Wamhoff, Steve; Wiseman, Michael
Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults
SSI's International Development Co-operation (SIUS). Annual report 1998
International Nuclear Information System (INIS)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
Ship-source oil pollution fund : annual report 1997-1998
International Nuclear Information System (INIS)
1998-01-01
The Ship-source Oil Pollution Fund (SOPF) receives reports of oil pollution caused by ships in Canadian waters. The reports come from a variety of sources, including individuals who wish to be advised whether they are entitled for consideration under the Canada Shipping Act as potential claimants as a result of oil pollution damage and expenses they have suffered. The SOPF fully investigates all such reports and inquiries. A summary of each investigation that fall within the SOPF purview is provided in this report. This recitation includes a number of references to incidents dating as far back as the 1970s, providing for each incident the name of the ship, a summary of the incident, the damage caused, and the claims received and paid out by the fund. The balance of the SOPF on March 31, 1998 was just over $268 million. As of April 1, 1998 the maximum liability of the SOPF is about $128 million for all claims in respect of any one oil spill. The amount of liability is indexed annually to the consumer price index. 1 fig., 1 tab
Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji
2007-06-01
We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.
SSI`s International Development Co-operation (SIUS). Annual report 1998
Energy Technology Data Exchange (ETDEWEB)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
2010-10-01
... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU
SSI's review of SKB's RDandD Program 2007
International Nuclear Information System (INIS)
Wiebert, Anders
2008-05-01
In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict
Lifescience Database Archive (English)
Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056
SSI's Review of RD and D Programme 98
International Nuclear Information System (INIS)
1999-06-01
The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.
Science teachers teaching socioscientific issues (SSI): Four case studies
Lee, Hyunju
Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they
International Nuclear Information System (INIS)
Lundeen, J.E.
1994-01-01
The purpose of this report is to compile date generated during the first annual tests and inspections of the Benificiai Uses Shipping System (BUSS) Cask. In addition, this report will verify that the testing criteria identified in chapter 8 of the BUSS Cask Safety Analysis Report for Packaging (SARP) was met. Section 8.2 ''Maintenance and Periodic Inspection Program'' of the BUSS Cask SARP requires that the following tests and inspections be performed on an annual basis: Hydrostatic pressure test; helium leak test; dye penetrant test on the trunnions and lifting lugs; and torque test on all bolts; impact limiter inspection and weight test. The first annual inspections and testing of the BUSS Cask were completed on May 5, 1994, and met the SARP criteria
Multi-equilibrium property of metabolic networks: SSI module
Directory of Open Access Journals (Sweden)
Chen Luonan
2011-06-01
Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.
20 CFR 416.266 - Continuation of SSI status for Medicaid
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...
"Jazz Ruuler" toob dzhässi Rock Cafesse
2008-01-01
Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés
Influence of different boundary conditions on analysis of SSI
International Nuclear Information System (INIS)
Wang Jiachun
2005-01-01
In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)
Effective Strategies To Improve the Employment of SSI/SSDI Participants.
Radtke, Jean, Ed.
This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…
Annual report of Japan Nuclear Ship Development Agency
International Nuclear Information System (INIS)
1978-01-01
Works performed in fiscal 1977 concerning the nuclear ship 'Mutsu' are reported: safety inspection and shielding repair of the Mutsu; maintenance of the Mutsu and its port facilities; permissions by law; P.R. etc. on its prospective repair port; ship crew training; and, organization etc. Safety inspection of the Mutsu was carried out on its both hardware and software. For repair, a final basic design was started. Without ship operation, the Mutsu's hull, reactor plant, etc. and port facilities were subjected to maintenance works. P.R. works on its repair port concentrated on understanding of the local people. (Mori, K.)
Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.
Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F
2012-10-01
Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.
Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents
Directory of Open Access Journals (Sweden)
Ruuttu Titta
2005-02-01
Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri
2005-02-03
Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
Directory of Open Access Journals (Sweden)
Patricia Maria Sens
2011-10-01
Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte
DoSSiER: Database of Scientific Simulation and Experimental Results
Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea
2017-01-01
The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.
Energy Technology Data Exchange (ETDEWEB)
Oehlen, Elisabeth
2006-09-15
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.
Fiscal 1978 annual report of Japan Nuclear Ship Development Agency
International Nuclear Information System (INIS)
1979-01-01
In October, 1978, the nuclear ship Mutsu was moved to Sasebo Port from Ominato Port for shield repair and comprehensive safety check-up and repair; and this was a long-standing problem for the ship. In face of a new energy age, Japan Nuclear Ship Development Agency is endeavoring to bring up the nuclear ship technology in Japan to the top level in the world by successfully completing the n.s. Mutsu through perfect safety and reliability. For Japan, which is a leading country of shipbuilding and merchant shipping, the development of nuclear ships is extremely important. On the activities of the agency from April, 1978, to March, 1979, the following matters are described: safety check and shielding repair of the n.s. Mutsu; Maintenance of the n.s. Mutsu at Ominato and Sasebo ports and its sailing to Sasebo port; works at Sasebo port before and after the arrival of the n.s. Mutsu; maintenance works of the Mutsu facilities at Ominato port; governmental formalities for permission and approval; training of ship crew; administrative works. (J.P.N.)
20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...
Annual report of Japan Nuclear Ship Development Agency, 1980
International Nuclear Information System (INIS)
1981-01-01
Japan Nuclear Ship Development Agency executed the works centering around the repair of shielding and the general inspection on safety of the nuclear-Ship Mutsu in the fiscal year 1980. On the other hand, the law revising the law concerning Japan Nuclear Ship Development Agency was enforced, and the Agency was entitled to carry out the research and investigation required for the development of new nuclear ships. As for the repair of reactor shielding, the alteration of the reactor installation was permitted in November, 1979, and the design and the method of construction were approved in August, 1980. The preparatory works were carried out from April to August, 1980, prior to the main works. The repair works were started in August, and the new shields have been manufactured, while the existing shields and the equipments in the containment vessel were removed. The completed new shields have been installed successively in the containment vessel. It was confirmed that there is no problem in the safety of the nuclear ship Mutsu, as the result of the general inspection on safety completed in June, 1980. Maintenance works were carried out for the Mutsu and the normally berthing port. The periodic measurement of radiation dose rate, the selection of the new normally berthing port, the research and development of nuclear ships and others are also reported. (Kako, I.)
Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor
DEFF Research Database (Denmark)
Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten
2008-01-01
The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...
Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...
46 CFR 167.15-20 - Inspections of nautical school ships.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Inspections of nautical school ships. 167.15-20 Section... NAUTICAL SCHOOL SHIPS Inspections § 167.15-20 Inspections of nautical school ships. (a) At each annual inspection, or oftener if deemed necessary, the inspector will inspect the hull, boilers, machinery...
Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...
49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...
Han, Chang Wan; Ortalan, Volkan
2015-09-01
We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.
Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model
Institute of Scientific and Technical Information of China (English)
Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi
2013-01-01
The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.
International Nuclear Information System (INIS)
Oehlen, Elisabeth
2006-09-01
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect
2010-10-01
... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...
SSI's review of SKB's RD and D programme 2001
Energy Technology Data Exchange (ETDEWEB)
Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others
2002-08-01
In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.
46 CFR 167.15-10 - Application for annual inspection.
2010-10-01
... NAUTICAL SCHOOL SHIPS Inspections § 167.15-10 Application for annual inspection. Application in writing for the annual inspection of every nautical school ship required to be inspected by law and the... Inspection, at any local Marine Inspection Office, U.S. Coast Guard, where the nautical school ship may be...
Preoperative antiseptic skin preparations and reducing SSI.
Al Maqbali, Mohammed Abdullah
Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.
Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io
Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.
2005-01-01
Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.
2015-03-19
Department per patient per admission. Device- and procedure-associated metrics (CLABSI, VAP , SSI) require the use of International Classification of...Overall Prevalence 0.28 HO Bacteremia 0.002 HO UTI 0.008 CLABSI -- VAP -- SSI 0.01 Per 100 Procedures per 1,000 Patient -Days...policy or position of the Department of the Navy, Department of Defense, nor the U.S. Government. i MDRGNB/CRE Infections in the DON: Annual
SSI's review of ASAR Oskarshamn 1
International Nuclear Information System (INIS)
Godaas, T.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
Energy Technology Data Exchange (ETDEWEB)
Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others
2005-06-01
In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.
Hirave, Vivek; Kalyanshetti, Mahesh
2018-02-01
Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.
Püssi plaat saab 30aastaseks / Gerli Romanovitsh
Romanovitš, Gerli, 1977-
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas
Ship-Source Oil Pollution Fund annual report, 1991-1992
International Nuclear Information System (INIS)
1992-01-01
The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1991 and ending 31 March 1992. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, United States legislation, the Haven incident, and the status of the fund. Twenty-three oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 4 figs., 1 tab
Directory of Open Access Journals (Sweden)
A. Arifi
2016-07-01
Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the
FT4 Data Analysis Summary (SSI-ARC)
Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor
2016-01-01
Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.
Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses
International Nuclear Information System (INIS)
Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee
2016-01-01
The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45
Contini, Daniele; Gambaro, Andrea; Donateo, Antonio; Cescon, Paolo; Cesari, Daniela; Merico, Eva; Belosi, Franco; Citron, Marta
2015-02-01
Ships and harbour emissions are currently increasing, due to the increase of tourism and trade, with potential impact on global air pollution and climate. At local scale, in-port ship emissions influence air quality in coastal areas impacting on health of coastal communities. International legislations to reduce ship emissions, both at Worldwide and European levels, are mainly based on the use of low-sulphur content fuel. In this work an analysis of the inter-annual trends of primary contribution, ε, of tourist shipping to the atmospheric PM2.5 concentrations in the urban area of Venice has been performed. Measurements have been taken in the summer periods of 2007, 2009 and 2012. Results show a decrease of ε from 7% (±1%) in 2007 to 5% (±1%) in 2009 and to 3.5% (±1%) in 2012. The meteorological and micrometeorological conditions of the campaigns were similar. Tourist ship traffic during measurement campaigns increased, in terms of gross tonnage, of about 25.4% from 2007 to 2009 and of 17.6% from 2009 to 2012. The decrease of ε was associated to the effect of a voluntary agreement (Venice Blue Flag) for the use of low-sulphur content fuel enforced in the area between 2007 and 2009 and to the implementation of the 2005/33/CE Directive in 2010. Results show that the use of low-sulphur fuel could effectively reduce the impact of shipping to atmospheric primary particles at local scale. Further, voluntary agreement could also be effective in reducing the impact of shipping on local air quality in coastal areas.
Internationalisation Within Liner Shipping
DEFF Research Database (Denmark)
Prockl, Günter; Kinra, Aseem; Kotzab, Herbert
2018-01-01
, the degree of internationalisation, measured on the basis of sea-oriented operations, differs from that measured according to land-oriented front-end marketing and sales activities. The purpose of this study is to further examine the internationalisation patterns of shipping lines. An examination...... of the front-end activities and the structures of leading container-shipping companies is conducted. The sales office networks of the sector’s 20 largest companies worldwide (by twenty-foot equivalent unit capacity) are analysed as key indicators. The numbers of sales offices are measured by analysing...... the websites of the sample (20 companies), as well as annual reports and other publicly available data sources. The findings show that not all shipping companies are international, by virtue of the industry. While it is difficult to observe differences in the overall patterns of the sales networks at a macro...
The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions
Li, Q.
2016-12-01
The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study
ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI
Directory of Open Access Journals (Sweden)
Rohini Murlidhar Gajbhiye
2017-02-01
Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20
Ship-Source Oil Pollution Fund annual report, 1992-1993
International Nuclear Information System (INIS)
1993-01-01
The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1992 and ending 31 March 1993. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, major international incidents, the International Conference on the Revision of the 1969 Civil Liability Convention and the 1971 Fund Convention, the 1993 Oil Spill Conference, and the status of the fund. Twenty-nine oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 3 figs
2009-12-01
The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.
Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R
2018-04-01
Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.
The SSI reviews of the SKB research programs 1992
International Nuclear Information System (INIS)
Jensen, Mikael.
1993-02-01
The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs
2011-01-05
... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...
SSI's review of ASAR Ringhals 2, 1994
International Nuclear Information System (INIS)
Hofvander, P.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjorrn
2007-09-15
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.
Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model
International Nuclear Information System (INIS)
Kang, Joo-Hyung; Lee, Sang-Hoon
2008-01-01
Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated
Annual report of the Japan Nuclear Ship Development Agency, 1979
International Nuclear Information System (INIS)
1980-01-01
The pending repair work of the shielding of the nuclear ship ''Mutsu'' was started at long last, and the development of nuclear ships in Japan is to be accelerated again. The Agency intends to exert more efforts to execute the repair of shielding and the works of the general inspection on safety for ''Mutsu'' rapidly and surely and to attain the expected objective. The energy situation in the world is still in confusion, and all countries, advanced and developing alike, are carrying out the researches to develop and utilize substitute energy. Especially large expectation is entertained in atomic energy which can fill the energy gap for the time being, and the policy to promote positively the improvement of safety and the development of the application to new fields is being taken. In such situation, the Atomic Energy Commission clarified the policy to positively promote the research and development on nuclear ships including the design of new nuclear reactors considering their necessity to relax the restriction of energy supply. As for the ''Mutsu'', the AEC insists that the repair should be completed and the operation test must be executed urgently. Concerning the organization for the research and development, the Agency is to undertake the solution of the pending problems related to the ''Mutsu'', and also is required to have the functions of the research and development aiming at the improvement of the economy and reliability of nuclear ships. In this report, the works of the Agency carried out in 1979 are described. (Kako, I.)
National Oceanic and Atmospheric Administration, Department of Commerce — Following annual ship shakedown and patch tests, EX1301 will complete the comprehensive mapping of the Northeast canyons and the adjacent continental shelf carried...
Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit
2017-01-23
There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
2018-01-01
Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to
Pitiporntapin, Sasithep; Lankford, Deanna Marie
2015-01-01
This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…
Estimation of shipping emissions in Candarli Gulf, Turkey.
Deniz, Cengiz; Kilic, Alper; Civkaroglu, Gökhan
2010-12-01
Ships are significant air pollution sources as their high powered main engines often use heavy fuels. The major atmospheric components emitted are nitrogen oxides, particulate matter (PM), sulfur oxide gases, carbon oxides, and toxic air pollutants. Shipping emissions cause severe impacts on health and environment. These effects of emissions are emerged especially in territorial waters, inland seas, canals, straits, bays, and port regions. Candarli Gulf is one of the major industrial regions on the Aegean side of Turkey. The marine environment of the region is affected by emissions from ships calling to ten different ports. In this study, NO( x ), SO(2), CO(2), hydrocarbons (HC), and PM emissions from 7,520 ships are estimated during the year of 2007. These emissions are classified regarding operation modes and types of ships. Annual shipping emissions are estimated as 631.2 t year(-1) for NO(x), 573.6 t year(-1) for SO(2), 33,848.9 t year(-1) for CO(2), 32.3 t year(-1) for HC, and 57.4 t year(-1) for PM.
SSI analysis of a massive concrete structure based on a novel ...
Indian Academy of Sciences (India)
1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...
Galileo SSI Observations of Io During Orbits C30 I33
Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.
2002-01-01
New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.
Annual report of the Japan Nuclear Ship Research and Development Agency, for fiscal 1981
International Nuclear Information System (INIS)
1982-01-01
All the works of shielding repair and safety general inspection for the nuclear ship ''Mutsu'' were completed. For advancing the research and development of nucear ships, of course, the data and experience of the behavior of marine nuclear reactors are required, which can be obtained only by operating nuclear ships. The Agency will carry out the experimental voyage after the prescribed tests are finished, and endeavor to attain the objective. A new development was observed on the new home port for the Mutsu. In May, 1981, the agreement was reached among those concerned to decide Sekine Beach, Mutsu City, as the candidate site after the survey and coordination, and to construct the home port as early as possible. The Agency carried out the survey required for the location, and reported in March, 1982, that the construction of the home port is technically feasible, and also the concept of the home port and the incidental facilities on land was informed to Aomori Prefecture. Hereafter, the compensation for fishery and the purchase of land will be actively promoted. In order to ease the restriction on the energy supply for shipping industry, the technical basis for the practical use of nuclear ships must be urgently consolidated. In this report, the works performed by the Agency in fiscal 1981 are described. (Kako, I.)
Directory of Open Access Journals (Sweden)
A. Cahyarini
2016-11-01
Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills ( = 74,95 than both the student who learned using 5E LC model ( = 74,17 and the student who learned using conventional method ( = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However, there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.
NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2
National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...
International Nuclear Information System (INIS)
Dverstorp, Bjorrn
2007-09-01
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009
20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.
2010-04-01
... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...
Green Shipping Practices of Shipping Firms
Directory of Open Access Journals (Sweden)
Young-Tae Chang
2017-05-01
Full Text Available The primary objective of this study is to provide an empirical research using structural equation modeling to identify the factors that motivate shipping firms to adopt green shipping practices (GSP. Furthermore, it also examines if adopting GSP can enhance the shipping firms’ environmental and productivity performance. The findings show that shipping firms are motivated to adopt GSP mostly by industrial norms set by institutionalized associations. They are also motivated by customers’ demand for environmental friendliness and their own strategy to make good image. Unlike our expectation, government regulations and international environmental laws are not significant in influencing shipping firms to adopt GSP. Moreover, adoption of green shipping practices can improve the environmental and productivity performance of the shipping firms.
