products

    NARCIS (Netherlands)

    Lu, T.; Fransoo, J.C.; Lee, C.-Y.

    2017-01-01

    Many seasonal products are transported via ocean carriers from origin to destination markets. The shipments arriving earlier in the market may sell at higher prices, but faster shipping services can be costly. In this paper, we study a newsvendor-type shipper who transports and sells seasonal

  6. Exergy Analysis of Complex Ship Energy Systems

    Directory of Open Access Journals (Sweden)

    Pierre Marty

    2016-04-01

    Full Text Available With multiple primary and secondary energy converters (diesel engines, steam turbines, waste heat recovery (WHR and oil-fired boilers, etc. and extensive energy networks (steam, cooling water, exhaust gases, etc., ships may be considered as complex energy systems. Understanding and optimizing such systems requires advanced holistic energy modeling. This modeling can be done in two ways: The simpler approach focuses on energy flows, and has already been tested, approved and presented; a new, more complicated approach, focusing on energy quality, i.e., exergy, is presented in this paper. Exergy analysis has rarely been applied to ships, and, as a general rule, the shipping industry is not familiar with this tool. This paper tries to fill this gap. We start by giving a short reminder of what exergy is and describe the principles of exergy modeling to explain what kind of results should be expected from such an analysis. We then apply these principles to the analysis of a large two-stroke diesel engine with its cooling and exhaust systems. Simulation results are then presented along with the exergy analysis. Finally, we propose solutions for energy and exergy saving which could be applied to marine engines and ships in general.

  7. Statistical modelling for ship propulsion efficiency

    DEFF Research Database (Denmark)

    Petersen, Jóan Petur; Jacobsen, Daniel J.; Winther, Ole

    2012-01-01

    This paper presents a state-of-the-art systems approach to statistical modelling of fuel efficiency in ship propulsion, and also a novel and publicly available data set of high quality sensory data. Two statistical model approaches are investigated and compared: artificial neural networks...

  8. Flooding and sinking of nuclear merchant ships

    International Nuclear Information System (INIS)

    Lettnin, H.K.J.; Wehowsky, P.

    1978-01-01

    In contrast to land-based power plants for ship reactors the marine environment brings up the peril of sinking. But this peril is low for nuclear ships with its high safety standard. An evaluation of casualties from 1964 - 1974 for ships>8000 GRT allows to estimate a very low sink probability for nuclear ships in the range of 10 -7 to 10 -8 p.a. In spite of this low probability a sinking cannot be excluded absolutely. Therefore passive means must be provided for sinking in deep waters: to maintain the integrity of at least one enclosure as activity barrier; to supply seawater into the safety containment for decay heat removal. For sinking in shallow waters and flooding at least one of the redundant decay heat removal systems including power supply stays operable. A mathematical tool is available for the design of flood openings of sufficient cross sections to flood the containment and to reach a pressure balance in case of postulated sinking in deep waters of any depth

  9. Reconfigurable Control of a Ship Propulsion Plant

    DEFF Research Database (Denmark)

    Blanke, M.; Izadi-Zamanabadi, Roozbeh

    1998-01-01

    -tolerant control is a fairly new area. Thise paper presents a ship propulsion system as a benchmark that should be useful as a platform for the development of new ideas and a comparison of methods. The benchmark has two main elements. One is the development of efficient FDI algorithms, and the other...

  10. Trace of the nuclear powered ship 'Mutsu'

    International Nuclear Information System (INIS)

    1992-01-01

    The development of the nuclear powered ship 'Mutsu' required the long period of about 30 years from 1963 to 1992. When this period is looked back, it is roughly divided into the period from the initial planning to the construction, the period of the power increase test and the occurrence of radiation leak, the period of the repair of shielding and the general safety checkup as the countermeasures, the period of the checkup and maintenance based on the new research plan, the period of the power increase test and the sea trial, and the period of the experimental voyage after the completion. The course of the development of the nuclear powered ship 'Mutsu' is shown. The design of Mutsu, the incidental land facilities for Mutsu, the power increase test and the experimental voyage of Mutsu, the law system for nuclear powered ships, the research and development of an improved marine nuclear reactor and the development of nuclear powered ships in the world are reported. Nuclear powered warships are operated in USA, USSR, UK, France and China. (K.I.)

  11. Speed Optimization in Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Brouer, Berit Dangaard; Karsten, Christian Vad; Pisinger, David

    In the Liner Shipping Network Design Problem (LSNDP) services sail at a given speed throughout a round trip. In reality most services operate with a speed differentiated head- and back-haul, or even individual speeds on every sailing between two ports. The speed of a service is decisive...

  12. Wave energy extraction using decommisioned ships

    DEFF Research Database (Denmark)

    Mansour, A.E.; Pedersen, Preben Terndrup; Paik, J.K.

    2013-01-01

    is to tune the ship to have rigid body resonance, or close to it, and resist that motion to absorb power. A hydraulic ramp connected to an accumulator feeding a hydraulic motor that generates power is one possibility. Several other energy extraction mechanisms such as turbines connected to oscillating water...

  13. NOAA Ship Okeanos Explorer Video Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — During each NOAA Ship Okeanos Explorer field season, full-resolution video in a ProRes 422 format at a bitrate of 145 Mbps is produced during each deployment of the...

  14. Microbiologically influenced corrosion in ship ballast tanks

    NARCIS (Netherlands)

    Heyer, A.

    2013-01-01

    Microbiologically influenced corrosion (MIC) is known to be a dangerous process in ship tanks due to its rapid and yet unpredictable occurrence, leading to extremely fast local corrosion, possibly jeopardizing the structural integrity, in a relatively short time. This project focuses on a

  15. Detection of Parametric Roll on Ships

    DEFF Research Database (Denmark)

    Galeazzi, Roberto; Blanke, Mogens; Poulsen, Niels Kjølstad

    2012-01-01

    phenomenon could make the navigator change ship’s speed and heading, and these remedial actions could make the vessel escape the bifurcation. This chapter proposes non-parametric methods to detect the onset of parametric roll resonance. Theoretical conditions for parametric resonance are re...... on experimental data from towing tank tests and data from a container ship passing an Atlantic storm....

  16. Key Design Properties for Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas; Tan, Yao-Hua

    2015-01-01

    on paper, e-mail, phone and text message, and far too costly. This paper explores the design properties for a shared information infrastructure to exchange information between all parties in the supply chain, commercial parties as well as authorities, which is called a Shipping Information Pipeline...

  17. Near Real Time Ship Detection Experiments

    Science.gov (United States)

    Brusch, S.; Lehner, S.; Schwarz, E.; Fritz, T.

    2010-04-01

    A new Near Real Time (NRT) ship detection processor SAINT (SAR AIS Integrated Toolbox) was developed in the framework of the ESA project MARISS. Data are received at DLRs ground segment DLR-BN (Neustrelitz, Germany). Results of the ship detection are available on ftp server within 30 min after the acquisition started. The detectability of ships on Synthetic Aperture Radar (SAR) ERS-2, ENVISAT ASAR and TerraSAR-X (TS-X) images is validated by coastal (live) AIS and space AIS. The monitoring areas chosen for surveillance are the North-, Baltic Sea, and Cape Town. The detectability in respect to environmental parameters like wind field, sea state, currents and changing coastlines due to tidal effects is investigated. In the South Atlantic a tracking experiment of the German research vessel Polarstern has been performed. Issues of piracy in particular in respect to ships hijacked at the Somali coast are discussed. Some examples using high resolution images from TerraSAR-X are given.

  18. PARTICIPATION BASED MODEL OF SHIP CREW MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Toni Bielić

    2014-10-01

    Full Text Available 800x600 This paper analyse the participation - based model on board the ship as possibly optimal leadership model existing in the shipping industry with accent on decision - making process. In the paper authors have tried to define master’s behaviour model and management style identifying drawbacks and disadvantages of vertical, pyramidal organization with master on the top. Paper describes efficiency of decision making within team organization and optimization of a ship’s organisation by introducing teamwork on board the ship. Three examples of the ship’s accidents are studied and evaluated through “Leader - participation” model. The model of participation based management as a model of the teamwork has been applied in studying the cause - and - effect of accidents with the critical review of the communication and managing the human resources on a ship. The results have showed that the cause of all three accidents is the autocratic behaviour of the leaders and lack of communication within teams. Normal 0 21 false false false HR X-NONE X-NONE MicrosoftInternetExplorer4

  19. IS INLAND SHIPPING NEEDED IN POLAND?

    Directory of Open Access Journals (Sweden)

    Ryszard Rolbiecki

    2014-06-01

    Full Text Available In Poland, inland shipping plays only a mariginal role in transport needs fulfillment. Inland shipping has a share of mere 0,3% in goods transport modal split. The reason for this is poor and variable technical parameters of inland waterways together with adverse legal regulations. Different situation takes place in Western European countries, in which the development of this mode of transport is viewed as a way of road transport develop-ment restraint. In Poland, the need to move some of the volume from road transport to in-land shipping is specifically observed within marine ports surroundings. Because of their complex nature, the investments in inland shipping infrastructure would also be helpful in solving the current problems of water management. Inland waterways in Poland guaran-tee neither an adequate level of flood protection, nor the water needs fulfillment of do-mestic economy. When it comes to water reserves, Poland is one of the most deficient countries in Europe. Thus there is a need to invest in inland waterways in Poland.

  20. Automated intelligent video surveillance system for ships

    Science.gov (United States)

    Wei, Hai; Nguyen, Hieu; Ramu, Prakash; Raju, Chaitanya; Liu, Xiaoqing; Yadegar, Jacob

    2009-05-01

    To protect naval and commercial ships from attack by terrorists and pirates, it is important to have automatic surveillance systems able to detect, identify, track and alert the crew on small watercrafts that might pursue malicious intentions, while ruling out non-threat entities. Radar systems have limitations on the minimum detectable range and lack high-level classification power. In this paper, we present an innovative Automated Intelligent Video Surveillance System for Ships (AIVS3) as a vision-based solution for ship security. Capitalizing on advanced computer vision algorithms and practical machine learning methodologies, the developed AIVS3 is not only capable of efficiently and robustly detecting, classifying, and tracking various maritime targets, but also able to fuse heterogeneous target information to interpret scene activities, associate targets with levels of threat, and issue the corresponding alerts/recommendations to the man-in- the-loop (MITL). AIVS3 has been tested in various maritime scenarios and shown accurate and effective threat detection performance. By reducing the reliance on human eyes to monitor cluttered scenes, AIVS3 will save the manpower while increasing the accuracy in detection and identification of asymmetric attacks for ship protection.

  1. Towards seasonal Arctic shipping route predictions

    Science.gov (United States)

    Haines, K.; Melia, N.; Hawkins, E.; Day, J. J.

    2017-12-01

    In our previous work [1] we showed how trans-Arctic shipping routes would become more available through the 21st century as sea ice declines, using CMIP5 models with means and stds calibrated to PIOMAS sea ice observations. Sea ice will continue to close shipping routes to open water vessels through the winter months for the foreseeable future so the availability of open sea routes will vary greatly from year to year. Here [2] we look at whether the trans-Arctic shipping season period can be predicted in seasonal forecasts, again using several climate models, and testing both perfect and imperfect knowledge of the initial sea ice conditions. We find skilful predictions of the upcoming summer shipping season can be made from as early as January, although typically forecasts may show lower skill before a May `predictability barrier'. Focussing on the northern sea route (NSR) off Siberia, the date of opening of this sea route is twice as variable as the closing date, and this carries through to reduced predictability at the start of the season. Under climate change the later freeze-up date accounts for 60% of the lengthening season, Fig1 We find that predictive skill is state dependent with predictions for high or low ice years exhibiting greater skill than for average ice years. Forecasting the exact timing of route open periods is harder (more weather dependent) under average ice conditions while in high and low ice years the season is more controlled by the initial ice conditions from spring onwards. This could be very useful information for companies planning vessel routing for the coming season. We tested this dependence on the initial ice conditions by changing the initial ice state towards climatologically average conditions and show directly that early summer sea-ice thickness information is crucial to obtain skilful forecasts of the coming shipping season. Mechanisms for this are discussed. This strongly suggests that good sea ice thickness observations

  2. Bathyodontus mirus (Andrássy, 1956, first record of a representative of the suborder Bathyodontina (Nematoda, Mononchida in the Iberian fauna

    Directory of Open Access Journals (Sweden)

    Peña-Santiago, R.

    2010-12-01

    Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.

  3. EX1101: Ship Shakedown and Patch Tests on NOAA Ship Okeanos Explorer (EM302)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project will involve the shakedown of all Okeanos Explorer ship capabilities and a patch test of the Kongsberg EM302 multibeam system. Operations for this...

  4. A quantitative assessment of Arctic shipping in 2010–2014

    KAUST Repository

    Eguí luz, Victor M.; Ferná ndez-Gracia, Juan; Irigoien, Xabier; Duarte, Carlos M.

    2016-01-01

    considerable uncertainty because Arctic shipping was previously considered too sparse to allow for adequate validation. Here, we provide quantitative evidence that the extent of Arctic shipping in the period 2011–2014 is already significant

  5. Virtual Ship Architecture Description Document Issue 1.00

    National Research Council Canada - National Science Library

    Best, John

    2000-01-01

    The Virtual Ship concept calls for simulation models of systems to be brought together to create a virtual representation of a warship, in a process analogous to the construction of a physical ship...

  6. INFLUENCE OF OPERABILITY CRITERIA LIMITING VALUES ON SHIP SPEED

    Directory of Open Access Journals (Sweden)

    Jasna Prpić-Oršić

    2016-09-01

    Full Text Available When the ship is caught in heavy seas, there are two manoeuvres that the shipmaster can undertake to avoid excessive ship motion and hull damage: changing course or voluntary speed reduction. This paper presents a study of the effect of the various voluntary speed reduction criteria to attainable speed of ship on seaway. The speed loss is calculated by taking into account wind and wave effect on ship speed, the engine and propeller performance in actual seas as well as the mass inertia of the ship. The attainable ship speed for ship in head, following and beam waves by accounting for voluntary speed reduction is estimated for various significant wave height. The criteria of slamming, deck wetness, propeller emergence, excessive accelerations and roll are taken into account. The impact of variations of the limiting values of certain criteria due to which the captain intentionally reduces the ship speed is analysed and discussed.

  7. Ship Track for Lost City 2005 - Office of Ocean Exploration

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship track of the NOAA ship Ronald H. Brown during the "Lost City 2005" expedition sponsored by the National Oceanic and Atmospheric Administration (NOAA) Office of...

  8. Protection of Shipping: A Forgotten Mission with Many New Challenges

    National Research Council Canada - National Science Library

    Grubb, Michael C

    2006-01-01

    ..." mission status, often leading to devastating losses of shipping when war came. Today, the protection of shipping mission still finds itself behind more high-profile missions such as strike warfare and ballistic missile defense...

  9. 1999 Annual report

    International Nuclear Information System (INIS)

    2000-01-01

    The year 1999 was a very challenging one for Ryan Energy Technologies Inc. In the wake of the industry slowdown the Company removed from service 12 'measurement while drilling/logging while drilling' (MWD/LWD) systems or 40 per cent of its MWD/LWD equipment. Staff was reduced correspondingly, resulting in a proportional improvement in cost structures. Despite the financially challenging first three quarters of 1999, Ryan entered the year 2000 with a strong balance sheet. It was able to complete an equity offering of $ 7.5 million in gross proceeds to fund the expansion of its electromagnetic (EM) communication and data management equipment fleet, and to provide a source of cash for possible acquisitions. With the turnaround of oil prices Ryan returned to service its MWD/LWD systems in the fourth quarter of 1999, and rehired a significant number of its previous staff. Revenues in the fourth quarter increased by 95 per cent and the company returned to profitability. Consolidated revenues for the year ending December 31, 1999 decreased to $ 27.3 million from $ 43.9 million in 1998. Consolidated net losses amounted to $ 3.4 million compared to net earnings of $ 2.0 million in 1998. Despite hard times, the Company was able to manufacture four additional EM systems, bringing EM job capacity to seven. The Company also completed the acquisition of the directional drilling assets of Whipstock Systems Inc of Calgary . Ryan secured its first MWD/LWD job contract in Venezuela in the third quarter; since then it also shipped a second unit to Venezuela to meet rising demand for the company;' services. Ryan also began drilling a multi-well pilot program in Abu Dhabi in late 1999. Two of these wells have been successfully completed to date, and a third well is in the planning stages. Upon finishing this program, Ryan Energy Technologies will be eligible for multi-year contracts with the Abu Dhabi National Oil Company, an important step in establishing a Middle East presence in the