International Nuclear Information System (INIS)
Ermutlu, H.E.
1993-01-01
In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained
International Nuclear Information System (INIS)
Llambias, J.M.
1993-01-01
The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation
Cleaner fuels for ships provide public health benefits with climate tradeoffs.
Sofiev, Mikhail; Winebrake, James J; Johansson, Lasse; Carr, Edward W; Prank, Marje; Soares, Joana; Vira, Julius; Kouznetsov, Rostislav; Jalkanen, Jukka-Pekka; Corbett, James J
2018-02-06
We evaluate public health and climate impacts of low-sulphur fuels in global shipping. Using high-resolution emissions inventories, integrated atmospheric models, and health risk functions, we assess ship-related PM 2.5 pollution impacts in 2020 with and without the use of low-sulphur fuels. Cleaner marine fuels will reduce ship-related premature mortality and morbidity by 34 and 54%, respectively, representing a ~ 2.6% global reduction in PM 2.5 cardiovascular and lung cancer deaths and a ~3.6% global reduction in childhood asthma. Despite these reductions, low-sulphur marine fuels will still account for ~250k deaths and ~6.4 M childhood asthma cases annually, and more stringent standards beyond 2020 may provide additional health benefits. Lower sulphur fuels also reduce radiative cooling from ship aerosols by ~80%, equating to a ~3% increase in current estimates of total anthropogenic forcing. Therefore, stronger international shipping policies may need to achieve climate and health targets by jointly reducing greenhouse gases and air pollution.
Ship emissions and their externalities for Greece
Tzannatos, Ernestos
2010-06-01
The existing and emerging international and European policy framework for the reduction of ship exhaust emissions dictates the need to produce reliable national, regional and global inventories in order to monitor emission trends and consequently provide the necessary support for future policy making. Furthermore, the inventories of ship exhaust emissions constitute the basis upon which their external costs are estimated in an attempt to highlight the economic burden they impose upon the society and facilitate the cost-benefit analysis of the proposed emission abatement technologies, operational measures and market-based instruments prior to their implementation. The case of Greece is of particular interest mainly because the dense ship traffic within the Greek seas directly imposes the impact of its exhaust emission pollutants (NO x, SO 2 and PM) upon the highly populated, physically sensitive and culturally precious Greek coastline, as well as upon the land and seas of Greece in general, whereas the contribution of Greece in the global CO 2 inventory at a time of climatic change awareness cannot be ignored. In this context, this paper presents the contribution of Greece in ship exhaust emissions of CO 2, NO x, SO 2 and PM from domestic and international shipping over the last 25 years (1984-2008), utilizing the fuel-based (fuel sales) emission methodology. Furthermore, the ship exhaust emissions generated within the Greek seas and their externalities are estimated for the year 2008, through utilizing the fuel-based (fuel sales) approach for domestic shipping and the activity-based (ship traffic) approach for international shipping. On this basis, it was found that during the 1984 to 2008 period the fuel-based (fuel sales) ship emission inventory for Greece increased at an average annual rate of 2.85%. In 2008, the CO 2, NO x, SO 2 and PM emissions reached 12.9 million tons (of which 12.4 million tons of CO 2) and their externalities were found to be around 3
Kai Duan; Ge Sun; Steven G. McNulty; Peter V. Caldwell; Erika C. Cohen; Shanlei Sun; Heather D. Aldridge; Decheng Zhou; Liangxia Zhang; Yang Zhang
2017-01-01
This study examines the relative roles of cli- matic variables in altering annual runoff in the contermi- nous United States (CONUS) in the 21st century, using a monthly ecohydrological model (the Water Supply Stress In- dex model, WaSSI) driven with historical records and future scenarios constructed from 20 Coupled Model Intercompar- ison Project Phase 5 (CMIP5)...
Active Volcanism on Io as Seen by Galileo SSI
McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.
1998-01-01
Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50
Present state of Japan Nuclear Ship Development Agency
International Nuclear Information System (INIS)
Takada, Yoshio
1981-01-01
The Japan Nuclear Ship Development Agency held the annual report meeting on April 8, 1981. The main contents were the plan of research and development of nuclear ships hereafter, the present state of the repair works for the nuclear ship ''Mutsu'', the progress of the selection of the new home port and others. In the last year, the function of research was given to the Agency by the revision of the related law. The full-scale repair works for Mutsu were started in August, 1980, and various equipments and shields in the containment vessel and the upper shields of the containment vessel have been removed. Subsequently, new shields are being installed. According to the report by the committee of nuclear ship research and development, the development of Mutsu, which is valuable as the experimental ship, is continued. Moreover, it is proposed to do the research and development of an improved marine nuclear plant for the purposes of securing the economic efficiency, the proving of the reliability of nuclear merchant ships, and the establishment of safety. As the home port for Mutsu, the new port will be constructed on the open sea side in Aomori Prefecture, and as a candidate, Sekine beach in Mutsu City was named. Till the completion of the new home port, Mutsu will be berthed in Ominato home port. The conditions for entering and berthing in Ominato port will be decided later. (Kako, I.)
Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan
2017-01-01
Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…
Enhanced situational technologies applied to ship channels
Helgeson, Michael A.; Wacker, Roger A.
1997-06-01
The Houston Ship Channel ranks as America's number one port in foreign tonnage by welcoming more than 50,000 cargo ships and barges annually. Locally 196,000 jobs, 5.5 billion dollars in business revenue and 213 million dollars in taxes are generated. Unfortunately, 32 days of each year vessel traffic stops for hours due to fog causing an estimated 40- 100 million dollars loss as ships idly wait in the channel for weather to clear. In addition, poor visibility has contributed to past vessel collisions which have resulted in channel closure, and associated damage to property and the environment. Today's imaging technology for synthetic vision systems and enhanced situational awareness systems offers a new solution to this problem. Whereas, typically these systems have been targeted at aircraft landing systems the channel navigation application provides a peripheral ground based market. This paper describes two imaging solutions to the problem. One using an active 35 GHz scanning radar and the other using a 94 GHz passive millimeter wave camera.
Shielding calculations for ships carrying irradiated nuclear fuel
International Nuclear Information System (INIS)
Burstall, R.F.; Dean, M.H.
1983-01-01
A number of ships have been constructed to carry irradiated fuel from Japan to the UK and France, for reprocessing. About twenty transport flasks may be carried on each voyage. Permanent shielding must be provided on the ships to ensure that no member of the crew receives an annual dose rate greater than a specified limit. As the fuel is of varying type and radiation history, and as flasks of differing designs are used, many calculations are needed. There are a number of difficulties in making shielding calculations for the ships. The geometry is complex, dimensions are large, and considerable air spaces are involved. The paper considers possible methods of calculation. The line-of-sight method is chosen for most of the calculations, for both gamma radiation and neutrons. The basic data which is used in the calculations is described. As the methods of calculation are somewhat approximate, it is necessary to provide confirmation that they are sufficiently accurate. Validation has been provided in two ways. First, measurements have been made on board the ships, and these have been checked against calculation. Second, a simplified model of the flasks and ship has been set up, and calculations checked against more sophisticated methods. Results of the validation checks are presented, and it is shown that adequate accuracy is achieved. (author)
Shielding calculations for ships carrying irradiated nuclear fuel
International Nuclear Information System (INIS)
Dean, M.H.
1985-01-01
A number of ships have been constructed to carry irradiated fuel from Japan to the U.K. and France, for reprocessing. About 20 transport flasks may be carried on each voyage. Permanent shielding must be provided on the ships to ensure that no member of the crew receives an annual dose greater than a specified limit. As the fuel is of varying type and radiation history, and as flasks of differing designs are used, many shielding calculations are needed. There are a number of difficulties in making shielding calculations for the ships. The geometry is complex, dimensions are large and considerable air spaces are involved. The paper considers possible methods of calculation. The line-of-sight method is chosen for most of the calculations, for both γ-radiation and neutrons. The basic data which is used in the calculations is described. As the methods of calculation are somewhat approximate, it is necessary to provide confirmation that they are sufficiently accurate. Validation has been provided in two ways. First, measurements have been made on board one of the ships, Pacific Crane, and these have been checked against calculation. Second, a simplified model of the flasks and ship has been set up, and calculations checked against more sophisticated methods. Results of the validation checks are presented, and it is shown that adequate accuracy is achieved. (author)
Analysis of a ship-to-ship collision
International Nuclear Information System (INIS)
Porter, V.L.; Ammerman, D.J.
1996-01-01
Sandia National Laboratories is involved in a safety assessment for the shipment of radioactive material by sea. One part of this study is investigation of the consequences of ship-to-ship collisions. This paper describes two sets of finite element analyses performed to assess the structural response of a small freighter and the loading imparted to radioactive material (RAM) packages during several postulated collision scenarios with another ship. The first series of analyses was performed to evaluate the amount of penetration of the freighter hull by a striking ship of various masses and initial velocities. Although these analyses included a representation of a single RAM package, the package was not impacted during the collision so forces on the package could not be computed. Therefore, a second series of analyses incorporating a representation of a row of seven packages was performed to ensure direct package impact by the striking ship. Average forces on a package were evaluated for several initial velocities and masses of the striking ship. In addition to. providing insight to ship and package response during a few postulated ship collisions scenarios, these analyses will be used to benchmark simpler ship collision models used in probabilistic risk assessment analyses
International Nuclear Information System (INIS)
2000-01-01
This annual report describes the duties and responsibilities of the Ship-source Oil Pollution (SOPF) Administrator of Canada, which includes investigating and assessing all claims filed against SOPF, and reviewing the activities of the the International Oil Pollution Compensation (IOPC) Fund in his capacity as leader of the Canadian delegation to the Assembly of IOPC Funds. The annual review also provides a summary of all active Canadian ship-source oil spill claims. A variety of issues and challenges facing SOPF are highlighted. Among these are the Arctic Response Strategy of the Canadian Coast Guard; port reception facilities for oily waste; illegal discharge of oily waste at sea; oil spill response regime changes; limitations of ship-owners' liability; and changes in IOPC regime and its impact on SOPF. Various visits to Canadian response organizations, and attendance by the SOPF Administrator during the year at seminars on oil spills, freshwater spills, and natural resource damage assessment are reviewed. There is also a review of SOPF financial obligations to the IOPC Fund, and a summary of expenditures incurred. Appendices contain extended summaries of the International Compensation regime, brief summaries of the meetings of the 1971 and the 1992 IOPC Fund Executive Committee and Assembly sessions, changes introduced by the 1992 protocols, and lists of contracting states to the 1992 and the 1969/1971 protocols. 6 appendices
46 CFR 2.10-105 - Prepayment of annual vessel inspection fees.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Prepayment of annual vessel inspection fees. 2.10-105... VESSEL INSPECTIONS Fees § 2.10-105 Prepayment of annual vessel inspection fees. (a) Vessel owners may prepay the annual vessel inspection fee for any period of not less than three years, and not more than...
Identification and quantification of shipping emissions in Bohai Rim, China
International Nuclear Information System (INIS)
Zhang, Fan; Chen, Yingjun; Tian, Chongguo; Wang, Xiaoping; Huang, Guopei; Fang, Yin; Zong, Zheng
2014-01-01
Rapid development of port and shipbuilding industry in China has badly affected the ambient air quality of coastal zone due to shipping emissions. A total of 60 ambient air samples were collected from background site of Tuoji Island in Bohai Sea strait. The air samples were analyzed for PM 2.5 , organic carbon (OC), element carbon (EC), inorganic elements, and water-soluble ions. The maximum concentration of PM 2.5 was observed during spring (73.6 μg·m −3 ) compared to winter (39.0 μg·m −3 ) with mean of 54.6 μg·m −3 . Back trajectory air mass analysis together with temporal distribution of vanadium (V) showed that V could be the typical tracer of shipping emissions at Tuoji Island. Furthermore, the ratios of vanadium to nickel (V/Ni), vanadium to lead (V/Pb) and vanadium to zinc (V/Zn) also suggest shipping emissions at Tuoji Island. The annual average primary PM 2.5 estimate of shipping emissions was 0.65 μg·m −3 at Tuoji Island, accounting for 2.94% of the total primary PM 2.5 , with a maximum of 3.16% in summer and a minimum of 2.39% in autumn. - Highlights: • Tracers of shipping emissions in coastal zone of northern China were identified. • Contributions of shipping emissions on primary PM 2.5 were estimated. • Shipping emissions accounted for 2.94% of primary PM 2.5 apart from fishing boats. • Impact of shipping emissions on coastal zone increased rapidly in recent years
Effect of the gate scaling on the analogue performance of s-Si CMOS devices
International Nuclear Information System (INIS)
Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E
2011-01-01
In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts
Towards Real Time Simulation of Ship-Ship Interaction
DEFF Research Database (Denmark)
Lindberg, Ole; Bingham, Harry B.; Engsig-Karup, Allan Peter
2012-01-01
We present recent and preliminary work directed towards the development of a simplified, physics-based model for improved simulation of ship-ship interaction that can be used for both analysis and real-time computing (i.e. with real-time constraints due to visualization). The goal is to implement...... accurate (realistic) and much faster ship-wave and ship-ship simulations than are currently possible. The coupling of simulation with visualization should improve the visual experience such that it can be perceived as more realistic in training. Today the state-of-art in real-time ship-ship interaction...... is for efficiency reasons and time-constraints in visualization based on model experiments in towing tanks and precomputed force tables. We anticipate that the fast, and highly parallel, algorithm described by Engsig-Karup et al. [2011] for execution on affordable modern high-throughput Graphics Processing Units...
Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...
SSI response of a typical shear wall structure. Volume 1
International Nuclear Information System (INIS)
Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.
1984-04-01
The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables
The shipping man adventures in ship finance
McCleery, Matthew
2013-01-01
When restless New York City hedge fund manager Robert Fairchild watches the Baltic Dry Cargo Index plunge 97%, registering an all-time high and a 25-year low within the span of just six months, he decides to buy a ship. Immediately fantasizing about naming a vessel after his wife, carrying a string of worry beads and being able to introduce himself as a "shipowner" at his upcoming college reunion, Fairchild immediately embarks on an odyssey into the most exclusive, glamorous and high stakes business in the world. From pirates off the coast of Somalia and on Wall Street to Greek and Norwegian shipping magnates, the education of Robert Fairchild is an expensive one. In the end, he loses his hedge fund, but he gains a life - as a Shipping Man. Part fast paced financial thriller, part ship finance text book, The Shipping Man is 310 pages of required reading for anyone with an interest in capital formation for shipping.
International Nuclear Information System (INIS)
Spears, Robert Edward; Coleman, Justin Leigh
2015-01-01
Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This
Are nuclear ships environmentally safer than conventionally powered ships
International Nuclear Information System (INIS)
Bone, C.A.; Molgaard, C.A.; Helmkamp, J.C.; Golbeck, A.L.
1988-01-01
An epidemiologic analysis was conducted to determine if risk of hospitalization varied by age, ship type, or occupation between nuclear and conventional powered ship crews in the U.S. Navy. Study cohorts consisted of all male enlisted personnel who served exclusively aboard conventional or nuclear powered aircraft carriers and cruisers during the years 1975-1979; cases were those men hospitalized during this period (N = 48,242). Conventional ship personnel showed significantly elevated rates of injury and disease when compared to nuclear ship personnel. The largest relative risks by age occurred for conventional ship crewmen less than 30 years old. Seaman, logistics (supply), and healthcare personnel serving aboard conventional ships comprised the occupational groups exhibiting the highest hospitalization rate differentials. The results strongly suggest that nuclear ships provide a healthier, safer working and living environment than conventional ships
Wijnolst, N.; Wergeland, T.
1996-01-01
Shipping is a multi-faceted industry which is rather complex to define from an academic point of view. This book attempts to grasp these complexities and provide the reader with an overview of the main topics and terminology in shipping. The book is based on material from our courses in shipping at
Identification and quantification of shipping emissions in Bohai Rim, China
Energy Technology Data Exchange (ETDEWEB)
Zhang, Fan [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Chen, Yingjun, E-mail: yjchen@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Tian, Chongguo, E-mail: cgtian@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Wang, Xiaoping [University of Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou, Guangdong 510640 (China); Huang, Guopei; Fang, Yin; Zong, Zheng [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)
2014-11-01
Rapid development of port and shipbuilding industry in China has badly affected the ambient air quality of coastal zone due to shipping emissions. A total of 60 ambient air samples were collected from background site of Tuoji Island in Bohai Sea strait. The air samples were analyzed for PM{sub 2.5}, organic carbon (OC), element carbon (EC), inorganic elements, and water-soluble ions. The maximum concentration of PM{sub 2.5} was observed during spring (73.6 μg·m{sup −3}) compared to winter (39.0 μg·m{sup −3}) with mean of 54.6 μg·m{sup −3}. Back trajectory air mass analysis together with temporal distribution of vanadium (V) showed that V could be the typical tracer of shipping emissions at Tuoji Island. Furthermore, the ratios of vanadium to nickel (V/Ni), vanadium to lead (V/Pb) and vanadium to zinc (V/Zn) also suggest shipping emissions at Tuoji Island. The annual average primary PM{sub 2.5} estimate of shipping emissions was 0.65 μg·m{sup −3} at Tuoji Island, accounting for 2.94% of the total primary PM{sub 2.5}, with a maximum of 3.16% in summer and a minimum of 2.39% in autumn. - Highlights: • Tracers of shipping emissions in coastal zone of northern China were identified. • Contributions of shipping emissions on primary PM{sub 2.5} were estimated. • Shipping emissions accounted for 2.94% of primary PM{sub 2.5} apart from fishing boats. • Impact of shipping emissions on coastal zone increased rapidly in recent years.