  10. The investigation of ship maneuvering with hydrodynamic effects between ships in curved narrow channel

    Directory of Open Access Journals (Sweden)

    Chun-Ki Lee

    2016-01-01

    Full Text Available The hydrodynamic interaction between two large vessels can't be neglected when two large vessels are closed to each other in restricted waterways such as in a harbor or narrow channel. This paper is mainly concerned with the ship maneuvering motion based on the hydrodynamic interaction effects between two large vessels moving each other in curved narrow channel. In this research, the characteristic features of the hydrodynamic interaction forces between two large vessels are described and illustrated, and the effects of velocity ratio and the spacing between two vessels are summarized and discussed. Also, the Inchon outer harbor area through the PALMI island channel in Korea was selected, and the ship maneuvering simulation was carried out to propose an appropriate safe speed and distance between two ships, which is required to avoid sea accident in confined waters. From the inspection of this investigation, it indicates the following result. Under the condition of SP12≤0.5L, it may encounter a dangerous tendency of grounding or collision due to the combined effect of the interaction between ships and external forces. Also considering the interaction and wind effect as a parameter, an overtaken and overtaking vessel in narrow channel can navigate while keeping its own original course under the following conditions; the lateral separation between two ships is about kept at 0.6 times of ship length and 15 degrees of range in maximum rudder angle. On the other hand, two ships while overtaking in curved narrow channel such as Inchon outer harbor in Korea should be navigated under the following conditions; SP12 is about kept at 1.0 times of ship length and the wind velocity should not be stronger than 10 m/s.

  11. Optimal ship forms for minimum total resistance in shallow water

    OpenAIRE

    Zhao, Lian-en

    1984-01-01

    Optimal ship forms for minimum total resistance in shallow water Optimal ship forms for minimum total resistance in shallow water: An attempt is made to obtain shallow-water optimal ship forms for total resistance by means of "tent" function representation under the constraints that the main dimensions of the ship and the water-line area were kept constant. The objective function in the quadratic programming is the sum of wave-making resistance calculated by Sretenski's formula and viscou...

  12. 47 CFR 80.277 - Ship Security Alert System (SSAS).

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship Security Alert System (SSAS). 80.277... Security Alert System (SSAS). (a) Vessels equipped with a Ship Security Alert System pursuant to the Safety..., “RTCM Standard 11020.0—Ship Security Alert Systems (SSAS) using the Cospas-Sarsat System,” Version 1.0...

  13. Routing and scheduling and fleet management for liner shipping

    DEFF Research Database (Denmark)

    Kjeldsen, Karina Hjortshøj

    2009-01-01

    The problem of routing, scheduling and fleet management in global liner shipping is presented. The developed model incorporates the ships' speed as a decision variable. Furthermore, the model must be able to handle problems of the size and complexity experienced by the global liner shipping...

  14. Concept Design and Risk Assessment of Nuclear Propulsion Ship

    International Nuclear Information System (INIS)

    Gil, Youngmi; Yoo, Seongjin; Kim, Yeontae; Oh, June; Byun, Yoonchul; Woo, Ilguk; Kim, Jiho; Choi, Suhn

    2014-01-01

    The nuclear propulsion ships (hereinafter referred to as 'nuclear ships') have been considered as an eco-friendly ship. There have historically been warship and submarine with the source of nuclear power. The use of nuclear ships has been recently extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, we evaluated the economics of various types of ships and concluded that the container ship could be appropriate for the nuclear propulsion. In order to verify its safety, we performed the ship calculation based on the optimal arrangement of the nuclear reactor. Finally, we verified its safety by the HAZID. In the former research, we confirmed the applicability of the nuclear propulsion system for the large container ship. In this study, we verified the safety of the nuclear ships according to the HAZID analysis. We expect that this research will lead to safe design of the nuclear ships

  15. Concept Design and Risk Assessment of Nuclear Propulsion Ship

    Energy Technology Data Exchange (ETDEWEB)

    Gil, Youngmi; Yoo, Seongjin; Kim, Yeontae; Oh, June; Byun, Yoonchul; Woo, Ilguk [Daewoo Shipbuilding and Marine Engineering Co. Ltd., Seoul (Korea, Republic of); Kim, Jiho; Choi, Suhn [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2014-05-15

    The nuclear propulsion ships (hereinafter referred to as 'nuclear ships') have been considered as an eco-friendly ship. There have historically been warship and submarine with the source of nuclear power. The use of nuclear ships has been recently extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, we evaluated the economics of various types of ships and concluded that the container ship could be appropriate for the nuclear propulsion. In order to verify its safety, we performed the ship calculation based on the optimal arrangement of the nuclear reactor. Finally, we verified its safety by the HAZID. In the former research, we confirmed the applicability of the nuclear propulsion system for the large container ship. In this study, we verified the safety of the nuclear ships according to the HAZID analysis. We expect that this research will lead to safe design of the nuclear ships.

  16. 29 CFR 1915.164 - Ship's propulsion machinery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's propulsion machinery. 1915.164 Section 1915.164 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.164 Ship's...

  17. Econometric analysis of ship life cycles - are safety inspections effective?

    NARCIS (Netherlands)

    G.E. Bijwaard (Govert); S. Knapp (Sabine)

    2008-01-01

    textabstractDue to the shipping industry’s international legal framework and the existence of loopholes in the system, an estimated 5-10 percent of substandard ships exist which are more likely to have incidents with high economic cost. This article uses ship life cycles to provide insight into

  18. 47 CFR 80.59 - Compulsory ship inspections.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Compulsory ship inspections. 80.59 Section 80... STATIONS IN THE MARITIME SERVICES Applications and Licenses § 80.59 Compulsory ship inspections. (a) Inspection of ships subject to the Communications Act or the Safety Convention. (1) The FCC will not normally...

  19. 46 CFR 176.910 - Passenger Ship Safety Certificate.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 176.910 Section 176... 100 GROSS TONS) INSPECTION AND CERTIFICATION International Convention for Safety of Life at Sea, 1974, as Amended (SOLAS) § 176.910 Passenger Ship Safety Certificate. (a) A vessel, which carries more than...

  20. 46 CFR 115.910 - Passenger Ship Safety Certificate.

    Science.gov (United States)

    2010-10-01

    ...) The route specified on the Certificate of Inspection and the SOLAS Passenger Ship Safety Certificate... 46 Shipping 4 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 115.910 Section 115... MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND...

  1. A Mathematical Model for Analysis on Ships Collision Avoidance ...

    African Journals Online (AJOL)

    This study develops a mathematical model for analysis on collision avoidance of ships. The obtained model provides information on the quantitative effect of the ship's engine's response and the applied reversing force on separation distance and stopping abilities of the ships. Appropriate evasive maneuvers require the ...

  2. 47 CFR 80.1099 - Ship sources of energy.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship sources of energy. 80.1099 Section 80.1099... Stations § 80.1099 Ship sources of energy. (a) There must be available at all times, while the ship is at... batteries used as part of a reserve source of energy for the radio installations. (b) A reserve source of...

  3. Effect of ship motion on spinal loading during manual lifting

    NARCIS (Netherlands)

    Faber, G.S.; Kingma, I.; Delleman, N.; Dieën, J. van

    2008-01-01

    This study investigated the effects of ship motion on peak spinal loading during lifting. All measurements were done on a ship at sea. In 1-min trials, which were repeated over a wide range of sailing conditions, subjects lifted an 18 kg box five times. Ship motion, whole body kinematics, ground

  4. 48 CFR 47.305-16 - Shipping characteristics.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Shipping characteristics... CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 47.305-16 Shipping characteristics... shipments of agreed size. (b) Guaranteed shipping characteristics. (1) The contracting officer shall insert...