On the Global Ship Hull Bending Energy in Ship Collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Li, Y.
2004-01-01
During ship collisions part of the kinetic energy of the involved vessels prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can be stored in elastic...... hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non trivial part of the energy released for structural deformation during the collision can be absorbed as elastic energy in global...... ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship-ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing is confined...
Climate and air quality trade-offs in altering ship fuel sulfur content
Partanen, A.-I.; Laakso, A.; Schmidt, A.; Kokkola, H.; Kuokkanen, T.; Pietikäinen, J.-P.; Kerminen, V.-M.; Lehtinen, K. E. J.; Laakso, L.; Korhonen, H.
2013-08-01
Aerosol particles from shipping emissions both cool the climate and cause adverse health effects. The cooling effect is, however, declining because of shipping emission controls aiming to improve air quality. We used an aerosol-climate model ECHAM-HAMMOZ to test whether by altering ship fuel sulfur content, the present-day aerosol-induced cooling effect from shipping could be preserved while at the same time reducing premature mortality rates related to shipping emissions. We compared the climate and health effects of a present-day shipping emission scenario with (1) a simulation with strict emission controls in the coastal waters (ship fuel sulfur content of 0.1%) and twofold ship fuel sulfur content compared to current global average of 2.7% elsewhere; and (2) a scenario with global strict shipping emission controls (ship fuel sulfur content of 0.1% in coastal waters and 0.5% elsewhere) roughly corresponding to international agreements to be enforced by the year 2020. Scenario 1 had a slightly stronger aerosol-induced radiative flux perturbation (RFP) from shipping than the present-day scenario (-0.43 W m-2 vs. -0.39 W m-2) while reducing premature mortality from shipping by 69% (globally 34 900 deaths avoided per year). Scenario 2 decreased the RFP to -0.06 W m-2 and annual deaths by 96% (globally 48 200 deaths avoided per year) compared to present-day. A small difference in radiative effect (global mean of 0.04 W m-2) in the coastal regions between Scenario 1 and the present-day scenario imply that shipping emission regulation in the existing emission control areas should not be removed in hope of climate cooling. Our results show that the cooling effect of present-day emissions could be retained with simultaneous notable improvements in air quality, even though the shipping emissions from the open ocean clearly have a significant effect on continental air quality. However, increasing ship fuel sulfur content in the open ocean would violate existing
On the global ship hull bending energy in ship collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Li, Yujie
2009-01-01
During ship collisions part of the kinetic energy of the involved vessels immediately prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can...... be stored in elastic hull vibrations during a ship collision. When a ship side is strengthened in order to improve the crashworthiness it has been argued in the scientific literature that a non-trivial part of the energy released for structural deformation during the collision can be absorbed as elastic...... energy in global ship hull vibrations, such that with strong ship sides less energy has to be spent in crushing of the striking ship bow and/or the struck ship side. In normal ship–ship collision analyses both the striking and struck ship are usually considered as rigid bodies where structural crushing...
Directory of Open Access Journals (Sweden)
Antonio Granero-Gallegos
2013-03-01
Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.
Energy Technology Data Exchange (ETDEWEB)
Avila Moreno, R.; Barrdahl, R.; Haegg, C.
1995-05-01
The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.
Broome, Richard A; Cope, Martin E; Goldsworthy, Brett; Goldsworthy, Laurie; Emmerson, Kathryn; Jegasothy, Edward; Morgan, Geoffrey G
2016-02-01
This study investigates the mortality effect of primary and secondary PM2.5 related to ship exhaust in the Sydney greater metropolitan region of Australia. A detailed inventory of ship exhaust emissions was used to model a) the 2010/11 concentration of ship-related PM2.5 across the region, and b) the reduction in PM2.5 concentration that would occur if ships used distillate fuel with a 0.1% sulfur content at berth or within 300 km of Sydney. The annual loss of life attributable to 2010/11 levels of ship-related PM2.5 and the improvement in survival associated with use of low-sulfur fuel were estimated from the modelled concentrations. In 2010/11, approximately 1.9% of the region-wide annual average population weighted-mean concentration of all natural and human-made PM2.5 was attributable to ship exhaust, and up to 9.4% at suburbs close to ports. An estimated 220 years of life were lost by people who died in 2010/11 as a result of ship exhaust-related exposure (95% CIβ: 140-290, where CIβ is the uncertainty in the concentration-response coefficient only). Use of 0.1% sulfur fuel at berth would reduce the population weighted-mean concentration of PM2.5 related to ship exhaust by 25% and result in a gain of 390 life-years over a twenty year period (95% CIβ: 260-520). Use of 0.1% sulfur fuel within 300 km of Sydney would reduce the concentration by 56% and result in a gain of 920 life-years over twenty years (95% CIβ: 600-1200). Ship exhaust is an important source of human exposure to PM2.5 in the Sydney greater metropolitan region. This assessment supports intervention to reduce ship emissions in the GMR. Local strategies to limit the sulfur content of fuel would reduce exposure and will become increasingly beneficial as the shipping industry expands. A requirement for use of 0.1% sulfur fuel by ships within 300 km of Sydney would provide more than twice the mortality benefit of a requirement for ships to use 0.1% sulfur fuel at berth. Copyright © 2015 Elsevier
Effects of different SSI parameters on the floor response spectra of a nuclear reactor building
International Nuclear Information System (INIS)
Kabir, A.F.; Bolourchi, S.; Maryak, M.E.
1991-01-01
The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth
Lun, Y H Venus; Wong, Christina W Y; Cheng, T C E
2016-01-01
This book presents theory-driven discussion on the link between implementing green shipping practices (GSP) and shipping firm performance. It examines the shipping industry’s challenge of supporting economic growth while enhancing environmental performance. Consisting of nine chapters, the book covers topics such as the conceptualization of green shipping practices (GSPs), measurement scales for evaluating GSP implementation, greening capability, greening and performance relativity (GPR), green management practice, green shipping network, greening capacity, and greening propensity. In view of the increasing quest for environment protection in the shipping sector, this book provides a good reference for firms to understand and evaluate their capability in carrying out green operations on their shipping activities.
Wijnolst, N.; Wergeland, T.
1996-01-01
Shipping is a multi-faceted industry which is rather complex to define from an academic point of view. This book attempts to grasp these complexities and provide the reader with an overview of the main topics and terminology in shipping. The book is based on material from our courses in shipping at the universities in Delft and Bergen. As with our lectures, we draw upon quite a va ried material, from research studies at a high academic level to lower level student work and purely descriptive ...
International Nuclear Information System (INIS)
Espejo, R.; Gill, A.
1998-01-01
The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions
Designing Adaptable Ships: Modularity and Flexibility in Future Ship Designs
2016-01-01
with motors, belts, shafts , seals, valves, hose spindles , and switches. If ship installation is not installed, the system will be status quo. Ship...Impact: the current centrifugal purifiers (Alfa-Laval) have experienced frequent failures with motor, belts, shafts , seals, valves, hose spindles ... Designing Adaptable Ships Modularity and Flexibility in Future Ship Designs John F. Schank, Scott Savitz, Ken Munson, Brian Perkinson, James
Development of generic soil profiles and soil data development for SSI analyses
Energy Technology Data Exchange (ETDEWEB)
Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)
2014-04-01
This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.
SSI response of a typical shear wall structure
International Nuclear Information System (INIS)
Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.
1985-01-01
The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)
Energy Technology Data Exchange (ETDEWEB)
Jiven, Karl; Sjoebris, Anders [MariTerm AB, Goeteborg (Sweden); Nilsson, Maria [Lund Univ. (Sweden). Stiftelsen TEM; Ellis, Joanne; Traegaardh, Peter; Nordstroem, Malin [SSPA Sweden AB, Goeteborg (Sweden)
2004-05-01
In order to make it easier to include aspects during ship design that will improve environmental performance, general methods for life cycle calculations and a prototype tool for LCA calculations of ships and marine transportation have been developed. The base of the life cycle analyses is a comprehensive set of life cycle data that was collected for the materials and consumables used in ship construction and vessel operations. The computer tool developed makes it possible to quickly and simply specify (and calculate) the use of consumables over the vessel's life time cycle. Special effort has been made to allow the tool to be used for different types of vessels and sea transport. The main result from the project is the computer tool LCA ship, which incorporates collected and developed life cycle data for some of the most important materials and consumables used in ships and their operation. The computer application also contains a module for propulsion power calculations and a module for defining and optimising the energy system onboard the vessel. The tool itself is described in more detail in the Computer application manual. The input to the application should, as much as possible, be the kind of information that is normally found in a shipping company concerning vessel data and vessel movements. It all starts with defining the ship to be analysed and continues with defining how the ship is used over the lifetime. The tool contains compiled and processed background information about specific materials and processes (LCA data) connected to shipping operations. The LCA data is included in the tool in a processed form. LCA data for steel will for example include the environmental load from the steel production, the process to build the steel structure of the ship, the scrapping and the recycling phase. To be able to calculate the environmental load from the use of steel the total amount of steel used over the life cycle of the ship is also needed. The
20 CFR 416.1826 - Showing that you are not married when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...
Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter
Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann
2010-01-01
There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…
International Nuclear Information System (INIS)
Westerlind, M.; Hedberg, B.
2000-01-01
This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)
Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI
Directory of Open Access Journals (Sweden)
MOHD AFIFI BAHURUDIN SETAMBAH
2018-05-01
Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.
2010-01-11
... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...
Classification of Ship Routing and Scheduling Problems in Liner Shipping
DEFF Research Database (Denmark)
Kjeldsen, Karina Hjortshøj
2011-01-01
This article provides a classification scheme for ship routing and scheduling problems in liner shipping in line with the current and future operational conditions of the liner shipping industry. Based on the classification, the literature is divided into groups whose main characteristics...
Cl@ssi 2.0: experience in Emilia Romagna
Directory of Open Access Journals (Sweden)
Elena Pacetti
2013-06-01
Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.
International Nuclear Information System (INIS)
Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.
1987-01-01
This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described
Hiesinger, H.; Jaumann, R.; Neukum, G.
1993-01-01
Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.
Nuclear merchant ship propulsion
International Nuclear Information System (INIS)
Schroeder, E.; Jager, W.; Schafstall, H.G.
1977-01-01
The operation of about 300 nuclear naval vessels has proven the feasibility of nuclear ship propulsion. Until now six non military ships have been built or are under construction. In the Soviet Union two nuclear icebreakers are in operation, and a third one is under construction. In the western world three prototype merchant ships have been built. Of these ships only the NS OTTO HAHN is in operation and provides valuable experience for future large scale use of nuclear merchant ship propulsion. In many countries studies and plans are made for future nuclear merchant ships. Types of vessels investigated are large containerships, tankers and specialized ships like icebreakers or ice-breaking ships. The future of nuclear merchant ship propulsion depends on three interrelated items: (1) nuclear ship technology; (2) economy of nuclear ship propulsion; (3) legal questions. Nuclear merchant ship technology is based until now on standard ship technology and light water reactor technology. Except for special questions due to the non-stationary type of the plant entirely new problems do not arise. This has been proven by the recent conceptual licensing procedure for a large nuclear containership in Germany. The economics of nuclear propulsion will be under discussion until they are proven by the operation of privately owned lead ships. Unsolved legal questions e.g. in connection with port entry permissions are at present another problem for nuclear shipping. Efforts are made to solve these questions on an international basis. The future development of nuclear energy electricity production in large land based plants will stimulate the employment of smaller units. Any future development of long distance sea transport will have to take this opportunity of a reliable and economic energy supply into account
Risk Analysis on Ship Wreck and Container Cargo to Ship Navigation
Directory of Open Access Journals (Sweden)
Muhammad Badrus Zaman
2017-03-01
Full Text Available Wreck of a ship is an incident that must be avoided. Ship accidents are generally caused by a several cases, such as human error, natural disaster, technical errors, missed communication, poor condition of the ship, and many more. Ship wreckage have huge impact for ship navigation, environment, economics, and others. Those impact have many disadvantages for the shipowners, and also for environment. For examples the fuel spills that pollute the environment, make disturbance to sailing ship because the track for those navigation is blocked by the ship wreck and their cargo especially on shallow location (<50 m. These research will discuss the effect the container when it is floats on the sea and its interference other ships. The main objective of this study is to present a risk assessment on the environmental impact of the wreck and container cargo. Wrecks on the seabed is likely to pose a risk to passing ships. container and its contents as well as the possibility of refloat, and also their environmental risks emanating from the wreck and container cargo, such as fuels, lubricants, and chemical cargo. Variations scenario is a collision between ships that pass by floating containers. The frequency of refloating container, and the consequences of the passing ship depends on several factors, which will be the subject of research. However, because of the frequency of refloating containers is unlikely, then the risk is low and does not pose a danger to navigation. These risk assessment using risk matrix 5x5 which is the combined value of the frequency and consequences of the incident. The results of this study indicate the level of risk, whether the risk is accepted, not accepted or received by considering the costs and benefits (ALARP. To consequence, there are two parameters which energy is absorbed and the penetration occurs. The absorbed energy is divided into two, namely the energy absorbed by ship and the energy absorbed by containers. In this
Shama, Mohamed
2013-01-01
Buckling of Ship Structures presents a comprehensive analysis of the buckling problem of ship structural members. A full analysis of the various types of loadings and stresses imposed on ship plating and primary and secondary structural members is given. The main causes and consequences of the buckling mode of failure of ship structure and the methods commonly used to control buckling failure are clarified. This book contains the main equations required to determine the critical buckling stresses for both ship plating and the primary and secondary stiffening structural members. The critical buckling stresses are given for ship plating subjected to the induced various types of loadings and having the most common boundary conditions encountered in ship structures. The text bridges the gap existing in most books covering the subject of buckling of ship structures in the classical analytical format, by putting the emphasis on the practical methods required to ensure safety against buckling of ship structur...
Viking FellowSHIP: Norwegian hydrogen ship on the right course
International Nuclear Information System (INIS)
Larssen-Aas, Kari
2006-01-01
In the future fuel cells will change the world of shipping's economical conditions, and environmental effects from this industry. A new model of a hydrogen fuelled ship was presented at the ONS exhibition in Stavanger 2006. The technology may revolutionize the shipping industry. A brief description of the project is presented (ml)
International Nuclear Information System (INIS)
1978-01-01
Interest in the utilization of nuclear steam supply systems for merchant ships and icebreakers has recently increased considerably due to the sharp rise in oil prices and the continuing trend towards larger and faster merchant ships. Canada, for example, is considering construction of an icebreaker in the near future. On the other hand, an accident which could result in serious damage to or the sinking of a nuclear ship is potentially far more dangerous to the general public than a similar accident with a conventional ship. Therefore, it was very important to evaluate in an international forum the safety of nuclear ships in the light of our contemporary safety philosophy, taking into account the results of cumulative operating experience with nuclear ships in operation. The philosophy and safety requirement for land-based nuclear installations were outlined because of many common features for both land-based nuclear installations and nuclear ships. Nevertheless, essential specific safety requirements for nuclear ships must always be considered, and the work on safety problems for nuclear ships sponsored by the NEA was regarded as an important step towards developing an international code of practice by IMCO on the safety of nuclear merchant ships. One session was devoted to the quantitative assessment of nuclear ship safety. The probability technique of an accident risk assessment for nuclear power plants is well known and widely used. Its modification, to make it applicable to nuclear propelled merchant ships, was discussed in some papers. Mathematical models for describing various postulated accidents with nuclear ships were developed and reported by several speakers. Several papers discussed a loss-of-coolant accident (LOCA) with nuclear steam supply systems of nuclear ships and engineering design features to prevent a radioactive effluence after LOCA. Other types of postulated accidents with reactors and systems in static and dynamic conditions were also
1995-01-01
George T. McKaige, USN *CAPT Frederick P. Milwer, USAF CAPT Alan W. Hassebrock, USAF CAPT Charles P. Guard , USAF CAPT”John D. Shewchuk, USAF ENS Edward...Det 1, lWW - USAF 1977 ANNUAL TYPHOON REPORT *Departed during 1977 season FRONTCOVER: ln&a.tedphoztogzaphof a - tmJ -A.toZmb.iaZatAn o.ulh a M dtig -&A...ships provide day and night coverage in the JTWC area of responsibility. Interpretation of this satellite imagery pro- vides cyclone positions, and for
Report on the 95th annual meeting of MSNS
Energy Technology Data Exchange (ETDEWEB)
1982-09-01
Coal recovery from coal wastes, acid rain, marketing and shipping Cape Breton coal, and coal blending are discussed briefly in this account of the activities and technical sessions of the Mining Society of Nova Scotia annual meeting that was held at Ingonish Beach, June 23-26, 1982.
Recent situations around nuclear ships
International Nuclear Information System (INIS)
Mizuno, Hiroshi
1978-01-01
The philosophy when the safety standard for nuclear ships is drawn up and the international rules specifically for nuclear ships are summarized. As for the safety standard for nuclear ships, the safety requirements for ordinary ships, for the ships transporting nuclear reactors, for ordinary nuclear reactors, and for the reactors moving around the seas must be included. As for the international rules for nuclear ships, there are chapter 8 ''Nuclear ships'' in the International Convention on the Safety of Life at Sea, 1960 and 1974, and Safety Consideration in the Use of Ports and Approaches by Nuclear Merchant Ships. Also there are national rules and standards in Japan and foreign countries. One of the means to explore the practicality of nuclear ships is the investigation of the economy. At this time, the social merits and demerits of nuclear ships must be compared with conventional ships by taking total expenses into account without omission. When oil is depleted, the age of nuclear ships will not necessarily begin, and the will be still some competitors. The investigations concerning the economy of nuclear ships have been carried out in various countries. The present state of the development of nuclear ships in Japan and foreign countries is explained. Many conferences and symposia have been held concerning nuclear ships, and those held recently are enumerated. The realization of nuclear ship age cannot be anticipated from existing papers and shipbuilding projects. (Kako, I.)
DEFF Research Database (Denmark)
Jensen, Thomas
to creating a more efficient shipping industry, and a number of critical issues are identified. These include that shipments depend on shipping information, that shipments often are delayed due to issues with documentation, that EDI messages account for only a minor part of the needed information......This thesis applies theoretical perspectives from the Information Systems (IS) research field to propose how Information Technology (IT) can improve containerized shipping. This question is addressed by developing a set of design principles for an information infrastructure for sharing shipping...... information named the Shipping Information Pipeline (SIP). Review of the literature revealed that IS research prescribed a set of meta-design principles, including digitalization and digital collaboration by implementation of Inter-Organizational Systems based on Electronic Data Interchange (EDI) messages...
Energy Technology Data Exchange (ETDEWEB)
Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna
2004-09-01
The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.
A numerical study on ship-ship interaction in shallow and restricted waterway
Directory of Open Access Journals (Sweden)
Sungwook Lee
2015-09-01
Full Text Available In the present study, a numerical prediction method on the hydrodynamic interaction force and moment between two ships in shallow and restricted waterway is presented. Especially, the present study proposes a methodology to overcome the limitation of the two dimensional perturbation method which is related to the moored-passing ship interaction. The validation study was performed and compared with the experiment, firstly. Afterward, in order to propose a methodology in terms with the moored-passing ship interaction, further studies were performed for the moored-passing ship case with a Reynolds Averaged Navier-Stokes (RANS calculation which is using OpenFOAM with Arbitrary Coupled Mesh Interface (ACMI technique and compared with the experiment result. Finally, the present study proposes a guide to apply the two dimensional perturbation method to the moored-passing ship interaction. In addition, it presents a possibility that the RANS calculation with ACMI can applied to the ship-ship interaction without using a overset moving grid technique.
Nuclear ship engineering simulator
International Nuclear Information System (INIS)
Itoh, Yasuyoshi; Kusunoki, Tsuyoshi; Hashidate, Koji
1991-01-01
The nuclear ship engineering simulator, which analyzes overall system response of nuclear ship numerically, is now being developed by JAERI as an advanced design tool with the latest computer technology in software and hardware. The development of the nuclear ship engineering simulator aims at grasping characteristics of a reactor plant under the situation generated by the combination of ocean, a ship hull and a reactor. The data from various tests with the nuclear ship 'MUTSU' will be used for this simulator to modulate and verify its functions of reproducing realistic response of nuclear ship, and then the simulator will be utilized for the research and development of advanced marine reactors. (author)
International Nuclear Information System (INIS)
1978-01-01
The GKSS (Society for the Utilization of Nuclear Energy in Shipbuilding and Nautics) gives in this annual report a comprehensive survey of the research and development efforts carried out and a survey on the organisation and its sociological position. More detailed and generally explicable presentations of selected spheres of research deal this year with solid combustible neutron poisons, water desalination systems, pollution at the Elbe-mouth, trace analysis with x-ray fluor essence, heat conduction in water and under-water systems. The research and development programme is, in comparison with previous years better understandable. The range of tasks, 'utilization of nuclear energy', especially covers projects on the field of reactor safety research which were comprised in one project and fully integrated in the reactor safety programme of the Fed. Ministry for Research and Technology. Furthermore, nuclear energy ship development and works concerning working material technology are being carried out, to a smaller extent. The project of a nuclear container ship which run over a period of 5 years, was finished in 1977. Profitability calculations show that nuclear trade ships can be used in a profitable way, when the oil price has increased three-fold. This might be the case in about 15-20 years. Further plans of the GKSS on the field of nuclear energy ship development take into account this result. The range of tasks 'utilization of the sea and the shores' was comprised in a frame programme and divided in the research, fields of environment technique, water desalination, resources, and sea technique. These works are, beside reactor safety research, the main range of works of the GKSS. (orig./HK) [de
Crushing Strength of Ship Structures
DEFF Research Database (Denmark)
Cerup-Simonsen, Bo; Abramowicz, W.; Høstgaard-Brene, C.N.S.
1999-01-01
The crushing response of ship structures is of primary importance to the designers and practicing engineers concerned with accidental loading and accident reconstruction of marine vehicles. Ship to-ship collisions, ship-harbor infrastructure interaction or ship-offshore structure interaction are ...
Energy Technology Data Exchange (ETDEWEB)
Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)
1998-01-01
The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.
Development of the nuclear ship MUTSU spent fuel shipping cask
International Nuclear Information System (INIS)
Ishizuka, M.; Umeda, M.; Nawata, Y.; Sato, H.; Honami, M.; Nomura, T.; Ohashi, M.; Higashino, A.
1989-01-01
After the planned trial voyage (4700 MWD/MTU) of the nuclear ship MUTSU in 1990, her spent fuel assemblies, initially made of two types of enriched UO 2 (3.2wt% and 4.4wt%), will be transferred to the reprocessing plant soon after cooling down in the ship reactor for more than one year. For transportation, the MUTSU spent fuel shipping casks will be used. Prior to transportation to the reprocessing plant, the cooled spent fuel assemblies will be removed from the reactor to the shipping casks and housed at the spent fuel storage facility on site. In designing the MUTSU spent fuel shipping cask, considerations were given to make the leak-tightness and integrity of the cask confirmable during storage. The development of the cask and the storage function demonstration test were performed by Japan Atomic Energy Research Institute (JAERI) and Mitsubishi Heavy Industries, Ltd. (MHI). One prototype cask for the storage demonstration test and licensed thirty-five casks were manufactured between 1987 and 1988
The Administrator's Annual Report 2000-2001
International Nuclear Information System (INIS)
2001-01-01
This annual report of the Ship-Source Oil Pollution Fund (SOPF) describes the compensation regime of the Fund which may include claims for oil pollution damage; claims for costs and expenses of oil spill clean-up, including the cost of preventive measures; and claims for oil pollution damage and clean-up costs where the identity of the ship that caused the discharge cannot be established, the so-called 'mystery spills'. The main body of the report consists of descriptions of the status of oil pollution incidents brought to the attention of the Administrator. It does not include incidents which were settled directly with ship owners, hence not requiring intervention by the SOPF Administrator. The current status of recovery action by the Administrator against ship-owners is also discussed, along with the issue of port of refuge for damaged ships at sea; the continuing challenge for classification societies, and others in the marine industry to ensure construction, staffing and management of well-founded ships, so that they can be operated safely to preclude environmental damage; and international safety management principles and guidelines for the safe operation of ships and pollution prevention. Also discussed are various actions by the International Maritime Organization (IMO) to review the effectiveness and impact of the ISM code to date, the IMO's timetable for the accelerated phasing out of single hull oil tankers, the differences in handling compensation for environmental damage under the CSA (Canada Shipping Act), the IOPC (International Oil Pollution Compensation Fund) regime, and the US OPA (Oil Pollution Act). SOPF's liabilities to the International Fund, and SOPF's outreach activities during the reporting period are also discussed. A financial summary is provided. Full financial statement is said to available on request. Seven appendices contain various relevant documentation, including summaries of the proceedings of the 1971 and 1992 IOPC Fund executive
DEFF Research Database (Denmark)
Sørensen, Herman
1997-01-01
Methods for calculating natural frequencies for ship hulls and for plates and panels.Evaluation of the risk for inconvenient vibrations on board......Methods for calculating natural frequencies for ship hulls and for plates and panels.Evaluation of the risk for inconvenient vibrations on board...
Directory of Open Access Journals (Sweden)
Magdalena Klopott
2013-12-01
Full Text Available The article briefly outlines the issues concerning ship recycling. It highlights ships' high value as sources of steel scrap and non-ferrous metals, without omitting the fact that they also contain a range of hazardous substances. Moreover, the article also focuses on basic ship demolition methods and their environmental impact, as well as emphasizes the importance of “design for ship recycling” philosophy.
Nuclear ships and their safety
Energy Technology Data Exchange (ETDEWEB)
NONE
1961-04-15
Several aspects of nuclear ship propulsion, with special reference to nuclear safety, were discussed at an international symposium at Taormina, Italy, from 14-18 November 1960. Discussions on specific topics are conducted, grouped under the following headings: Economics and National Activities in Nuclear Ship Propulsion; International Problems and General Aspects of Safety for Nuclear Ships; Nuclear Ship Projects from the Angle of Safety; Ship Reactor Problems; Sea Motion and Hull Problems; Maintenance and Refuelling Problems; and Safety Aspects of Nuclear Ship Operation.
International Nuclear Information System (INIS)
2004-01-01
This 2003 annual report of the Group Total provides economical results and information of the society on the following topics: keys data, the corporate governance (Directors charter, board of directors, audit committee, nomination and remuneration committee, internal control procedures, compensation of directors and executive officers), the corporate social responsibility (environmental stewardship, the future of energy management, the safety enhancement, the human resources, ethics and local development), the investor relations, the management report, the upstream exploration and production, the downstream refining, marketing, trading and shipping, the chemicals and financial and legal information. (A.L.B.)
Cleaner shipping. Trade off between air pollution, costs and refinery CO2 emissions
International Nuclear Information System (INIS)
De Wilde, H.P.J.; Kroon, P.
2008-05-01
Still subject to final approval in October 2008, the International Maritime Organisation (IMO) agreed on a maximum sulphur content of 0.5% for shipping fuels in 2020. This target will induce major changes in the global refinery industry. We have estimated the impact on the Dutch refinery industry, which annually produces about 8 million tons of heavy fuel oil for sea shipping, with refinery residues as main component. It is technically possible to convert all residues, although this process will cause an additional energy use of about one million tons of crude oil and a related CO2 emission of about 4 million tons. The investment costs for these major changes in the Dutch refinery industry are estimated at about 1.5 tot 2 billion euros. The recent IMO agreement enables a gradual introduction of cleaner shipping fuels, which will reduce market disruptions and peak prices. Nevertheless, Rotterdam may not necessarily be able to develop a similar position in import, export and bunkering of future low sulphur fuels, compared to its present strong position in the market of heavy marine bunkers. Extrapolation of our national study to the global scale suggests that the deep conversion of 350 million tons of heavy fuel oil for shipping would require refinery investments in the order of 70-100 billion euros. The associated CO2 emissions would amount up to 175 Mton. The net additional CO2 emission, however, would be smaller since lighter shipping fuels result in less CO2 emissions at sea. On balance, we expect that the improvements in fuel economy, driven by the expensive low-carbon shipping fuels, will decrease CO2 emissions more than the increase in CO2 emissions from additional desulphurization in the refineries. Nevertheless CO2 emissions from sea shipping will continue to increase since marine transport is rapidly growing
The final Galileo SSI observations of Io: Orbits G28-I33
Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.
2004-01-01
We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.
Approximate Method of Calculating Forces on Rudder During Ship Sailing on a Shipping Route
Directory of Open Access Journals (Sweden)
K. Zelazny
2014-09-01
Full Text Available Service speed of a ship in real weather conditions is a basic design parameter. Forecasting of this speed at preliminary design stage is made difficult by the lack of simple but at the same accurate models of forces acting upon a ship sailing on a preset shipping route. The article presents a model for calculating forces and moment on plane rudder, useful for forecasting of ship service speed at preliminary stages of ship design.
Asphyxiation death caused by oxygen-depleting cargo on a ship.
Sundal, Marjana Kjetland; Lilleng, Peer Kaare; Barane, Hans; Morild, Inge; Vevelstad, Merete
2017-10-01
The extreme danger associated with entering enclosed spaces loaded with oxygen-depleting organic cargo in ships and tanks is obviously underestimated, both among crew and management. We present a case report to highlight this occupational hazard and to increase the knowledge about the imperative precautions, in order to prevent future accidents. An experienced customs officer was found lifeless at the bottom of the unattended cargo hold on a ship loaded with woodchips. The oxygen content in the cargo atmosphere was below 2%, which is incompatible with life. Forensic autopsy revealed injuries related to the fall, and there were no positive toxicological findings in blood, lung or urine. Management and workers must be taught about the extreme rapidity of developing unconsciousness and asphyxiant death when entering enclosed spaces loaded with oxygen-depleting cargo. Even a single inhalation can result in unconsciousness and death. Dozens of annual deaths and severe injuries can easily be prevented if simple precautions are followed. Copyright © 2017 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Oelgaard, P.L.
1993-05-01
In this report available information on 28 nuclear ship accident and incidents is considered. Of these 5 deals with U.S. ships and 23 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the nuclear propulsion plants, radiation exposures, fires/explosions and sea water leaks into the submarines are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that much of the available information is of a rather dubious nature. consequently some of the assessments made may not be correct. (au)
Development of the Nuclear Ship Database. 1. Outline of the Nuclear Ship Experimental Database
Energy Technology Data Exchange (ETDEWEB)
Kyouya, Masahiko; Ochiai, Masa-aki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Hashidate, Kouji
1995-03-01
We obtained the experimental data on the effects of the ship motions and the change in load and caused by the ship operations, the waves, the winds etc., to the nuclear power plant behavior, through the Power-up Tests and Experimental Voyages of the Nuclear Ship MUTSU. Moreover, we accumulated the techniques, the knowledge and others on the Nuclear Ship development at the each stage of the N.S. MUTSU Research and Development program, such as the design stage, the construction stage, the operation stage and others. These data, techniques, knowledge and others are the assembly of the experimental data and the experiences through the design, the construction and the operation of the first nuclear ship in JAPAN. It is important to keep and pigeonhole these products of the N.S. MUTSU program in order to utilize them effectively in the research and development of the advanced marine reactor, since there is no construction plan of the nuclear ship for the present in JAPAN. We have been carrying out the development of the Nuclear Ship Database System since 1991 for the purpose of effective utilization of the N.S. MUTSU products in the design study of the advanced marine reactors. The part of the Nuclear Ship Database System on the experimental data, called Nuclear Ship Experimental Database, was already accomplished and utilized since 1993. This report describes the outline and the use of the Nuclear Ship Experimental Database.The remaining part of the database system on the documentary data, called Nuclear Ship Documentary Database, are now under development. (author).
Development of the Nuclear Ship Database. 1. Outline of the Nuclear Ship Experimental Database
International Nuclear Information System (INIS)
Kyouya, Masahiko; Ochiai, Masa-aki; Hashidate, Kouji.
1995-03-01
We obtained the experimental data on the effects of the ship motions and the change in load and caused by the ship operations, the waves, the winds etc., to the nuclear power plant behavior, through the Power-up Tests and Experimental Voyages of the Nuclear Ship MUTSU. Moreover, we accumulated the techniques, the knowledge and others on the Nuclear Ship development at the each stage of the N.S. MUTSU Research and Development program, such as the design stage, the construction stage, the operation stage and others. These data, techniques, knowledge and others are the assembly of the experimental data and the experiences through the design, the construction and the operation of the first nuclear ship in JAPAN. It is important to keep and pigeonhole these products of the N.S. MUTSU program in order to utilize them effectively in the research and development of the advanced marine reactor, since there is no construction plan of the nuclear ship for the present in JAPAN. We have been carrying out the development of the Nuclear Ship Database System since 1991 for the purpose of effective utilization of the N.S. MUTSU products in the design study of the advanced marine reactors. The part of the Nuclear Ship Database System on the experimental data, called Nuclear Ship Experimental Database, was already accomplished and utilized since 1993. This report describes the outline and the use of the Nuclear Ship Experimental Database.The remaining part of the database system on the documentary data, called Nuclear Ship Documentary Database, are now under development. (author)
Constraints on Eurasian ship NOx emissions using OMI NO2 observations and GEOS-Chem
Vinken, Geert C. M.; Boersma, Folkert; van Donkelaar, Aaron; Zhang, Lin
2013-04-01
Ships emit large quantities of nitrogen oxides (NOx = NO + NO2), important precursors for ozone (O3) and particulate matter formation. Ships burn low-grade marine heavy fuel due to the limited regulations that exist for the maritime sector in international waters. Previous studies showed that global ship NOx emission inventories amount to 3.0-10.4 Tg N per year (15-30% of total NOx emissions), with most emissions close to land and affecting air quality in densely populated coastal regions. Bottom-up inventories depend on the extrapolation of a relatively small number of measurements that are often unable to capture annual emission changes and can suffer from large uncertainties. Satellites provide long-term, high-resolution retrievals that can be used to improve emission estimates. In this study we provide top-down constraints on ship NOx emissions in major European ship routes, using observed NO2 columns from the Ozone Monitoring Instrument (OMI) and NO2 columns simulated with the nested (0.5°×0.67°) version of the GEOS-Chem chemistry transport model. We use a plume-in-grid treatment of ship NOx emissions to account for in-plume chemistry in our model. We ensure consistency between the retrievals and model simulations by using the high-resolution GEOS-Chem NO2 profiles as a priori. We find evidence that ship emissions in the Mediterranean Sea are geographically misplaced by up to 150 km and biased high by a factor of 4 as compared to the most recent (EMEP) ship emission inventory. Better agreement is found over the shipping lane between Spain and the English Channel. We extend our approach and also provide constraints for major ship routes in the Red Sea and Indian Ocean. Using the full benefit of the long-term retrieval record of OMI, we present a new Eurasian ship emission inventory for the years 2005 to 2010, based on the EMEP and AMVER-ICOADS inventories, and top-down constraints from the satellite retrievals. Our work shows that satellite retrievals can
de Boer, Victor; Hoekstra, F.G.; Leinenga, Jurjen; van Rossum, Matthias
2014-01-01
Dutch Ships and Sailors provides an infrastructure for maritime historical datasets, linking correlating data through semantic web technology. It brings together datasets related to recruitment and shipping in the East-India trade (mainly 18th century) and in the shipping of the northern provinces
Reactors. Nuclear propulsion ships
International Nuclear Information System (INIS)
Fribourg, Ch.