  5. Ships going slow in reducing their NOx emissions

    NARCIS (Netherlands)

    Boersma, K.F.; Vinken, G.C.M.; Tournadre, J.

    2015-01-01

    Weaddress the lack of temporal information on ship emissions, and report on rapid short-term variations of satellite-derived shipNOx emissions between 2005 and 2012 over European seas. Our inversion is based onOMI observed troposphericNO2 columns and GEOS-Chem simulations. Average European shipNOx

  6. Shipping emission forecasts and cost-benefit analysis of China ports and key regions' control.

    Science.gov (United States)

    Liu, Huan; Meng, Zhi-Hang; Shang, Yi; Lv, Zhao-Feng; Jin, Xin-Xin; Fu, Ming-Liang; He, Ke-Bin

    2018-05-01

    China established Domestic Emission Control Area (DECA) for sulphur since 2015 to constrain the increasing shipping emissions. However, future DECA policy-makings are not supported due to a lack of quantitive evaluations. To investigate the effects of current and possible Chinese DECAs policies, a model is presented for the forecast of shipping emissions and evaluation of potential costs and benefits of an DECA policy package set in 2020. It includes a port-level and regional-level projection accounting for shipping trade volume growth, share of ship types, and fuel consumption. The results show that without control measures, both SO 2 and particulate matter (PM) emissions are expected to increase by 15.3-61.2% in Jing-Jin-Ji, the Yangtze River Delta, and the Pearl River Delta from 2013 to 2020. However, most emissions can be reduced annually by the establishment of a DECA that depends on the size of the control area and the fuel sulphur content limit. Costs range from 0.667 to 1.561 billion dollars (control regional shipping emissions) based on current fuel price. A social cost method shows the regional control scenarios benefit-cost ratios vary from 4.3 to 5.1 with large uncertainty. Chemical transportation model combined with health model method is used to get the monetary health benefits and then compared with the results from social cost method. This study suggests that Chinese DECAs will reduce the projected emissions at a favorable benefit-cost ratio, and furthermore proposes policy combinations that provide high cost-effective benefits as a reference for future policy-making. Crown Copyright © 2018. Published by Elsevier Ltd. All rights reserved.

  7. Ship emissions and the use of current air cleaning technology: contributions to air pollution and acidification in the Baltic Sea

    Directory of Open Access Journals (Sweden)

    B. Claremar

    2017-10-01

    Full Text Available The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km  ×  50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for

  8. Ship-Track Models Based on Poisson-Distributed Port-Departure Times

    National Research Council Canada - National Science Library

    Heitmeyer, Richard

    2006-01-01

    ... of those ships, and their nominal speeds. The probability law assumes that the ship departure times are Poisson-distributed with a time-varying departure rate and that the ship speeds and ship routes are statistically independent...

  9. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    International Nuclear Information System (INIS)

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have

  10. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable

  11. Technique for ship/wake detection

    Science.gov (United States)

    Roskovensky, John K [Albuquerque, NM

    2012-05-01

    An automated ship detection technique includes accessing data associated with an image of a portion of Earth. The data includes reflectance values. A first portion of pixels within the image are masked with a cloud and land mask based on spectral flatness of the reflectance values associated with the pixels. A given pixel selected from the first portion of pixels is unmasked when a threshold number of localized pixels surrounding the given pixel are not masked by the cloud and land mask. A spatial variability image is generated based on spatial derivatives of the reflectance values of the pixels which remain unmasked by the cloud and land mask. The spatial variability image is thresholded to identify one or more regions within the image as possible ship detection regions.

  12. Indirect Encoding in Neuroevolutionary Ship Handling

    Directory of Open Access Journals (Sweden)

    Miroslaw Lacki

    2018-03-01

    Full Text Available In this paper the author compares the efficiency of two encoding schemes for artificial intelligence methods used in the neuroevolutionary ship maneuvering system. This may be also be seen as the ship handling system that simulates a learning process of a group of artificial helmsmen - autonomous control units, created with an artificial neural network. The helmsman observes input signals derived form an enfironment and calculates the values of required parameters of the vessel maneuvering in confined waters. In neuroevolution such units are treated as individuals in population of artificial neural networks, which through environmental sensing and evolutionary algorithms learn to perform given task efficiently. The main task of this project is to evolve a population of helmsmen with indirect encoding and compare results of simulation with direct encoding method.

  13. Application of fuel cells in surface ships

    Energy Technology Data Exchange (ETDEWEB)

    Bourne, C.; Nietsch, T.; Griffiths, D.; Morley, J.

    2001-07-01

    This report presents the findings of a DTI supported project entitled: ''Applications of fuel cells in surface ships''. It gives a brief market analysis describing the general requirements of different vessel types and an overview of the different heat engine technologies currently used for propulsion and power generation in ships. The appendices contain a more detailed description of the different vessel types, their general requirements and a description of current prime mover technologies used. This analysis is followed by a summary of the major fuel cell development programmes and activities ongoing in different countries that have a direct or potential relevance to a marine application of the technology. (author)

  14. Major impact in shipping and port sectors

    Energy Technology Data Exchange (ETDEWEB)

    Cottrill, K.

    1985-08-01

    The impact of information technology (IT) on operations efficiency in the transport field is comparable to the revolution brought on by the use of containers. The author examines the influence of IT on British shipping in terms of documentation, cargo tracking, and trend analysis on the operational side and communications links on the structural side. Shipboard computers were slow to penetrate the traditional bastion of the ship's bridge, but the effects of automation are already evident in the size of crews and their work roles. Britain is a world leader in specialized networks in the ports sector. A European-based initiative for a European ports database is in the development stage. It is essential for the IT networks to be compatible both nationally and internationally for the technology to be worthwhile.

  15. Multipole superconducting electric motors for ship propulsion

    International Nuclear Information System (INIS)

    Thullen, P.; Keim, T.A.; Minervini, J.V.

    1975-01-01

    While a great deal of attention has been paid to two-pole superconducting synchronous machines, very little analysis of low speed, multipole superconducting synchronous machines has been done. Such machines may prove desirable as drive motors in ship drive systems. Results are presented of an analysis which assumes a motor of sufficient size that the airgap may be considered to be flat. A power output expression is given which shows the effects of machine geometry and superconductor characteristics on machine size. Based on this expression, a 40,000 hp 120 rpm motor is sized, and the resulting machine is compared with a conventional ship drive motor. The comparison illustrates possible size reductions through the application of superconductivity

  16. The Ship Movement Trajectory Prediction Algorithm Using Navigational Data Fusion.

    Science.gov (United States)

    Borkowski, Piotr

    2017-06-20

    It is essential for the marine navigator conducting maneuvers of his ship at sea to know future positions of himself and target ships in a specific time span to effectively solve collision situations. This article presents an algorithm of ship movement trajectory prediction, which, through data fusion, takes into account measurements of the ship's current position from a number of doubled autonomous devices. This increases the reliability and accuracy of prediction. The algorithm has been implemented in NAVDEC, a navigation decision support system and practically used on board ships.

  17. Leadership Profiling of Ocean Going Ship Masters1

    Directory of Open Access Journals (Sweden)

    Ioannis Theotokas

    2014-12-01

    This paper focuses on the ocean going ship Masters and aims at identifying their leadership profiles and understanding their attitudes and reactions in given circumstances. It analyses and discusses the results of a field study of ship officers of different nationalities employed as Masters on board ships of a leading international maritime group. Results of the research reveal that the characteristics and the competencies of ship Masters as identified using the specially developed questionnaire, are compatible with those proposed by situational leadership theories. Ship Masters seem to give priority to the people on board and their needs and try to be supportive in their decisions.

  18. Observations and computations of narrow Kelvin ship wakes

    OpenAIRE

    Francis Noblesse; Chenliang Zhang; Jiayi He; Yi Zhu; Chenjun Yang; Wei Li

    2016-01-01

    Computations of far-field ship waves, based on linear potential flow theory and the Hogner approximation, are reported for monohull ships and catamarans. Specifically, far-field ship waves are computed for six monohull ships at four Froude numbers F≡V/gL=0.58, 0.68, 0.86, 1.58 and for six catamarans with nondimensional hull spacing s≡S/L=0.25 at two Froude numbers Fs≡V/gS=1 and 2.5. Here, g is the gravitational acceleration, V and L denote the ship speed and length, and S is the separation di...