2001-01-01
This article has for object the development of nuclear-powered ships and the conception of the nuclear-powered ship. The technology of the naval propulsion P.W.R. type reactor is described in the article B.N.3 141 'Nuclear Boilers ships'. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf
2008-04-15
The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures
Directory of Open Access Journals (Sweden)
Keun-Sik Park
2018-05-01
Full Text Available Strengthening sale and purchase (S&P capacity has become a fundamental requirement for sustainable growth and corporate competitiveness in the modern shipping market. However, there is a lack of research related to S&P and its priority when shipping companies attempt to implement ship acquisition through S&P activities. To fill this gap, this paper conducts an empirical analysis to analyze priority factors during the acquisition of second-hand ships from the perspective of shipping companies. Business criteria are considered to be the most important factors in the analysis of the priority of ship acquisition and investment in shipping companies. To the best of our knowledge, this research is the first exploration covering Korean shipping companies’ ship acquisition through S&P activities. This study is expected to contribute to the better understanding of the role of S&P in ensuring the sustainability of shipping companies and to provide stakeholders with valuable insights.
Estimation of PV output power in moving and rocking hybrid energy marine ships
International Nuclear Information System (INIS)
Liu, Hongda; Zhang, Qing; Qi, Xiaoxia; Han, Yang; Lu, Fang
2017-01-01
Highlights: •A mathematical model for characterizing the ship PV output power is developed. •The impacts of the sea condition and ship type on the PV output power are analyzed. •The hybrid energy storage system is used to stabilize the PV fluctuation powers. •A SC configuration method based on maximum half period is applied. -- Abstract: In recent years, the application of solar energy and energy storage to ship power systems has shown promise as a method for both reducing annual carbon and nitrogen oxide emissions and improving ship energy efficiency in the maritime shipping industry. When a ship navigates at sea, it encounters a constant rocking motion that is affected by both the surrounding sea conditions and the ship’s navigation parameters. This motion increases the uncertainty involved in using solar energy and accelerates the aging of the ship’s energy storage battery to some extent. In this study, a universal mathematical model is established for the power generation by photovoltaic (PV) modules in which both the sea conditions and the ship’s integrated motion, including its basic movement along with the motion caused by rocking, are taken into account. Based on this model, the fluctuation characteristics of a ship’s PV output power are studied and determined using three different simulation scenarios. A binary energy storage scheme based on a decoupled PV output power is proposed in order to both stabilize the small-period PV power fluctuations and slow the aging of the actual battery caused by rocking. In addition, a super-capacitor (SC) configuration is constructed based on a maximum half cycle. Finally, the optimal energy storage capacities for this green ship are compared under both rocking and moving motion. In the case of rocking motion, the SCs are able to achieve an approximately 24.8–35.0% reduction in battery replacement. A shipping route between Shanghai, China and Sydney, Australia is considered to validate the practicality
Outer Dynamics of Ship Collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup
1996-01-01
The purpose is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisions with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding structures....
International Nuclear Information System (INIS)
1981-03-01
First, the government organs and other organizations related to nuclear ships and their tasks are described. The fundamental plan for the development of nuclear ships had been determined in July, 1963, and was revised three times thereafter. However in December, 1980, new determination to carry out the research works also was made. The course of the construction of the nuclear ship ''Mutsu'' from 1955 to 1980, the main particulars of the nuclear ship ''Mutsu'' and the drawing of the general arrangement are shown. The designated port for berthing the Mutsu was completed in 1972 in Ominato, Aomori Prefecture, but after the happening of radiation leak during the trial operation of the Mutsu in 1974, it was agreed to remove the port. The main works to be carried out at the port and the port facilities are explained. The progress of the examination of safety of the Mutsu and the result, the test of raising the power output carried out in 1974, and the course of selecting the port for making the repair works of the Mutsu are described. The law concerning Japan Nuclear Ship Research and Development Agency had been instituted in 1963, and was revised four times thereafter. The change of the budget for the tests and researches related to nuclear ships in Japan is shown. The state of development of nuclear ships in foreign countries, the international organs related to atomic energy, shipping, shipbuilding and energy, and chronological table are introduced. (Kako, I.)
Outer Dynamics of Ship Collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup
1996-01-01
The purpose of these notes is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisons with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding...
On Impact Mechanics in Ship Collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Zhang, Shengming
1998-01-01
The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship-ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived ...
Towards a nuclear merchant ship
International Nuclear Information System (INIS)
Nicholson, R.L.R.; Llewelyn, G.I.W.; Farmer, A.A.
1976-01-01
The operation of nuclear merchant ships is likely to be attended by a number of constraints and requirements. Not all of these can be fully resolved until such ships come into use and the necessary experience and confidence have been acquired. But the timing of commercial introduction, if it comes about, will depend on the relative economics of nuclear versus fossil fuel propulsion, and the differences in turn depend in part on the operating costs particular to nuclear ships. A review of operation aspects is essential not only to commercial appraisal; each country whose trade may be carried in nuclear ships - whether it will build such ships or not - will have occasion to give some attention to the problems. It is an international problem and is, as noted later, being considered internationally. This paper; i) reviews some of the operational aspects as seen in the U.K.; ii) summarizes views received by the Nuclear Merchant Ship Unit (NMSU) from U.K. shipping, shipbuilding and nuclear industries on the prospects of a U.K. nuclear merchant ship. (author)
Annual report 1994. NV Gemeenschappelijk Kolenbureau Elektriciteitsproduktiebedrijven (GVE)
International Nuclear Information System (INIS)
Anon.
1995-01-01
GKE supplies coal for public generation of electricity and heating in the Netherlands. The annual report gives details of GKE's business and activities during the year including information on coal markets, shipping, coal requirements, coal sources, suppliers, contracts, logistics, coal quality, quality control, air pollution control, throughput and coal stocks and inland transportation. Financial data for the year ending 31 December 994 are included
Contribution of ship emissions to the concentration and deposition of air pollutants in Europe
Directory of Open Access Journals (Sweden)
S. Aksoyoglu
2016-02-01
Full Text Available Emissions from the marine transport sector are one of the least-regulated anthropogenic emission sources and contribute significantly to air pollution. Although strict limits were introduced recently for the maximum sulfur content in marine fuels in the SECAs (sulfur emission control areas and in EU ports, sulfur emissions outside the SECAs and emissions of other components in all European maritime areas have continued to increase in the last two decades. We have used the air quality model CAMx (Comprehensive Air Quality Model with Extensions with and without ship emissions for the year 2006 to determine the effects of international shipping on the annual as well as seasonal concentrations of ozone, primary and secondary components of PM2.5, and the dry and wet deposition of nitrogen and sulfur compounds in Europe. The largest changes in pollutant concentrations due to ship emissions were predicted for summer. Concentrations of particulate sulfate increased due to ship emissions in the Mediterranean (up to 60 %, the English Channel and the North Sea (30–35 %, while increases in particulate nitrate levels were found especially in the north, around the Benelux area (20 %, where there were high NH3 land-based emissions. Our model results showed that not only are the atmospheric concentrations of pollutants affected by ship emissions, but also depositions of nitrogen and sulfur compounds increase significantly along the shipping routes. NOx emissions from the ships, especially in the English Channel and the North Sea, cause a decrease in the dry deposition of reduced nitrogen at source regions by moving it from the gas phase to the particle phase which then contributes to an increase in the wet deposition at coastal areas with higher precipitation. In the western Mediterranean region, on the other hand, model results show an increase in the deposition of oxidized nitrogen (mostly HNO3 due to the ship traffic. Dry deposition of SO2 seems to
Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC
Energy Technology Data Exchange (ETDEWEB)
Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)
2000-07-01
The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)
DEFF Research Database (Denmark)
Jensen, Thomas; Vatrapu, Ravi
2015-01-01
and national borders within international shipping which is a rather complex domain. The intellectual objective is to generate and evaluate the efficacy and effectiveness of design principles for inter-organizational information infrastructures in the international shipping domain that can have positive...
Navy Hospital ships in history
Directory of Open Access Journals (Sweden)
Sougat Ray
2017-01-01
Full Text Available Hospital ships are operated by the Naval forces in or near war zones to provide medical assistance to the wounded personnel of all nationalities and not be used for any military purpose. Hospital ships possibly existed in ancient times and the Athenian Navy had a ship named Therapia. However, it was only during the 17th century that it became a common practice for the naval squadrons to be accompanied by large ships with the facilities of carrying the wounded after each engagement. In 1860, the steamships HMS Melbourne and HMS Mauritius were equipped with genuine medical facilities. They were manned by the Medical Staff Corps and provided services to the British expedition to China. During the World War I and World War II, passenger ships were converted for use as hospital ships and were started to be used on a massive scale. RMS Aquitania and HMHS Britannic were two famous examples of hospital ships used extensively. Modern US hospital ships USNS Mercy and USNS Comfort are operated by Military Sealift Command of the US Navy. Their primary mission is to provide emergency on-site care for US combatant forces deployed in war or other operations.
International Nuclear Information System (INIS)
Oelgaard, P.L.
1993-03-01
This report contains a review of the information available on nuclear powered ships, built for civilian purposes. In the introduction a short discussion is given of the reasons for the limited use of nuclear ships for these purposes. In the second section a brief review is presented of data for the three experimental/merchant ships build by the United States, Germany and Japan, i.e. NS Savannah, NS Otto Hahn and NS Mutsu. In the third section the Soviet/Russian icebreaker NS Lenin is considered. Its design, operational experience and the introduction of a new nuclear propulsion plant is reviewed. In the fourth section the newer Soviet/Russian icebreakers with nuclear propulsion are considered. Finally design of the Soviet/Russian icebreaker transport/container ship NS Sevmorput is reviewed in the fifth section. The future Russian plans for nuclear vessels for the arctic waters are briefly discussed. (au)
Tarnapowicz, Dariusz; German-Galkin, Sergiej
2018-03-01
The decisive source of air pollution emissions in ports is the berthed ships. This is primarily caused by the work of ship's autonomous generator sets. One way of reducing the air pollution emissions in ports is the supply of ships from electricity inland system. The main problem connected with the power connection of ships to the inland network is caused by different values of levels and frequencies of voltages in these networks (in various countries) in relation to different values of levels and frequencies of voltages present in the ship's network. It is also important that the source power can range from a few hundred kW up to several MW. In order to realize a universal „Shore to Ship" system that allows the connection of ships to the electricity inland network, the international standardization is necessary. This article presents the current recommendations, standards and regulations for the design of „Shore to Ship" systems.
International Nuclear Information System (INIS)
Kobayashi, Michiyuki; Murata, Hiroyuki; Sawada, Kenichi; Inasaka, Fujio; Aya, Izuo; Shiozaki, Koki
1999-01-01
By inputting the experimental data, information and others on thermo-hydraulic characteristics of integrated ship propulsion reactor accumulated hitherto by the Ship Research Institute and some recent cooperation results into the nuclear ship engineering simulation system, it was conducted not only to contribute an improvement study on next ship reactor by executing general analysis and evaluation on motion characteristics under ship body motion conditions, safety at accidents, and others of the integrated ship reactor but also to investigate and prepare some measures to apply fundamental experiment results based on obtained here information to safety countermeasure of the nuclear ships. In 1997 fiscal year, on safety of the integrated ship propulsion reactor loading nuclear ship, by adding experimental data on unstable flow analysis and information on all around of the analysis to general data base fundamental program, development to intellectual data base program was intended; on effect of pulsation flow on thermo-hydraulic characteristics of ship propulsion reactor; after pulsation flow visualization experiment, experimental equipment was reconstructed into heat transfer type to conduct numerical analysis of pulsation flow by confirming validity of numerical analysis code under comparison with the visualization experiment results; and on thermo-hydraulic behavior in storage container at accident of active safety type ship propulsion reactor; a flashing vibration test using new apparatus finished on its higher pressurization at last fiscal year to examine effects of each parameter such as radius and length of exhausting nozzle and pool water temperature. (G.K.)
The Human Element and Autonomous Ships
Directory of Open Access Journals (Sweden)
Sauli Ahvenjärvi
2016-09-01
Full Text Available The autonomous ship technology has become a “hot” topic in the discussion about more efficient, environmentally friendly and safer sea transportation solutions. The time is becoming mature for the introduction of commercially sensible solutions for unmanned and fully autonomous cargo and passenger ships. Safety will be the most interesting and important aspect in this development. The utilization of the autonomous ship technology will have many effects on the safety, both positive and negative. It has been announced that the goal is to make the safety of an unmanned ship better that the safety of a manned ship. However, it must be understood that the human element will still be present when fully unmanned ships are being used. The shore-based control of a ship contains new safety aspects and an interesting question will be the interaction of manned and unmanned ships in the same traffic area. The autonomous ship technology should therefore be taken into account on the training of seafarers. Also it should not be forgotten that every single control algorithm and rule of the internal decision making logic of the autonomously navigating ship has been designed and coded by a human software engineer. Thus the human element is present also in this point of the lifetime navigation system of the autonomous ship.
On impact mechanics in ship collisions
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Zhang, Shengming
1998-01-01
The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship–ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived ...
Advanced Demonstration of Motion Correction for Ship-to-Ship Passive Inspections
Energy Technology Data Exchange (ETDEWEB)
Ziock, Klaus-Peter [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Boehnen, Chris Bensing [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ernst, Joseph [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2013-09-30
Passive radiation detection is a key tool for detecting illicit nuclear materials. In maritime applications it is most effective against small vessels where attenuation is of less concern. Passive imaging provides: discrimination between localized (threat) and distributed (non-threat) sources, removal of background fluctuations due to nearby shorelines and structures, source localization to an individual craft in crowded waters, and background subtracted spectra. Unfortunately, imaging methods cannot be easily applied in ship-to-ship inspections because relative motion of the vessels blurs the results over many pixels, significantly reducing sensitivity. This is particularly true for the smaller water craft where passive inspections are most valuable. In this project we performed tests and improved the performance of an instrument (developed earlier under, “Motion Correction for Ship-to-Ship Passive Inspections”) that uses automated tracking of a target vessel in visible-light images to generate a 3D radiation map of the target vessel from data obtained using a gamma-ray imager.
An assessment of simplified methods to determine damage from ship-to-ship collisions
International Nuclear Information System (INIS)
Parks, M.B.; Ammerman, D.J.
1996-01-01
Sandia National Laboratories (SNL) is studying the safety of shipping, radioactive materials (RAM) by sea, the SeaRAM project (McConnell, et al. 1995), which is sponsored by the US Department of Energy (DOE). The project is concerned with the potential effects of ship collisions and fires on onboard RAM packages. Existing methodologies are being assessed to determine their adequacy to predict the effect of ship collisions and fires on RAM packages and to estimate whether or not a given accident might lead to a release of radioactivity. The eventual goal is to develop a set of validated methods, which have been checked by comparison with test data and/or detailed finite element analyses, for predicting the consequences of ship collisions and fires. These methods could then be used to provide input for overall risk assessments of RAM sea transport. The emphasis of this paper is on methods for predicting- effects of ship collisions
International Nuclear Information System (INIS)
Hooghiemstra, J.
2007-01-01
Prices for the rent of a drilling ship are very high. Per day the rent is 1% of the price for building such a ship, and those prices have risen as well. Still, it is attractive for oil companies to rent a drilling ship [nl
Energy Technology Data Exchange (ETDEWEB)
Oelgaard, P L [Risoe National Lab., Roskilde (Denmark); [Technical Univ. of Denmark, Lyngby (Denmark)
1996-12-01
This report starts with a discussion of the types of nuclear vessels accidents, in particular accidents which involve the nuclear propulsion systems. Next available information on 61 reported nuclear ship events in considered. Of these 6 deals with U.S. ships, 54 with USSR ships and 1 with a French ship. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/explosions, sea-water leaks into the submarines and sinking of vessels are considered. For each event a summary of available information is presented, and comments are added. In some cases the available information is not credible, and these events are neglected. This reduces the number of events to 5 U.S. events, 35 USSR/Russian events and 1 French event. A comparison is made between the reported Soviet accidents and information available on dumped and damaged Soviet naval reactors. It seems possible to obtain good correlation between the two types of events. An analysis is made of the accident and estimates are made of the accident probabilities which are found to be of the order of 10{sup -3} per ship reactor years. It if finally pointed out that the consequences of nuclear ship accidents are fairly local and does in no way not approach the magnitude of the Chernobyl accident. It is emphasized that some of the information on which this report is based, may not be correct. Consequently some of the results of the assessments made may not be correct. (au).
International Nuclear Information System (INIS)
Oelgaard, P.L.
1996-12-01
This report starts with a discussion of the types of nuclear vessels accidents, in particular accidents which involve the nuclear propulsion systems. Next available information on 61 reported nuclear ship events in considered. Of these 6 deals with U.S. ships, 54 with USSR ships and 1 with a French ship. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/explosions, sea-water leaks into the submarines and sinking of vessels are considered. For each event a summary of available information is presented, and comments are added. In some cases the available information is not credible, and these events are neglected. This reduces the number of events to 5 U.S. events, 35 USSR/Russian events and 1 French event. A comparison is made between the reported Soviet accidents and information available on dumped and damaged Soviet naval reactors. It seems possible to obtain good correlation between the two types of events. An analysis is made of the accident and estimates are made of the accident probabilities which are found to be of the order of 10 -3 per ship reactor years. It if finally pointed out that the consequences of nuclear ship accidents are fairly local and does in no way not approach the magnitude of the Chernobyl accident. It is emphasized that some of the information on which this report is based, may not be correct. Consequently some of the results of the assessments made may not be correct. (au)
Trends of shipping markets development
Directory of Open Access Journals (Sweden)
Tomasz Nowosielski
2012-06-01
Full Text Available Shipping markets are dependent on international trade transactions that generate transport needs. These needs can dynamically change depending on global natural resources and commodity markets situation. The changes affecting shipping markets can also be caused by changes to the existing cargo flows and by establishing new ones in different geographies. It is anticipated that in the future shipping markets will change, visible by a decline in shipping in North America and Europe and an increase in Asia.
Lazakis, Iraklis; Dikis, Konstantinos; Michala, Anna Lito; Theotokatos, Gerasimos
2016-01-01
Structural and machinery failures in the day-to-day ship operations may lead to major accidents, endangering crew and\\ud passengers onboard, posing a threat to the environment, damaging the ship itself and having a great impact in terms of business\\ud losses. In this respect, this paper presents the INCASS (Inspection Capabilities for Enhanced Ship Safety) project which aims\\ud bringing an innovative solution to the ship inspection regime through the introduction of enhanced inspection of shi...
National Research Council Canada - National Science Library
2011-01-01
"The third edition of the Guide to Ship Sanitation presents the public health significance of ships in terms of disease and highlights the importance of applying appropriate control measures"--Back cover...
Cybersecurity Framework for Ship Industrial Control System
Maule, R. William; Hake, Joseph
2016-01-01
Ship mechanical and electrical control systems, and the communications grid through which these devices operate, are a high priority concern for Navy leadership. Ship systems use microprocessor-based controls to interface with physical objects, and Programmable Logic Controllers (PLCs) to automate ship electromechanical processes. Ship operations are completely dependent on these devices. The commercial security products upon which ships depend do not work on ICS, leaving ships vulnerable. Th...
Containment of spills from ships
International Nuclear Information System (INIS)
Engerer, M.J.
1992-01-01
Oil escaping from a ship is contained within a limited area surrounding the ship by means of a flexible ring structure. The ring structure is stored in a collapsed state in a compartment extending around the ship. In response to an oil spill, the ring structure is dropped from the compartment and immediately surrounds the ship. A circular inflatable flotation section of the ring structure is charged with gas under pressure. The gas is supplied from a bottle cascade aboard the ship, through lines preconnected to the flotation section and paid out from free-wheeling reels. The flotation section supports a thin circumferential wall of predetermined height that submerges and assumes a vertical cylinder-like shape surrounding the escaping oil. The oil floats within the confines of the ring structure, and the ring structure is progressively expanded to a predetermined size selected to accommodate the total volume of oil carried by the ship. When the ring structure achieves its expanded state, pressure in the flotation section is raised to render the structure relatively rigid and resistant to collapse in response to wave action. Oil can be removed from the interior of the ring structure by recovery ships using suction lines or other conventional recovery methods. 12 figs
SKI's and SSI's review of SKB's safety report SR-Can
International Nuclear Information System (INIS)
Dverstorp, Bjoern; Stroemberg, Bo
2008-03-01
This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality
Real-Time Simulation of Ship-Structure and Ship-Ship Interaction
DEFF Research Database (Denmark)
Lindberg, Ole; Glimberg, Stefan Lemvig; Bingham, Harry B.
2013-01-01
, because it is simple, easy to implement and computationally efficient. Multiple many-core graphical processing units (GPUs) are used for parallel execution and the model is implemented using a combination of C/C++, CUDA and MPI. Two ship hydrodynamic cases are presented: Kriso Container Carrier at steady...
Directory of Open Access Journals (Sweden)
Eris Ratnawati
2017-03-01
Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam
EX1001 Ship Shakedown (EX1001, EM302) on NOAA Ship Okeanos Explorer in Hawaiian Islands
National Oceanic and Atmospheric Administration, Department of Commerce — The ship has been alongside for repairs and leave since November, 2009. The ship shakedown cruise is scheduled to provide an opportunity for the ship to get underway...
SSI [soil-structure interactions] and structural benchmarks
International Nuclear Information System (INIS)
Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.
1986-01-01
This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils
Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter
2011-01-01
Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…
46 CFR 148.02-1 - Shipping papers.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 148.02-1 Section 148.02-1 Shipping... MATERIALS IN BULK Vessel Requirements § 148.02-1 Shipping papers. (a) Carriers may not accept for..., unless the hazardous materials offered for such shipment is accompanied by a shipping paper on which the...
Naval Ship Database: Database Design, Implementation, and Schema
2013-09-01
ClassId Class identifier Name Ship name Pendant Ship pendant CommissionDate Ship commission date DecommissionDate Ship decommission date; NULL if still...active FlagshipId Ship Id of the ship Figure 3: Ship table definition Table 3: Ship table example rows Id Prefix ClassId Name Pendant ...computation if required. A bridged connection will allow computation analysis to be done in Matlab and allow the processed data to be imported back
Ship Technology Workshop Materials from Collaboration with Mexico to Reduce Emissions from Ships
On September 26, 2012, a ship technology seminar was held to provide Mexican stakeholders with information about some of the ship technologies needed to meet the requirements of MARPOL Annex VI and an ECA.
Keuning, J.A.
2014-01-01
The invention concerns a ship whereby the hull and the mechanical propulsion device are designed such that the Froude number is larger than 0.5. In the aft ship the hull has a bottom with V-shaped bottom surfaces with a deadrise angle that is less than 40 degrees and the hull has substantially vertical sides. In the hull are a passenger compartment and a trim tank. The trim tank volume is such that the weight of a filled trim tank is more than 30 % of the weight of displacement of the hull wi...
46 CFR 151.45-7 - Shipping papers.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping papers. 151.45-7 Section 151.45-7 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Operations § 151.45-7 Shipping papers. Each barge carrying... towing vessel shall either have a copy of the shipping papers for each barge in his tow or he shall make...
Directory of Open Access Journals (Sweden)
Chun-Ki Lee
2016-01-01
Full Text Available The hydrodynamic interaction between two large vessels can't be neglected when two large vessels are closed to each other in restricted waterways such as in a harbor or narrow channel. This paper is mainly concerned with the ship maneuvering motion based on the hydrodynamic interaction effects between two large vessels moving each other in curved narrow channel. In this research, the characteristic features of the hydrodynamic interaction forces between two large vessels are described and illustrated, and the effects of velocity ratio and the spacing between two vessels are summarized and discussed. Also, the Inchon outer harbor area through the PALMI island channel in Korea was selected, and the ship maneuvering simulation was carried out to propose an appropriate safe speed and distance between two ships, which is required to avoid sea accident in confined waters. From the inspection of this investigation, it indicates the following result. Under the condition of SP12≤0.5L, it may encounter a dangerous tendency of grounding or collision due to the combined effect of the interaction between ships and external forces. Also considering the interaction and wind effect as a parameter, an overtaken and overtaking vessel in narrow channel can navigate while keeping its own original course under the following conditions; the lateral separation between two ships is about kept at 0.6 times of ship length and 15 degrees of range in maximum rudder angle. On the other hand, two ships while overtaking in curved narrow channel such as Inchon outer harbor in Korea should be navigated under the following conditions; SP12 is about kept at 1.0 times of ship length and the wind velocity should not be stronger than 10 m/s.
Optimization in liner shipping
DEFF Research Database (Denmark)
Brouer, Berit Dangaard; Karsten, Christian Vad; Pisinger, David
2017-01-01
Seaborne trade is the lynchpin in almost every international supply chain, and about 90% of non-bulk cargo worldwide is transported by container. In this survey we give an overview of data-driven optimization problems in liner shipping. Research in liner shipping is motivated by a need for handling...... still more complex decision problems, based on big data sets and going across several organizational entities. Moreover, liner shipping optimization problems are pushing the limits of optimization methods, creating a new breeding ground for advanced modelling and solution methods. Starting from liner...... shipping network design, we consider the problem of container routing and speed optimization. Next, we consider empty container repositioning and stowage planning as well as disruption management. In addition, the problem of bunker purchasing is considered in depth. In each section we give a clear problem...
Mandal, Nisith R
2017-01-01
This book addresses various aspects of ship construction, from ship types and construction materials, to welding technologies and accuracy control. The contents of the book are logically organized and divided into twenty-one chapters. The book covers structural arrangement with longitudinal and transverse framing systems based on the service load, and explains basic structural elements like hatch side girders, hatch end beams, stringers, etc. along with structural subassemblies like floors, bulkheads, inner bottom, decks and shells. It presents in detail double bottom construction, wing tanks & duct keels, fore & aft end structures, etc., together with necessary illustrations. The midship sections of various ship types are introduced, together with structural continuity and alignment in ship structures. With regard to construction materials, the book discusses steel, aluminum alloys and fiber reinforced composites. Various methods of steel material preparation are discussed, and plate cutting and form...
Potential of biofuels for shipping. Final Report
Energy Technology Data Exchange (ETDEWEB)
Florentinus, A.; Hamelinck, C.; Van den Bos, A.; Winkel, R.; Cuijpers, M. [Ecofys Netherlands, Utrecht (Netherlands)
2012-01-15
Biofuels could be one of the options to realize a lower carbon intensity in the propulsion of ships and also possibly reduce the effect of ship emissions on local air quality. Therefore, EMSA, the European Maritime Safety Agency, is evaluating if and how biofuels could be used in the shipping sector as an alternative fuel. To determine the potential of biofuels for ships, a clearer picture is needed on technical and organizational limitations of biofuels in ships, both on board of the ship as in the fuel supply chain to the ship. Economic and sustainability analysis of biofuels should be included in this picture, as well as an overview on current and potential policy measures to stimulate the use of biofuels in shipping. Ecofys has determined the potential of biofuels, based on analysis of collected data through literature review, own expertise and experiences, direct communication with EMSA, research publications, market developments based on press and other media, and consultations with relevant stakeholders in the shipping market.
International Nuclear Information System (INIS)
Kobayashi, Michiyuki; Aya, Izuo; Inasaka, Fujio; Murata, Hiroyuki; Odano, Naoteru; Shiozaki, Koki
1998-01-01
A research project from 1995-1999 had a plan to make experimental studies on (1) safety of nuclear ship loaded with an integral ship propulsion reactor (2) effects of pulsating flow on the thermo-hydraulic characteristics of ship propulsion reactor and (3) thermo-hydraulic behaviors of the reactor container at the time of accident in a passively safe ship propulsion reactor. Development of a data base for ship propulsion reactor was attempted using previous experimental data on the thermo-hydraulic characteristics of the reactor in the institute in addition to the present results aiming to make general analytical evaluation for the safety of the engineering-simulation system for nuclear ship. A general data base was obtained by integrating the data list and the analytical program for static characteristics. A test equipment which allows to visualize the pulsating flow was produced and visualization experiments have started. (M.N.)
Shipping emission forecasts and cost-benefit analysis of China ports and key regions' control.
Liu, Huan; Meng, Zhi-Hang; Shang, Yi; Lv, Zhao-Feng; Jin, Xin-Xin; Fu, Ming-Liang; He, Ke-Bin
2018-05-01
China established Domestic Emission Control Area (DECA) for sulphur since 2015 to constrain the increasing shipping emissions. However, future DECA policy-makings are not supported due to a lack of quantitive evaluations. To investigate the effects of current and possible Chinese DECAs policies, a model is presented for the forecast of shipping emissions and evaluation of potential costs and benefits of an DECA policy package set in 2020. It includes a port-level and regional-level projection accounting for shipping trade volume growth, share of ship types, and fuel consumption. The results show that without control measures, both SO 2 and particulate matter (PM) emissions are expected to increase by 15.3-61.2% in Jing-Jin-Ji, the Yangtze River Delta, and the Pearl River Delta from 2013 to 2020. However, most emissions can be reduced annually by the establishment of a DECA that depends on the size of the control area and the fuel sulphur content limit. Costs range from 0.667 to 1.561 billion dollars (control regional shipping emissions) based on current fuel price. A social cost method shows the regional control scenarios benefit-cost ratios vary from 4.3 to 5.1 with large uncertainty. Chemical transportation model combined with health model method is used to get the monetary health benefits and then compared with the results from social cost method. This study suggests that Chinese DECAs will reduce the projected emissions at a favorable benefit-cost ratio, and furthermore proposes policy combinations that provide high cost-effective benefits as a reference for future policy-making. Crown Copyright © 2018. Published by Elsevier Ltd. All rights reserved.
Documentation for fiscal year 1995 annual BUSS cask SARP testing and inspections
International Nuclear Information System (INIS)
Saueressig, P.T.
1994-01-01
The purpose of this report is to compile the data generated during the Fiscal Year (FY) 1995 annual tests and inspections performed on the Beneficial Uses Shipping System (BUSS) cask. The BUSS Cask Model R-1 is a type B shipping container used for shipment of radioactive cesium-137 and strontium-90 capsules to Waste Encapsulation and Storage Facility (WESF). The primary purpose of the BUSS Cask is to provide shielding and confinement as well as impact, puncture, and thermal protection for the capsules under both normal and accident conditions. Section 8.2 ''Maintenance and Periodic Inspection Program'' of the BUSS Cask SARP requires that the following tests and inspections be performed on an annual basis: hydrostatic pressure test; helium leak test; dye penetrant test on the trunnions and life lugs; torque test on all permanent bolts; and impact limiter inspection and weight test. In addition to compiling the generated data, this report will verify that the testing criteria identified in section 8.2 of the BUSS Cask Safety Analysis Report for Packaging (SARP) was met
Documentation for fiscal year 1995 annual BUSS cask SARP testing and inspections
Energy Technology Data Exchange (ETDEWEB)
Saueressig, P.T.
1994-11-08
The purpose of this report is to compile the data generated during the Fiscal Year (FY) 1995 annual tests and inspections performed on the Beneficial Uses Shipping System (BUSS) cask. The BUSS Cask Model R-1 is a type B shipping container used for shipment of radioactive cesium-137 and strontium-90 capsules to Waste Encapsulation and Storage Facility (WESF). The primary purpose of the BUSS Cask is to provide shielding and confinement as well as impact, puncture, and thermal protection for the capsules under both normal and accident conditions. Section 8.2 ``Maintenance and Periodic Inspection Program`` of the BUSS Cask SARP requires that the following tests and inspections be performed on an annual basis: hydrostatic pressure test; helium leak test; dye penetrant test on the trunnions and life lugs; torque test on all permanent bolts; and impact limiter inspection and weight test. In addition to compiling the generated data, this report will verify that the testing criteria identified in section 8.2 of the BUSS Cask Safety Analysis Report for Packaging (SARP) was met.
Lin, Ray-Quing; Kuang, Weijia
2011-01-01
In this paper, we describe the details of our numerical model for simulating ship solidbody motion in a given environment. In this model, the fully nonlinear dynamical equations governing the time-varying solid-body ship motion under the forces arising from ship wave interactions are solved with given initial conditions. The net force and moment (torque) on the ship body are directly calculated via integration of the hydrodynamic pressure over the wetted surface and the buoyancy effect from the underwater volume of the actual ship hull with a hybrid finite-difference/finite-element method. Neither empirical nor free parametrization is introduced in this model, i.e. no a priori experimental data are needed for modelling. This model is benchmarked with many experiments of various ship hulls for heave, roll and pitch motion. In addition to the benchmark cases, numerical experiments are also carried out for strongly nonlinear ship motion with a fixed heading. These new cases demonstrate clearly the importance of nonlinearities in ship motion modelling.
REVIEW OF AGING DATA ON EPDM O-RINGS IN THE H1616 SHIPPING PACKAGE
Energy Technology Data Exchange (ETDEWEB)
Skidmore, E.