  19. Trends in Integrated Ship Control Networking

    DEFF Research Database (Denmark)

    Jørgensen, N.; Nielsen, Jens Frederik Dalsgaard

    1997-01-01

    Integrated Ship Control systems can be designed as robust, distributed, autonomous control systems. The EU funded ATOMOS and ATOMOS II projects involves both technical and non technical aspects of this process. A reference modelling concept giving an outline of a generic ISC system covering...... the network and the equipment connected to it, a framework for verification of network functionality and performance by simulation and a general distribution platform for ISC systems, The ATOMOS Network, are results of this work....

  20. Methanol plant ship: Appendix. Export trade information

    International Nuclear Information System (INIS)

    1988-01-01

    The document is an appendix to the final report on a proposed methanol plant ship off of the coast of Trinidad. The document incorporates the results of the redetermination of capital required to implement the project. It also presents a revised cost analysis, with better accuracy, for the project. The projected operating revenues and revised expenses are also given. As a continuation of the information presented in the final report, the methanol market and proposed products are discussed in the report

  1. Light UAV Support Ship (ASW) (LUSSA)

    Science.gov (United States)

    2011-08-01

    Propeller EMALS - Electromagnetic Aircraft Launch System GM - Center of Gravity to Metacenter HFO - Heavy Fuel Oil IPS - Integrated Propulsion System...it induces high cavitation levels on surface ships. The ship’s final design implemented a contra- rotating propeller (CRP) system. CRP propulsion...Stability Analyses Intact stability analyses were performed using the hydrodynamic modeling tool Paramarine. The vertical center of gravity (VCG) of

  2. Salvage Stories, Preserving Narratives, and Museum Ships

    OpenAIRE

    Andrew Sawyer

    2013-01-01

    Preserved ships and other vessels are associated with a historiography, in Europe at least, which is still marked by parochialism, antiquarianism, and celebratory narrative. Many evidence difficult histories, and they are also extremely expensive to preserve. Yet, they are clearly valued, as nations in Europe invest heavily in them. This survey examines a range of European examples as sites of cultural, political and national identity. An analytical framework foregrounding the role of narrati...

  3. Navy Ship Names: Background for Congress

    Science.gov (United States)

    2016-09-14

    Secretary considers these nominations , along with others he receives as well as his own thoughts in this matter. At appropriate times, he selects names...Research Service 16 “ nomination ” process is often fiercely contested as differing groups make the case that “their” ship name is the most fitting...and practices of the Navy for naming vessels of the Navy, and an explanation for such variances;  Assesses the feasibility and advisability of

  4. A Survey on the Ship Loading Problem

    DEFF Research Database (Denmark)

    Iris, Cagatay; Pacino, Dario

    2015-01-01

    Recent statistics show that large container terminals can process more than 30 million containers a year, and are constantly in search for the better ways to optimize processing time, deliver high quality and profitable services. Some of the terminal decisions are, however, dependent...... are integrated to improve the efficiency of the ship handling operations. We present a survey of the state-of-the-art methods and of the available benchmarking data....

  5. Ship Structure Committee Publications. A Special Bibliography.

    Science.gov (United States)

    1992-01-01

    STEEL AND SUPPLEMENT ON EMBRITTLEMENT OF "C" STEEL BY NITROGEN Evans, EB. K lingler , Li .......................................................... 13...FROM: NTIS AD-8710SSC-28 CAUSES OF CLEAVAGE FRACTURE IN SHIP PLATE, HIGH YIELD STRENGTH STRUCTURAL STEEL SSC-31 The primary objective of the... careful design, selection of materials, and PART II: THE EFFECT OF SUBCRITICAL HEAT TREATMENT ON goo. workmanship are of the greatest importance in

  6. Ship Anti Ballistic Missile Response (SABR)

    OpenAIRE

    Johnson, Allen P.; Breeden, Bryan; Duff, Willard Earl; Fishcer, Paul F.; Hornback, Nathan; Leiker, David C.; Carlisle, Parker; Diersing, Michael; Devlin, Ryan; Glenn, Christopher; Hoffmeister, Chris; Chong, Tay Boon; Sing, Phang Nyit; Meng, Low Wee; Meng, Fann Chee

    2006-01-01

    Includes supplementary material. Based on public law and Presidential mandate, ballistic missile defense development is a front-burner issue for homeland defense and the defense of U.S. and coalition forces abroad. Spearheaded by the Missile Defense Agency, an integrated ballistic missile defense system was initiated to create a layered defense composed of land-, air-, sea-, and space-based assets. The Ship Anti-Ballistic Response (SABR) Project is a systems engineering approach t...

  7. Connecting Land-Based Networks to Ships

    Science.gov (United States)

    2013-06-01

    multipoint wireless broadband systems, and WiMAX networks were initially deployed for fixed and nomadic (portable) applications. These standards...CAPABILITIES OF SHIP-TO-SHORE COMMUNICATIONS A. US Navy Automated Digital Network System (ADNS) The U.S. Navy’s Automated Digital Network System (ADNS...submit digitally any necessary documents to the terminal operators, contact their logistics providers, access tidal information and receive

  8. Utilization of nuclear technology to ship

    International Nuclear Information System (INIS)

    Kim, H. C.

    2004-01-01

    The SMART, a medium sized power plant with an output of 330mwth, can be used on barges to generate electric power and water, and can be used to propel container ships. For high speed, to secure the container cargo, and huge container carriers, to lower the operating expenses, the use of nuclear power reactor is essential. To compete in this challenging area with the advanced countries, a well-orchestrated joint effort will be necessary by the government and the industries

  9. Big Data in Shipping - Challenges and Opportunities

    OpenAIRE

    Rødseth, Ørnulf Jan; Perera, Lokukaluge Prasad; Mo, Brage

    2016-01-01

    Big Data is getting popular in shipping where large amounts of information is collected to better understand and improve logistics, emissions, energy consumption and maintenance. Constraints to the use of big data include cost and quality of on-board sensors and data acquisition systems, satellite communication, data ownership and technical obstacles to effective collection and use of big data. New protocol standards may simplify the process of collecting and organizing the data, including in...

  10. Historic survey on nuclear merchant ships

    Energy Technology Data Exchange (ETDEWEB)

    Freire, Luciano Ondir, E-mail: luciano.ondir@gmail.com; Andrade, Delvonei Alves de, E-mail: delvonei@ipen.br

    2015-11-15

    Highlights: • The nuclear merchants ships already built are described and studied. • Their history and main architectural choices are presented, focusing nuclear domain. • The typical problems in those projects are discussed. • Some key factors for developing successful nuclear merchant ships are identified. - Abstract: This work provides a survey on past nuclear merchant ships experience. On light of new regulations on CO{sub 2}, SO{sub x} and NO{sub x}, the options for clean naval propulsion need to be studied. Despite many efforts, the only already sea proven emissions-free energy is nuclear power of pressurized water reactor type. Given the past experience on the field, this work provides some information on history, architectures and hints of reasons for the success or failures of each project. It is found that adequate requirements identification must be done keeping economics always in the center of design. Experience shows, except after major catastrophic accidents, public trust may be earned by open dialog and sound engineering practices.

  11. Historic survey on nuclear merchant ships

    International Nuclear Information System (INIS)

    Freire, Luciano Ondir; Andrade, Delvonei Alves de

    2015-01-01

    Highlights: • The nuclear merchants ships already built are described and studied. • Their history and main architectural choices are presented, focusing nuclear domain. • The typical problems in those projects are discussed. • Some key factors for developing successful nuclear merchant ships are identified. - Abstract: This work provides a survey on past nuclear merchant ships experience. On light of new regulations on CO 2 , SO x and NO x , the options for clean naval propulsion need to be studied. Despite many efforts, the only already sea proven emissions-free energy is nuclear power of pressurized water reactor type. Given the past experience on the field, this work provides some information on history, architectures and hints of reasons for the success or failures of each project. It is found that adequate requirements identification must be done keeping economics always in the center of design. Experience shows, except after major catastrophic accidents, public trust may be earned by open dialog and sound engineering practices.