2012-03-27
Currently, all H1616 shipping package containers undergo annual re-verification testing, including containment vessel leak testing to verify leak-tightness (<1 x 10{sup -7} ref cc/sec air) as per ANSI N14.5. The purpose of this literature review is to supplement aging studies currently being performed by SRNL on the EPDM O-rings to provide the technical basis for extending annual re-verification testing for the H1616 shipping package and to predict the life of the seals at bounding service conditions. The available data suggest that the EPDM O-rings can retain significant mechanical properties and sealing force at or below bounding service temperatures (169 F or 76 C) beyond the 1 year maintenance period. Interpretation of available data suggests that a service life of at least 2 years and potentially 4-6 years may be possible at bounding temperatures. Seal lifetimes at lower, more realistic temperatures will likely be longer. Being a hydrocarbon elastomer, EPDM O-rings may exhibit an inhibition period due to the presence of antioxidants. Once antioxidants are consumed, mechanical properties and seal performance could decline at a faster rate. Testing is being performed to validate the assumptions outlined in this report and to assess the long-term performance of O-ring seals under actual service conditions.
Directory of Open Access Journals (Sweden)
Roger Skjetne
2004-01-01
Full Text Available Complete nonlinear dynamic manoeuvering models of ships, with numerical values, are hard to find in the literature. This paper presents a modeling, identification, and control design where the objective is to manoeuver a ship along desired paths at different velocities. Material from a variety of references have been used to describe the ship model, its difficulties, limitations, and possible simplifications for the purpose of automatic control design. The numerical values of the parameters in the model is identified in towing tests and adaptive manoeuvering experiments for a small ship in a marine control laboratory.
Effect of Buffer Bow Structure in Ship-Ship Collision
DEFF Research Database (Denmark)
Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup
2008-01-01
tankers, the introduction of buffer bulbous bows has been proposed. Relatively soft buffer bows absorb part of the kinetic energy of the striking ship before penetrating the inner hull of the struck vessel. The purpose of the present paper is to verify the effectiveness of a prototype buffer bulbous bow......) and the forward velocity of the struck ship on the collapse mode of the bow of the striking vessel are investigated. Collapse modes, contact forces and energy absorption capabilities of the buffer bows are compared with those of conventional bows....
Identification of Dynamically Positioned Ships
Directory of Open Access Journals (Sweden)
Thor I. Fossen
1996-04-01
Full Text Available Todays model-based dynamic positioning (DP systems require that the ship and thruster dynamics are known with some accuracy in order to use linear quadratic optical control theory. However, it is difficult to identify the mathematical model of a dynamically posititmed (DP ship since the ship is not persistently excited under DP. In addition the ship parameter estimation problem is nonlinear and multivariable with only position and thruster state measurements available for parameter estimation. The process and measurement noise must also be modeled in order to avoid parameter drift due to environmental disturbances and sensor failure. This article discusses an off-line parallel extended Kalman filter (EKF algorithm utilizing two measurement series in parallel to estimate the parameters in the DP ship model. Full-scale experiments with a supply vessel are used to demonstrate the convergence and robustness of the proposed parameter estimator.
46 CFR 167.05-25 - Nautical school ship.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Nautical school ship. 167.05-25 Section 167.05-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-25 Nautical school ship. The term nautical school ship means a vessel operated by or in connection with a nautical school...
Liner Shipping Fleet Repositioning
DEFF Research Database (Denmark)
Tierney, Kevin; Jensen, Rune Møller
2011-01-01
Liner shipping fleet repositioning consists of moving vessels between services in a liner ship- ping network in order to better orient the overall network to the world economy, and to ensure the proper maintenance of vessels. Thus, fleet repositioning involves sailing and loading activities subject...
Hydrodynamics of Ship Propellers
DEFF Research Database (Denmark)
Breslin, John P.; Andersen, Poul
This book deals with flows over propellers operating behind ships, and the hydrodynamic forces and moments which the propeller generates on the shaft and on the ship hull.The first part of the text is devoted to fundamentals of the flow about hydrofoil sections (with and without cavitation...... of an intermittently cavitating propeller in a wake and the pressures and forces it exerts on the shaft and on the ship hull is examined. A final chapter discusses the optimization of efficiency of compound propulsors. The authors have taken care to clearly describe physical concepts and mathematical steps. Appendices...
Directory of Open Access Journals (Sweden)
Peña-Santiago, R.
2010-12-01
Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.
International climate policy : consequences for shipping
Mæstad, Ottar; Evensen, Annika Jaersen; Mathiesen, Lars; Olsen, Kristian
2000-01-01
This report summarises the main results from the project Norwegian and international climate policy consequences for shipping. The aim of the project has been to shed light on how climate policies might affect shipping, both from the cost side and from the demand side. The project has been divided into three sub-projects, investigating the consequences of climate policies for 1. Optimal shipping operations and management 2. The competitiveness of shipping relative to land transport 3. The tra...
Performance Monitoring of Ships
DEFF Research Database (Denmark)
Hansen, Søren Vinther
is used as input to the system and by comparing model and ship behaviour, an index describing the ship’s performance is generated. The work in this thesis is based on data logged through the automation system on board a PostPanmax container ship where data have been logged through a year. A routine...... in the models have been identified. The models used in this work are based on empirical relations or based on regression analyses of model tests and full-scale trials. In order to achieve valid results the conditions where performance is estimated have to be inside the boundaries of the model. Filters have been......The purpose of the research project is to establish a reliable index in the performance evaluation of ships. During operation the ship will experience added resistance due to fouling of hull and propeller. The added resistance will lead to increased fuel consumption and thus increased emissions...
Computational methods for more fuel-efficient ship
Koren, B.
2008-01-01
The flow of water around a ship powered by a combustion engine is a key factor in the ship's fuel consumption. The simulation of flow patterns around ship hulls is therefore an important aspect of ship design. While lengthy computations are required for such simulations, research by Jeroen Wackers
48 CFR 1371.118 - Changes-ship repair.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Changes-ship repair. 1371.118 Section 1371.118 Federal Acquisition Regulations System DEPARTMENT OF COMMERCE DEPARTMENT SUPPLEMENTAL REGULATIONS ACQUISITIONS INVOLVING SHIP CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.118 Changes—ship repair. Insert clause...
Some concepts of future nuclear ship
International Nuclear Information System (INIS)
Fujino, Masataka
2000-01-01
Characteristic features of nuclear power generation are as follows: (1) Thermal energy can be continuously extracted for a long time without fuel feed, (2) Nuclear energy is suitable for generating huge power, (3) Oxygen is unnecessary for combustion of fuel, and (4) Unlike fossil fuel, nuclear power generation does not exhaust NOx, SOx, and CO 2 : it can be considered environmentally friendly. In view of these features, the Japan Atomic Energy Research Institute commissioned the Shipbuilding Research Association of Japan (JSRA) to survey what kinds of nuclear ship would be put to practical use in the near future. For this purpose, a research committee was organized in 1992 by the JSRA, and concluded its investigation in 1996. The main aim of this research was to clarify the requirements of ship performance as nuclear ships, and then to extract the technical issues of the marine reactor installed in nuclear ships to be solved. As a result of the survey, it was suggested that displacement-type large high-speed container ship would be one of the promising future nuclear merchant ships, and 6500 m deep-sea and 600 m undersea scientific research submersibles would be other promising nuclear special purpose ships. At the same time, various requirements of marine reactors, which are expected to be installed in these ships, were clarified mainly from the technical viewpoints. (author)
Total Analysis System for Ship Structural Strength
Takuya, Yoneya; Hiroyuki, Kobayashi; Abdul M., Rahim; Yoshimichi, Sasaki; Masaki, Irisawa; Technical Investigation and Information Department, Research Center; Technical Investigation and Information Department, Research Center; Singapore Office; Technical Investigation and Information Department, Research Center; Technical Investigation and Information Department, Research Center
2001-01-01
This paper outlines a total analysis system for ship hull structures, which integrates a wide variety of analysis functions to realise practical applications of rational methods for assessing ship structural strength. It is based on direct calculation of wave-induced loads as well as three-dimensional structural analysis of an entire-ship or hold structure. Three major analysis functions of the total system are ship motion and wave load analysis, ship structural analysis and statistical analy...
The Transformation of Swedish Shipping, 1970-2010
Sjögren, Hans; Taro Lennerfors, Thomas; Taudal Poulsen, Rene
2012-01-01
Since the early 1970s, as shipping has undergone a period of structural change, Swedish shipping has rapidly declined from a position of global importance. The Swedish-controlled fleet has dwindled, and the structure of the industry itself has changed. This article explores the influence of shipping markets, shipping regulations, company strategies, maritime know-how, and financial resources on the development of Swedish shipping from 1970 to 2010. A comparison is made between, on the one han...
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Amdahl, Jørgen; Rutgersson, Olle
1996-01-01
A Joint Nordic Research project "Effecive and Safe Ships" is presented. The project is aiming to develop methods and tools for quantitative evaluation fo ship safety. This report is the report of the preliminary phase where the plan for the main project is developed. The objectives of the project...
Analysis of ship life cycles: the impact of economic cycles and ship inspection
Bijwaard, G.E.; Knapp, S.
2009-01-01
Due to the shipping industry's international legal framework, there are loopholes in the system, which can increase the risk of incidents with high economic costs due to the substandard operation of vessels. This article uses duration analysis and through the creation of ship life cycles provides
Simple analytical relations for ship bow waves
Noblesse, Francis; Delhommeau, G.?Rard; Guilbaud, Michel; Hendrix, Dane; Yang, Chi
Simple analytical relations for the bow wave generated by a ship in steady motion are given. Specifically, simple expressions that define the height of a ship bow wave, the distance between the ship stem and the crest of the bow wave, the rise of water at the stem, and the bow wave profile, explicitly and without calculations, in terms of the ship speed, draught, and waterline entrance angle, are given. Another result is a simple criterion that predicts, also directly and without calculations, when a ship in steady motion cannot generate a steady bow wave. This unsteady-flow criterion predicts that a ship with a sufficiently fine waterline, specifically with waterline entrance angle 2, may generate a steady bow wave at any speed. However, a ship with a fuller waterline (25E) can only generate a steady bow wave if the ship speed is higher than a critical speed, defined in terms of αE by a simple relation. No alternative criterion for predicting when a ship in steady motion does not generate a steady bow wave appears to exist. A simple expression for the height of an unsteady ship bow wave is also given. In spite of their remarkable simplicity, the relations for ship bow waves obtained in the study (using only rudimentary physical and mathematical considerations) are consistent with experimental measurements for a number of hull forms having non-bulbous wedge-shaped bows with small flare angle, and with the authors' measurements and observations for a rectangular flat plate towed at a yaw angle.
46 CFR 173.051 - Public nautical school ships.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school ships. 173.051 Section 173.051 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES PERTAINING TO VESSEL USE School Ships § 173.051 Public nautical school ships. Each public nautical school...
Ship emissions and air pollution in Denmark
DEFF Research Database (Denmark)
Olesen, Helge Rørdam; Winther, Morten; Ellermann, Thomas
A project has been carried out to map the contribution from ship traffic to air pollution in Denmark. A main element in the project is the establishment of a new, improved inventory of ship emissions for the waters around Denmark. The inventory makes use of the so-called AIS system, which...... continuously keeps track of ship positions. The inventory provides basis for model calculations of air quality in Denmark for the years 2007, 2011 and 2020. The study has focus on identifying the contribution from ships, and on assessing the effect of international regulations of ship pollution. A minor...... component of the study concerns the contribution to local air pollution from ships at port....
Du, Peng; Ouahsine, Abdellatif; Sergent, Philippe
2018-05-01
Ship maneuvering in the confined inland waterway is investigated using the system-based method, where a nonlinear transient hydrodynamic model is adopted and confinement models are implemented to account for the influence of the channel bank and bottom. The maneuvering model is validated using the turning circle test, and the confinement model is validated using the experimental data. The separation distance, ship speed, and channel width are then varied to investigate their influences on ship maneuverability. With smaller separation distances and higher speeds near the bank, the ship's trajectory deviates more from the original course and the bow is repelled with a larger yaw angle, which increase the difficulty of maneuvering. Smaller channel widths induce higher advancing resistances on the ship. The minimum distance to the bank are extracted and studied. It is suggested to navigate the ship in the middle of the channel and with a reasonable speed in the restricted waterway.
27 CFR 44.187 - Shipping containers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44... Shipping containers. Each shipping case, crate, or other container in which tobacco products, or cigarette... same containers in which they were received from the factory. (72 Stat. 1418, as amended; 26 U.S.C...
27 CFR 44.254 - Shipping containers.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...
49 CFR 176.24 - Shipping papers.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 176.24 Section 176.24... Requirements § 176.24 Shipping papers. (a) A person may not accept a hazardous material for transportation or transport a hazardous material by vessel unless that person has received a shipping paper prepared in...
49 CFR 177.817 - Shipping papers.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 177.817 Section 177.817... Information and Regulations § 177.817 Shipping papers. (a) General requirements. A person may not accept a... received a shipping paper prepared in accordance with part 172 of this subchapter or the material is...
49 CFR 174.24 - Shipping papers.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Shipping papers. 174.24 Section 174.24... Requirements § 174.24 Shipping papers. (a) A person may not accept a hazardous material for transportation or transport a hazardous material by rail unless that person receives a shipping paper prepared in accordance...
Development of nuclear powered ship in Japan
International Nuclear Information System (INIS)
Sato, Hiroshi
1976-01-01
The development of nuclear merchant ship in Japan was started in 1955 by the establishment of Nuclear Ship Study Group, and since then, the investigation, test and research on nuclear ships have been continued. As a result, a nuclear ocean observation and supply ship was designed for trial. Researches were carried out also in JAERI and Institute for Technical Research of Ships. Meanwhile, the nuclear icebreaker Lenin was completed in Soviet Union in 1959, the nuclear ship Savannah set out for maiden voyage in U.S. in 1962, and the construction of the nuclear ore carrier Otto Hahn was prepared in FRG. Japan Nuclear Ship Development Corp. was established in 1963, and started the design and construction of the first nuclear ship in Japan, Mutsu. The basic policy in the construction is the improvement of nuclear ship technology, the securing of safety, and the use of domestic technologies as far as possible. The progress of the design, construction and test of the Mutsu is described. Owing to the problem of radiation leak, the development of nuclear ships stagnated for a while, but the nuclear plant of the Mutsu demonstrated the expected performance in the functional test, land criticality test and zero output test, and it is expected that the bud of the independent development brought up so far can bear valuable fruit. The independent development of marine nuclear reactors should be continued by selecting the way most suitable to Japan. (Kako, I.)
Report of Nuclear Powered Ship Meeting
International Nuclear Information System (INIS)
1984-01-01
The development of nuclear-powered ships in Japan broke down due to the radiation leak on the nuclear ship ''Mutsu'' in 1974, and the objective has not yet been attained. The Japan Nuclear Ship Research and Development Agency was reorganized to advance the development of nuclear-powered ships and to develop marine nuclear reactors. Recently, various opinions have been expressed regarding the development of nuclear-powered ships and Mutsu, accordingly, it is necessary to clarify the way it should be. The Atomic Energy Commission organized this meeting to discuss the problem. The practical use of nuclear-powered ships is expected at the beginning of the 21st century, but it is only the guess. But it is important to accumulate the technology, knowledge and experience to prepare for the use of nuclear-powered ships. The continuation of the development of Mutsu is important for the future, and the construction of the new home port is unavoidable. The aim of the research and development, and the concrete way of advancing the research and development of Mutsu are discussed. It is scheduled that the Agency is integrated with other atomic energy organizations by March, 1985. The consideration to be given for implementing the integration is described. (Kako, I.)
19 CFR 4.69 - Shipping articles.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Shipping articles. 4.69 Section 4.69 Customs... VESSELS IN FOREIGN AND DOMESTIC TRADES Foreign Clearances § 4.69 Shipping articles. No vessel of the U.S... officer, of the shipping articles agreements, including any seaman's allotment agreement, required by 46 U...
29 CFR 1915.162 - Ship's boilers.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Ship's boilers. 1915.162 Section 1915.162 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.162 Ship's boilers. (a) Before...
Added masses of ship structures
Korotkin, Alexandr I
2008-01-01
This essentially self-contained reference book contains data on added masses of ships and various ship and marine engineering structures. Theoretical and experimental methods for determining added masses of these objects are described.
Control mechanisms for Nordic ship emissions
Energy Technology Data Exchange (ETDEWEB)
Martinsen, K. [DNV, Oslo (Norway); Torvanger, A. [Cicero, Oslo (Norway)
2013-04-15
Shipping today operates under a complex set of international and domestic regulations. However, the environmental regulations have lagged behind those of other industries. This situation is now changing quite dramatically. The increased focus on environmental issues, combined with the growing realisation of the actual pollution burden imposed by shipping, has led to an upsurge in both international and national regulations. Some are ready and will enter into force in the near future, while others are still being developed. On behalf of the Nordic Council of Ministers DNV has carried out a study on possible control mechanisms for Nordic ship emission. The aim is to assess the baseline shipping emissions and reduction potential and the possible controlling mechanisms (both incentives and regulations) available for reducing the emissions to air from shipping within the Nordic region. (Author)
Spent fuel shipping cask sealing concepts
International Nuclear Information System (INIS)
Sonnier, C.S.