  12. Adaptation to carbon dioxide tax in shipping

    International Nuclear Information System (INIS)

    Olsen, Kristian

    2000-01-01

    This note discusses the consequences for the sea transport sector between Norway and continental Europe of levying a carbon dioxide tax on international bunker. The influence of such a tax on the operational costs of various types of ship and various transport routes is calculated. The profit obtainable from the following ways of adapting to an increased tax level is assessed: (1) Reducing the speed, (2) Rebuilding the engine to decrease fuel consumption, (3) Changing the design speed for new ships. It is found that a carbon dioxide tax of NOK 200 per tonne of CO 2 will increase the transport costs by 3 - 15 percent. In the long run much of this may be transferred to the freight rates since so much of the sea transport are in segments in which the demand for the service is not sensitive to the prices. Even if the freight rates are not changed, a tax this size will not make it necessary to reduce the speed of the existing fleet. The income lost by taking fewer trips will exceed the costs saved in reducing the speed. However, the optimum design speed for new ships may be somewhat reduced (0.5 knots). Rebuilding engines to reduce the fuel consumption would pay off were it not for the fact that the remaining life of the present fleet is probably too short for this to be interesting

  13. Analysis of Ship Groundings on Soft Sea Beds

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup; Pedersen, Preben Terndrup

    1997-01-01

    it influences the ship heave and pitch motions as well as the friction between the ship and the soil.In this paper a rational calculation model is presented for the sea bed soil reaction forces on the ship bottom. The model is based on the assumption that the penetration of the ship bow generates a flow of pore......The consequences associated with ships running aground depend very much on the soil characteristics of the sea bed and the geometrical shape of the ship bow. The penetration into the sea bed depends on these factors and the penetration is an important factor for the ship motion because...... by the theory of frictional soils in rupture. Frictional stresses on the bow surface are assumed to be related to the normal pressure by a simple Coulumb relation. The total soil reaction as a function of velocity and penetration is found by integration of normal pressure and frictional stresses over...

  14. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Index Scriptorium Estoniae

    Sooväli-Sepping, Helen, 1974-

    2016-01-01

    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  15. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    International Nuclear Information System (INIS)

    Shulan Xu; Dverstorp, Bjoern; Woerman, Anders; Marklund, Lars; Klos, Richard; Shaw, George

    2008-03-01

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB investigation

  16. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    Energy Technology Data Exchange (ETDEWEB)

    Shulan Xu; Dverstorp, Bjoern (Swedish Radiation Protection Authority, Stockholm (Sweden)); Woerman, Anders; Marklund, Lars (Royal Institute of Technology (KTH), Stockholm (SE)); Klos, Richard (Aleksandria Sciences, Sheffield (GB)); Shaw, George (Univ. of Nottingham (GB))

    2008-03-15

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB

  17. Thermo-hydraulic characteristics of ship propulsion reactor in the conditions of ship motions and safety assessment

    International Nuclear Information System (INIS)

    Kobayashi, Michiyuki; Murata, Hiroyuki; Sawada, Kenichi; Inasaka, Fujio; Aya, Izuo; Shiozaki, Koki

    1999-01-01

    By inputting the experimental data, information and others on thermo-hydraulic characteristics of integrated ship propulsion reactor accumulated hitherto by the Ship Research Institute and some recent cooperation results into the nuclear ship engineering simulation system, it was conducted not only to contribute an improvement study on next ship reactor by executing general analysis and evaluation on motion characteristics under ship body motion conditions, safety at accidents, and others of the integrated ship reactor but also to investigate and prepare some measures to apply fundamental experiment results based on obtained here information to safety countermeasure of the nuclear ships. In 1997 fiscal year, on safety of the integrated ship propulsion reactor loading nuclear ship, by adding experimental data on unstable flow analysis and information on all around of the analysis to general data base fundamental program, development to intellectual data base program was intended; on effect of pulsation flow on thermo-hydraulic characteristics of ship propulsion reactor; after pulsation flow visualization experiment, experimental equipment was reconstructed into heat transfer type to conduct numerical analysis of pulsation flow by confirming validity of numerical analysis code under comparison with the visualization experiment results; and on thermo-hydraulic behavior in storage container at accident of active safety type ship propulsion reactor; a flashing vibration test using new apparatus finished on its higher pressurization at last fiscal year to examine effects of each parameter such as radius and length of exhausting nozzle and pool water temperature. (G.K.)

  18. Annual report, 1981-82

    International Nuclear Information System (INIS)

    1982-01-01

    Recent operational restructuring implemented grouped the Engineering, Chemical, and International Companies under CANDU Operations. The Research Company was charged with finding products and markets to bridge the gap in new orders for reactors apparent for the next few years. Net income rose 46 percent to $19.7 million. Economic slowdown in Canada and elsewhere had little effect as AECL continued to fufill obligations on previously negotiated multi-year contracts. Over 60 percent of commercial revenue came from outside Canada, and at $234 million was marginally higher than 1980-81. Development of the superconducting cyclotron continued at Chalk River, with successful testing of magnetic field and radiofrequency systems. The nuclear fuel waste management program continued, with selection of a site for an underground research laboratory near Pinawa, Manitoba. The Therac-25 high energy accelerator for cancer therapy neared completion of its development and manufacturing program. There are more than 10 orders already booked. A record 15.2 million curies of cobalt 60 were shipped, an increase of 25 percent in orders for gamma irradiation processing. The prototype Douglas Point generating station was returned to full power and reached its highest annual capacity factor since 1975. Conceptual design of the new standardized two 950MW-unit CANDU PHWR generating station was completed. AECL responded to a request for quotations from the Mexican government for its nuclear power program

  19. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    Energy Technology Data Exchange (ETDEWEB)

    2008-03-15

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  20. Adaptive Roles of SSY1 and SIR3 During Cycles of Growth and Starvation in Saccharomyces cerevisiae Populations Enriched for Quiescent or Nonquiescent Cells.

    Science.gov (United States)

    Wloch-Salamon, Dominika M; Tomala, Katarzyna; Aggeli, Dimitra; Dunn, Barbara

    2017-06-07

    Over its evolutionary history, Saccharomyces cerevisiae has evolved to be well-adapted to fluctuating nutrient availability. In the presence of sufficient nutrients, yeast cells continue to proliferate, but upon starvation haploid yeast cells enter stationary phase and differentiate into nonquiescent (NQ) and quiescent (Q) cells. Q cells survive stress better than NQ cells and show greater viability when nutrient-rich conditions are restored. To investigate the genes that may be involved in the differentiation of Q and NQ cells, we serially propagated yeast populations that were enriched for either only Q or only NQ cell types over many repeated growth-starvation cycles. After 30 cycles (equivalent to 300 generations), each enriched population produced a higher proportion of the enriched cell type compared to the starting population, suggestive of adaptive change. We also observed differences in each population's fitness suggesting possible tradeoffs: clones from NQ lines were better adapted to logarithmic growth, while clones from Q lines were better adapted to starvation. Whole-genome sequencing of clones from Q- and NQ-enriched lines revealed mutations in genes involved in the stress response and survival in limiting nutrients ( ECM21 , RSP5 , MSN1 , SIR4 , and IRA2 ) in both Q and NQ lines, but also differences between the two lines: NQ line clones had recurrent independent mutations affecting the Ssy1p-Ptr3p-Ssy5p (SPS) amino acid sensing pathway, while Q line clones had recurrent, independent mutations in SIR3 and FAS1 Our results suggest that both sets of enriched-cell type lines responded to common, as well as distinct, selective pressures. Copyright © 2017 Wloch-Salamon et al.

  1. Contribution of ship traffic to aerosol particle concentrations downwind of a major shipping lane

    DEFF Research Database (Denmark)

    Kivekäs, N.; Massling, Andreas; Grythe, H.

    2014-01-01

    at a remote location. We studied the particle number concentration (12 to 490 nm in diameter), the mass concentration (12 to 150 nm in diameter) and number and volume size distribution of aerosol particles in ship plumes for a period of 4.5 months at Hovsore, a coastal site on the western coast of Jutland...... in Denmark. During episodes of western winds, the site is about 50 km downwind of a major shipping lane and the plumes are approximately 1 hour old when they arrive at the site. We have used a sliding percentile-based method for separating the plumes from the measured background values and to calculate...... the ship plume contribution to the total particle number and PM0.15 mass concentration (mass of particles below 150 nm in diameter, converted from volume assuming sphericity) at the site. The method is not limited to particle number or volume concentration, but can also be used for different chemical...

  2. SYNCHRONIZATION OF NATIONAL GRID NETWORK WITH THE ELECTRICITY SHIPS NETWORK IN THE "SHORE TO SHIP" SYSTEM

    Directory of Open Access Journals (Sweden)

    Dariusz TARNAPOWICZ

    2013-07-01

    Full Text Available ‘Shore to ship’ system – ships’ power supply from the local electrical substations – is one of the effective ways to limit the negative impact of the ships lying in ports on the environment. Energy infrastructure of the port installation necessary to provide ships with power supply has to be designed so that different types of ships can use it. The important issue concerning ‘shore to ship’ system is the quality of power supply. This can be achieved via sustaining continuity of power supply while switching from the ships’ electrical network over to the national grid. In this article the author presents the way of synchronizing the national grid with the ships’ electrical network during ship’s lying in port. Such synchronization would allow for uninterruptible work of the ship’s electrical devices.

  3. Numerical Study on the Effect of Buffer Bow Structure in Ship-to-ship Collisions

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup

    2005-01-01

    tankers, the introduction of buffer bulbous bows has been proposed. Relatively soft buffer bows absorb part of the kinetic energy of the striking ship before penetrating the inner hull of the struck vessel. The purpose of the present paper is to verify the effectiveness of a prototype buffer bulbous bow......) and the forward velocity of the struck ship on the collapse mode of the bow of the striking vessel are investigated. Collapse modes, contact forces and energy absorption capabilities of the buffer bows are compared with those of conventional bows....

  4. An Adaptive Ship Detection Scheme for Spaceborne SAR Imagery

    Directory of Open Access Journals (Sweden)

    Xiangguang Leng

    2016-08-01

    Full Text Available With the rapid development of spaceborne synthetic aperture radar (SAR and the increasing need of ship detection, research on adaptive ship detection in spaceborne SAR imagery is of great importance. Focusing on practical problems of ship detection, this paper presents a highly adaptive ship detection scheme for spaceborne SAR imagery. It is able to process a wide range of sensors, imaging modes and resolutions. Two main stages are identified in this paper, namely: ship candidate detection and ship discrimination. Firstly, this paper proposes an adaptive land masking method using ship size and pixel size. Secondly, taking into account the imaging mode, incidence angle, and polarization channel of SAR imagery, it implements adaptive ship candidate detection in spaceborne SAR imagery by applying different strategies to different resolution SAR images. Finally, aiming at different types of typical false alarms, this paper proposes a comprehensive ship discrimination method in spaceborne SAR imagery based on confidence level and complexity analysis. Experimental results based on RADARSAT-1, RADARSAT-2, TerraSAR-X, RS-1, and RS-3 images demonstrate that the adaptive scheme proposed in this paper is able to detect ship targets in a fast, efficient and robust way.

  5. Fast Evaluation of Ship Responses in Waves

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    2004-01-01

    The aim of the present paper is to provide a rational and efficient procedure able to predict the design wave-induced motions, accelerations and loads with sufficient engineering accuracy in the conceptual design phase and in risk assessment. The procedure relies only on the following main parame...... parameters of the ship: Length, breadth, draught, block coefficient and water plane area together with the operational profile. The formulas are semi-analytical and the calculations can be easily done using a standard spreadsheet program....

  6. Special closure for radioactive shipping container

    International Nuclear Information System (INIS)

    Otts, J.V.

    1976-03-01

    The objective of this program was to develop a special lid closure for radioactive material shipping containers, typically steel drums. Three closure techniques were designed, fabricated, and proven to be structurally adequate to protect 1000 lb when dropped 30 ft. The three designs were (1) a 6-in. lid extension (skirt), (2) a 6-in. inner lid, and (3) c-clamps used at the container/lid interface. Based upon structural integrity, economic impact, and minimal design change, the 6-in. lid extension is recommended

  7. Vibration isolation of a ship's seat

    Science.gov (United States)

    Agahi, Maryam; Samani, Mehrdad B.; Behzad, Mehdi

    2005-05-01

    Different factors cause vibration. These vibrations make the voyages difficult and reduce comfort and convenience in passenger ships. In this paper, the creating factors of vibration have discussed first, then with mathematical modelling it will be attempted to minimize the vibration over the crew's seat. The modelling consists of a system with two degrees of freedom and by using vibrationisolation with passive method of Tuned Mass Damper (TMD) it will be tried to reduce the vibration over personnel. Moreover using active control systems will be compared with passive systems.

  8. REVIEW OF AGING DATA ON EPDM O-RINGS IN THE H1616 SHIPPING PACKAGE

    Energy Technology Data Exchange (ETDEWEB)

    Skidmore, E.

    2012-03-27

    Currently, all H1616 shipping package containers undergo annual re-verification testing, including containment vessel leak testing to verify leak-tightness (<1 x 10{sup -7} ref cc/sec air) as per ANSI N14.5. The purpose of this literature review is to supplement aging studies currently being performed by SRNL on the EPDM O-rings to provide the technical basis for extending annual re-verification testing for the H1616 shipping package and to predict the life of the seals at bounding service conditions. The available data suggest that the EPDM O-rings can retain significant mechanical properties and sealing force at or below bounding service temperatures (169 F or 76 C) beyond the 1 year maintenance period. Interpretation of available data suggests that a service life of at least 2 years and potentially 4-6 years may be possible at bounding temperatures. Seal lifetimes at lower, more realistic temperatures will likely be longer. Being a hydrocarbon elastomer, EPDM O-rings may exhibit an inhibition period due to the presence of antioxidants. Once antioxidants are consumed, mechanical properties and seal performance could decline at a faster rate. Testing is being performed to validate the assumptions outlined in this report and to assess the long-term performance of O-ring seals under actual service conditions.

  9. A Way Forward for Ship Classification and Technical Services

    Directory of Open Access Journals (Sweden)

    Lam-Bee Goh

    2014-04-01

    Full Text Available Classification societies are one of key organizations that promote the highest standards in ship safety and quality shipping. The paper reviews the ship classification industry and identifies what the classification societies can do to add value to the maritime industry more effectively. To meet this objective, an analysis of the five competitive forces is carried out, together with an opinion survey performed on some of the leading shipping companies, to assess and to establish some of the key factors which should be considered when formulating an overall business strategy for the growth of the classification services business. The findings from the study are discussed with the strategic options and choices. A classification services industrial value chain analysis together with ship management and operation is undertaken to explore the opportunities for classification societies. These findings also provide guidance to policy-makers who design and seek to implement more effective international shipping policies.

  10. A quantitative assessment of Arctic shipping in 2010–2014

    KAUST Repository

    Eguíluz, Victor M.

    2016-08-01

    Rapid loss of sea ice is opening up the Arctic Ocean to shipping, a practice that is forecasted to increase rapidly by 2050 when many models predict that the Arctic Ocean will largely be free of ice toward the end of summer. These forecasts carry considerable uncertainty because Arctic shipping was previously considered too sparse to allow for adequate validation. Here, we provide quantitative evidence that the extent of Arctic shipping in the period 2011–2014 is already significant and that it is concentrated (i) in the Norwegian and Barents Seas, and (ii) predominantly accessed via the Northeast and Northwest Passages. Thick ice along the forecasted direct trans-Arctic route was still present in 2014, preventing transit. Although Arctic shipping remains constrained by the extent of ice coverage, during every September, this coverage is at a minimum, allowing the highest levels of shipping activity. Access to Arctic resources, particularly fisheries, is the most important driver of Arctic shipping thus far.

  11. Estimation of waves and ship responses using onboard measurements

    DEFF Research Database (Denmark)

    Montazeri, Najmeh

    This thesis focuses on estimation of waves and ship responses using ship-board measurements. This is useful for development of operational safety and performance efficiency in connection with the broader concept of onboard decision support systems. Estimation of sea state is studied using a set...... of measured ship responses, a parametric description of directional wave spectra (a generalised JONSWAP model) and the transfer functions of the ship responses. The difference between the spectral moments of the measured ship responses and the corresponding theoretically calculated moments formulates a cost...... information. The model is tested on simulated data based on known unimodal and bimodal wave scenarios. The wave parameters in the output are then compared with the true wave parameters. In addition to the numerical experiments, two sets of full-scale measurements from container ships are analysed. Herein...

  12. Some considerations on the safety of nuclear ships

    International Nuclear Information System (INIS)

    Kuramoto, Masaaki

    1978-01-01

    For realizing the practical utilization of nuclear merchant ships, it is essential to gain their acceptance by maritime countries on an equal footing with conventional vessels, and to have the administrative procedures for their admission simplified. This, however cannot be expected to be attained overnight, and progressive measures will have to be adopted, to approach the ultimate goal step by step. The first step should be to demonstrate the safety of nuclear propulsion, for which nuclear ships must accumulate their mileages of safe service. The second important step is to simplify the procedures demanded of nuclear ships for access to ports, through the establishment of international safety standards and design criteria, the enforcement of safety measures covering the entrance of nuclear ships into ports, and the assurance of safety in he repair, inspection and refuelling operations of these ships. Among these measures, the considerations relevant to port entry are the subject of vital interest to both ship operators and port authorities

  13. The world's first supply ship powered by natural gas

    International Nuclear Information System (INIS)

    2003-01-01

    The article describes the newly developed natural gas powered supply ship ''Viking Energy'', which reduces the emission of NOx by 200 tonnes per year. The shipping company has for many years been working on the developing of environmentally friendly ships with less fuel consumption. The gas is stored in liquid form at a temperature of 160 o C. The engines can run on gas or diesel as needed. These dual-fuel engines offers great flexibility, which is very desirable since liquid natural gas is not widely available along the coast. This type of engine has been used in power stations and on offshore platforms, but not in ships. The operating conditions are quite different for ships than for power stations. So far, both investment and operating costs are higher than for conventional ships

  14. Global ship accidents and ocean swell-related sea states

    Science.gov (United States)

    Zhang, Zhiwei; Li, Xiao-Ming

    2017-11-01

    With the increased frequency of shipping activities, navigation safety has become a major concern, especially when economic losses, human casualties and environmental issues are considered. As a contributing factor, the sea state plays a significant role in shipping safety. However, the types of dangerous sea states that trigger serious shipping accidents are not well understood. To address this issue, we analyzed the sea state characteristics during ship accidents that occurred in poor weather or heavy seas based on a 10-year ship accident dataset. Sea state parameters of a numerical wave model, i.e., significant wave height, mean wave period and mean wave direction, were analyzed for the selected ship accident cases. The results indicated that complex sea states with the co-occurrence of wind sea and swell conditions represent threats to sailing vessels, especially when these conditions include similar wave periods and oblique wave directions.

  15. Structural analysis of a ship on global aspect using ANSYS

    Science.gov (United States)

    Rahman, M. Muzibur; Kamol, Rajia Sultana; Islam, Reyana

    2017-12-01

    Ship is a complex geometry which undergoes a combination of loadings such as hydrostatic, hydrodynamic, wind, wave etc. at sea and thus adequate strength in a ship has always been one of the most challenging tasks for the ship designers. International Maritime Organization (IMO) and classification societies are providing the standards to ensure the adequacy of strength for the ship against all demands throughout its service life. Thus, structural analysis is needed to assess the overall strength of hull, and the means in this regard are based on finite element method which may be applied either local or global aspect of the ship. This paper is an attempt to carry out the structural analysis of a ship in global aspect using ANSYS software to locate the most stress concentration and deformed area, which will have ultimate effect on fatigue fracture.

  16. Game Strategies of Ship in the Collision Situations

    Directory of Open Access Journals (Sweden)

    Jozef Lisowski

    2014-03-01

    Full Text Available The paper introduced the basic model of process of safe ship control in a collision situation using a game model with j objects, which includes non-linear state equations and non-linear, time varying constraints of the state variables as well as the quality game control index in the forms of the game integral payment and the final payment. Approximated model of the process control as the model of multi-step matrix game in the form of dual linear programming problem has been adopted here. The Game Ship Control GSC computer program has been designed in the Matlab/Simulink software in order to determine the own ship's safe trajectory. These considerations have been illustrated with examples of a computer simulation using an GSC program for determining the safe ship's trajectory in real navigational situation. Simulation research were passed for five sets of strategies of the own ship and met ships.

  17. Global ship accidents and ocean swell-related sea states

    Directory of Open Access Journals (Sweden)

    Z. Zhang

    2017-11-01

    Full Text Available With the increased frequency of shipping activities, navigation safety has become a major concern, especially when economic losses, human casualties and environmental issues are considered. As a contributing factor, the sea state plays a significant role in shipping safety. However, the types of dangerous sea states that trigger serious shipping accidents are not well understood. To address this issue, we analyzed the sea state characteristics during ship accidents that occurred in poor weather or heavy seas based on a 10-year ship accident dataset. Sea state parameters of a numerical wave model, i.e., significant wave height, mean wave period and mean wave direction, were analyzed for the selected ship accident cases. The results indicated that complex sea states with the co-occurrence of wind sea and swell conditions represent threats to sailing vessels, especially when these conditions include similar wave periods and oblique wave directions.

  18. Study of Volatility of New Ship Building Prices in LNG Shipping

    Directory of Open Access Journals (Sweden)

    T. Bangar Raju

    2016-12-01

    Full Text Available The natural gas market has been expanding in size and has attracted particular attention across the global energy market. Although most natural gas transportation is carried out through pipelines, almost one third of it is done with the help of merchant vessels, capable of carrying liquefied natural gas. These LNG carriers have a special design and thus can be treated as a separate class of global fleet. New vessels are huge capital investments by vessel owning companies and just like other vessel classes; the new shipbuilding prices for the LNG segment continue to be a key aspect in the decision making of business players. Additionally these prices can be volatile as new ship building prices fluctuate with time. This paper attempts to analyse the volatility of new ship building prices of LNG carriers. For the study, the average ship building prices for all the LNG carriers having volume carrying capacity is between 160,000 – 173,000 cbm to be delivered between 2016 – 2019 were taken into account. For the analysis, GARCH and EGARCH methods were applied on the data set. The analysis concluded that there is a great deal of volatility in the new ship building prices of LNG vessels. It was also identified that negative shocks were more persistent the positive shocks.

  19. The Ship of Classics: The Ark, the Titanic, or the Good Ship Lollipop?

    Science.gov (United States)

    Wolverton, Robert E.

    Various problems confronting teachers of the classics are explored through frequent reference to the metaphor of the classics viewed as a sailing ship in a sea of troubled waters. Several of the difficulties confronting classics teachers are seen to be related to an anti-intellectual mood prevailing in academe, scheduling problems, shifting school…

  20. Advanced Demonstration of Motion Correction for Ship-to-Ship Passive Inspections

    Energy Technology Data Exchange (ETDEWEB)

    Ziock, Klaus-Peter [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boehnen, Chris Bensing [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ernst, Joseph [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2013-09-30

    Passive radiation detection is a key tool for detecting illicit nuclear materials. In maritime applications it is most effective against small vessels where attenuation is of less concern. Passive imaging provides: discrimination between localized (threat) and distributed (non-threat) sources, removal of background fluctuations due to nearby shorelines and structures, source localization to an individual craft in crowded waters, and background subtracted spectra. Unfortunately, imaging methods cannot be easily applied in ship-to-ship inspections because relative motion of the vessels blurs the results over many pixels, significantly reducing sensitivity. This is particularly true for the smaller water craft where passive inspections are most valuable. In this project we performed tests and improved the performance of an instrument (developed earlier under, “Motion Correction for Ship-to-Ship Passive Inspections”) that uses automated tracking of a target vessel in visible-light images to generate a 3D radiation map of the target vessel from data obtained using a gamma-ray imager.