1989-05-01
In late 1985, the International Atomic Energy Agency (IAEA) requested the US Program for Technical Assistance to IAEA Safeguards (POTAS) to provide a study which examined sealing concepts for application to spent fuel shipping casks. This request was approved, and assigned to Sandia National Laboratories (Sandia). In the course of this study, discussions were held with personnel in the International Safeguards Community who were familiar with the shipping casks used in their States. A number of shipping casks were examined, and discussions were held with two shipping cask manufacturers in the US. As a result of these efforts, it was concluded that the shipping casks provided an extremely good containment, and that many of the existing casks can be effectively sealed by applying the seal to the cask closure bolts/nuts
Development of a nuclear ship safety philosophy
International Nuclear Information System (INIS)
Thompson, T.E.
1978-01-01
A unique safety philosophy must be recognized and accepted as an integral part of the design and operation of a nuclear ship. For the nuclear powered ship, the ultimate safety of the reactor and therefore the crew and the environment lies with the safety of the ship itself. The basis for ship safety is its ability to navigate and survive the conditions or the environment in which it may find itself. The subject of traditional ship safety is examined along with its implication for reactor protection and safety. Concepts of reactor safety are also examined. These two philosophies are combined in a manner so as to provide a sound philosophy for the safety of nuclear ships, their crews, and the environment
15 CFR 750.11 - Shipping tolerances.
2010-01-01
... in the ECCN applicable to your item reads “ $ value” or “in $ value”, there is no shipping tolerance... is no shipping tolerance with respect to the number of units. However, the value of all of your... shipping tolerance on this license because the items are controlled by an ECCN where “$ value” is the...
Ship design methodologies of preliminary design
Papanikolaou, Apostolos
2014-01-01
This book deals with ship design and in particular with methodologies of the preliminary design of ships. The book is complemented by a basic bibliography and five appendices with useful updated charts for the selection of the main dimensions and other basic characteristics of different types of ships (Appendix A), the determination of hull form from the data of systematic hull form series (Appendix B), the detailed description of the relational method for the preliminary estimation of ship weights (Appendix C), a brief review of the historical evolution of shipbuilding science and technology from the prehistoric era to date (Appendix D) and finally a historical review of regulatory developments of ship's damage stability to date (Appendix E). The book can be used as textbook for ship design courses or as additional reading for university or college students of naval architecture courses and related disciplines; it may also serve as a reference book for naval architects, practicing engineers of rel...
Potential risks of nuclear ships
International Nuclear Information System (INIS)
Oelgaard, P.L.
1994-07-01
This report represents an attempt to evaluate the potential risks of nuclear ships. Firstly reasons are given why nuclear ship accidents will not lead to accidents of the magnitude of the Chernobyl accident. This is due to much lower content of radioactive material and to different reactor designs. Next a review is given of the types of accidents which have actually occurred. Of these the reactor accidents which may lead to serious consequences for the crew and the environment are considered further. These are reactivity accidents and loss of coolant accidents. In addition the long term risks of sunken nuclear ships and sea disposed reactor compartments etc. are also discussed. Based on available accident data an attempt is made to estimate the probability of serious nuclear ship accidents. (au)
Occupational accidents aboard merchant ships
DEFF Research Database (Denmark)
Hansen, H.L.; Nielsen, D.; Frydenberg, Morten
2002-01-01
Objectives: To investigate the frequency, circumstances, and causes of occupational accidents aboard merchant ships in international trade, and to identify risk factors for the occurrence of occupational accidents as well as dangerous working situations where possible preventive measures may...... be initiated. Methods: The study is a historical follow up on occupational accidents among crew aboard Danish merchant ships in the period 1993–7. Data were extracted from the Danish Maritime Authority and insurance data. Exact data on time at risk were available. Results: A total of 1993 accidents were...... aboard. Relative risks for notified accidents and accidents causing permanent disability of 5% or more were calculated in a multivariate analysis including ship type, occupation, age, time on board, change of ship since last employment period, and nationality. Foreigners had a considerably lower recorded...
Techno-economic investigation of alternative propulsion plants for Ferries and RoRo ships
International Nuclear Information System (INIS)
Livanos, George A.; Theotokatos, Gerasimos; Pagonis, Dimitrios-Nikolaos
2014-01-01
Highlights: • Alternative Diesel and Gas engine propulsion plants of Ferries and RoRos were studied. • Special focus on marine Natural Gas burning engines and ship waste heat recovery systems. • Significant savings in annual operating costs were predicted in the case of Natural Gas engines. • Environmental and economic optimum propulsion plant alternative was proposed in a specific case study. - Abstract: In this paper, the main alternative propulsion plants based on reciprocating internal combustion engines of a ferry or RoRo ship operating in routes that include Emission Control Areas (ECAs) are comparatively assessed. Specifically, a dual fuel engine propulsion plant is compared with a conventional Diesel engine plant. For both cases, the installation of a waste heat recovery system, which covers a part of the ship electric energy demand, is also considered. The ship main DF engines are assumed to operate using LNG and a small amount of MDO for initiating combustion, whereas low sulphur MDO was regarded as the fuel for the case of the Diesel engine plant. The installation of Selective Catalytic Reduction (SCR) after-treatment unit for reducing the NOx emissions for the case of Diesel engines plant is also taken into account. The propulsion plants were modelled under steady state conditions, and the simulation results were analysed in order to compare the alternative configurations. Furthermore, the Energy Efficiency Design Index (EEDI) values were calculated and the two examined propulsion system cases were compared on EEDI basis. Finally, the Life Cycle Cost for each alternative propulsion plant was calculated and used for completing an economic evaluation of the Dual fuel propulsion plant versus the conventional designs applied in ferries
Concept Design and Risk Assessment of Nuclear Propulsion Ship
International Nuclear Information System (INIS)
Gil, Youngmi; Yoo, Seongjin; Kim, Yeontae; Oh, June; Byun, Yoonchul; Woo, Ilguk; Kim, Jiho; Choi, Suhn
2014-01-01
The nuclear propulsion ships (hereinafter referred to as 'nuclear ships') have been considered as an eco-friendly ship. There have historically been warship and submarine with the source of nuclear power. The use of nuclear ships has been recently extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, we evaluated the economics of various types of ships and concluded that the container ship could be appropriate for the nuclear propulsion. In order to verify its safety, we performed the ship calculation based on the optimal arrangement of the nuclear reactor. Finally, we verified its safety by the HAZID. In the former research, we confirmed the applicability of the nuclear propulsion system for the large container ship. In this study, we verified the safety of the nuclear ships according to the HAZID analysis. We expect that this research will lead to safe design of the nuclear ships
Concept Design and Risk Assessment of Nuclear Propulsion Ship
Energy Technology Data Exchange (ETDEWEB)
Gil, Youngmi; Yoo, Seongjin; Kim, Yeontae; Oh, June; Byun, Yoonchul; Woo, Ilguk [Daewoo Shipbuilding and Marine Engineering Co. Ltd., Seoul (Korea, Republic of); Kim, Jiho; Choi, Suhn [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2014-05-15
The nuclear propulsion ships (hereinafter referred to as 'nuclear ships') have been considered as an eco-friendly ship. There have historically been warship and submarine with the source of nuclear power. The use of nuclear ships has been recently extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, we evaluated the economics of various types of ships and concluded that the container ship could be appropriate for the nuclear propulsion. In order to verify its safety, we performed the ship calculation based on the optimal arrangement of the nuclear reactor. Finally, we verified its safety by the HAZID. In the former research, we confirmed the applicability of the nuclear propulsion system for the large container ship. In this study, we verified the safety of the nuclear ships according to the HAZID analysis. We expect that this research will lead to safe design of the nuclear ships.
Automatic temperature control method of shipping can
International Nuclear Information System (INIS)
Nishikawa, Kaoru.
1992-01-01
The present invention provides a method of rapidly and accurately controlling the temperature of a shipping can, which is used upon shipping inspection for a nuclear fuel assembly. That is, a measured temperature value of the shipping can is converted to a gas pressure setting value in a jacket of the shipping can by conducting a predetermined logic calculation by using a fuzzy logic. A gas pressure control section compares the pressure setting value of a fuzzy estimation section and the measured value of the gas pressure in the jacket of the shipping can, and conducts air supply or exhaustion of the jacket gas so as to adjust the measured value with the setting value. These fuzzy estimation section and gas pressure control section control the gas pressure in the jacket of the shipping can to control the water level in the jacket. As a result, the temperature of the shipping can is controlled. With such procedures, since the water level in the jacket can be controlled directly and finely, temperature of the shipping can is automatically controlled rapidly and accurately compared with a conventional case. (I.S.)
Ship Observations - VOS and Navy
National Oceanic and Atmospheric Administration, Department of Commerce — Combination of Voluntary Observing Ship (VOS) and US Navy Ship weather observations. Obs generally taken 2-4 times daily at 00, 06, 12, and 18z.
Department of Homeland Security — Various shipping zones delineate activities and regulations for marine vessel traffic. Traffic lanes define specific traffic flow, while traffic separation zones...
National Research Council Canada - National Science Library
1997-01-01
.... One additional multiproduct ship of a new class is currently under construction. The Navy has delegated operational control of 27 of these ships to MSC, the military's single manager for sealift, to better...
Directory of Open Access Journals (Sweden)
S. B. Dalsøren
2009-03-01
Full Text Available A reliable and up-to-date ship emission inventory is essential for atmospheric scientists quantifying the impact of shipping and for policy makers implementing regulations and incentives for emission reduction. The emission modelling in this study takes into account ship type and size dependent input data for 15 ship types and 7 size categories. Global port arrival and departure data for more than 32 000 merchant ships are used to establish operational profiles for the ship segments. The modelled total fuel consumption amounts to 217 Mt in 2004 of which 11 Mt is consumed in in-port operations. This is in agreement with international sales statistics. The modelled fuel consumption is applied to develop global emission inventories for CO2, NO2, SO2, CO, CH4, VOC (Volatile Organic Compounds, N2O, BC (Black Carbon and OC (Organic Carbon. The global emissions from ships at sea and in ports are distributed geographically, applying extended geographical data sets covering about 2 million global ship observations and global port data for 32 000 ships. In addition to inventories for the world fleet, inventories are produced separately for the three dominating ship types, using ship type specific emission modelling and traffic distributions.
A global Chemical Transport Model (CTM was used to calculate the environmental impacts of the emissions. We find that ship emissions is a dominant contributor over much of the world oceans to surface concentrations of NO2 and SO2. The contribution is also large over some coastal zones. For surface ozone the contribution is high over the oceans but clearly also of importance over Western North America (contribution 15–25% and Western Europe (5–15%. The contribution to tropospheric column ozone is up to 5–6%. The overall impact of ship emissions on global methane lifetime is large due to the high NOx emissions. With
Folkert Boersma, K.; Vinken, Geert C. M.; Tournadre, Jean
2015-07-01
We address the lack of temporal information on ship emissions, and report on rapid short-term variations of satellite-derived ship NOx emissions between 2005 and 2012 over European seas. Our inversion is based on OMI observed tropospheric NO2 columns and GEOS-Chem simulations. Average European ship NOx emissions increased by ˜15% from 2005 to 2008. This increase was followed by a reduction of ˜12% in 2009, a direct result of the global economic downturn in 2008-2009, and steady emissions from 2009 to 2012. Observations of ship passages through the Suez Canal and satellite altimeter derived ship densities suggests that ships in the Mediterranean Sea have reduced their speed by more than 30% since 2008. This reduction in ship speed is accompanied by a persistent 45% reduction of average, per ship NOx emission factors. Our results indicate that the practice of ‘slow steaming’, i.e. the lowering of vessel speed to reduce fuel consumption, has indeed been implemented since 2008, and can be detected from space. In spite of the implementation of slow steaming, one in seven of all NOx molecules emitted in Europe in 2012 originated from the shipping sector, up from one in nine in 2005. The growing share of the shipping contributions to the overall European NOx emissions suggests a need for the shipping sector to implement additional measures to reduce pollutant emissions at rates that are achieved by the road transport and energy producing sectors in Europe.
Study of Volatility of New Ship Building Prices in LNG Shipping
Directory of Open Access Journals (Sweden)
T. Bangar Raju
2016-12-01
Full Text Available The natural gas market has been expanding in size and has attracted particular attention across the global energy market. Although most natural gas transportation is carried out through pipelines, almost one third of it is done with the help of merchant vessels, capable of carrying liquefied natural gas. These LNG carriers have a special design and thus can be treated as a separate class of global fleet. New vessels are huge capital investments by vessel owning companies and just like other vessel classes; the new shipbuilding prices for the LNG segment continue to be a key aspect in the decision making of business players. Additionally these prices can be volatile as new ship building prices fluctuate with time. This paper attempts to analyse the volatility of new ship building prices of LNG carriers. For the study, the average ship building prices for all the LNG carriers having volume carrying capacity is between 160,000 – 173,000 cbm to be delivered between 2016 – 2019 were taken into account. For the analysis, GARCH and EGARCH methods were applied on the data set. The analysis concluded that there is a great deal of volatility in the new ship building prices of LNG vessels. It was also identified that negative shocks were more persistent the positive shocks.
LNG demand, shipping will expand through 2010
International Nuclear Information System (INIS)
True, W.R.
1998-01-01
The 1990s, especially the middle years, have witnessed a dramatic turnaround in the growth of liquefied-natural-gas demand which has tracked equally strong natural-gas demand growth. This trend was underscored late last year by several annual studies of world LNG demand and shipping. As 1998 began, however, economic turmoil in Asian financial markets has clouded near-term prospects for LNG in particular and all energy in general. But the extent of damage to energy markets is so far unclear. A study by US-based Institute of Gas Technology, Des Plaines, IL, reveals that LNG imports worldwide have climbed nearly 8%/year since 1980 and account for 25% of all natural gas traded internationally. In the mid-1970s, the share was only 5%. In 1996, the most recent year for which complete data are available, world LNG trade rose 7.7% to a record 92 billion cu m, outpacing the overall consumption for natural gas which increased 4.7% in 1996. By 2015, says the IGT study, natural-gas use would surpass coal as the world''s second most widely used fuel, after petroleum. Much of this growth will occur in the developing countries of Asia where gas use, before the current economic crisis began, was projected to grow 8%/year through 2015. Similar trends are reflected in another study of LNG trade released at year end 1997, this from Ocean Shipping Consultants Ltd., Surrey, U.K. The study was done too early, however, to consider the effects of the financial problems roiling Asia
Evaluation of the Service Performance of Ships
DEFF Research Database (Denmark)
Andersen, Poul; Borrod, Anne-Sophie; Blanchot, Hervé
2005-01-01
A simple method has been established for the evaluation of the service performance of ships. Input data are easily collected daily on board and transformed to a well-defined condition that makes possible the comparison between ships, for instance, sister ships, and between different time periods...... of voyages for the same ship. The procedure has been applied to two ships that are identical, with the exception that one has a conventional propeller, whereas the other one is fitted with a high-efficiency propeller of the KAPPEL type. The results are obtained from a period of 2 years steaming for both...
Transnucleaire's experience in ship adaptation
International Nuclear Information System (INIS)
Brachet, Y.; Vallette-Fontaine, M.
2000-01-01
Due to the application of the new IMDG regulations for the transport of radioactive material by sea, the conditions of transport of MTR spent fuel have drastically changed five years ago. In this paper, TRANSNUCLEAIRE analyses the necessary modifications to apply to existing ships in order to comply with the IMDG/INF regulations as well as with the Japanese KAISA 520 regulation. In the MTR spent fuel transport market characterized by a competitive approach, TRANSNUCLEAIRE has carried out many transports by sea in full compliance with the regulations at a price which is as close as possible to that of other industrial goods and without the need to fully dedicate the BOUGUENAIS ship to nuclear transports. Innovative ship design solutions have been implemented and accepted by different Authorities uncluding the Advisory Committee of the Japanese MOT. Due to efficient finite element calculations, benchmarked by laboratory large scale tests, high performances crushing materials have been developed in order to absorb the energy of collision between ships. These developments have led ta propose an efficient ship design complying with all the existing worldwide nuclear regulations. (author)
International Nuclear Information System (INIS)
Eyring, V.; Lauer, A.; Lemper, B.
2004-01-01
We use the today's fleet-average emission factors of the most important ship exhausts to calculate emission scenarios for the future. To develop plausible future scenarios we first discuss upcoming regulations and compliance with future regulations through technological improvements. We present geographically resolved emission inventory forecast scenarios for the years 2020 and 2050. The scenarios are based on some very strict assumptions of future ship traffic demand and technological improvements. The future ship traffic demand scenario is mainly determined by the economic growth and the growth in world seaborne trade and distinguishes between different ship types. The annual growth rates of sea trade volumes and expected vessel traffic density is assumed to be smaller for today's most frequently sailed routes (in particular east-west-trades) than for those that are currently less frequently sailed (in particular south-north-trades). This leads to an adjustment of the number of ships sailing the different shipping routes in 2020 and even stronger in 2050. For the future technology scenarios we assume a diesel-only fleet in 2020 resulting in an estimated fuel consumption of 422 million metric tons (Mt) and 1226 Tg CO 2 emissions. For 2050 one scenario for fuel consumption assumes that 25% of the fuel consumed by a diesel-only fleet can be saved by using future alternative propulsion plants, resulting in a fuel consumption of 422 Mt and 1339 Tg CO 2 emissions in 2050. The other scenario is a business-as-usual scenario for a diesel-only fleet even in 2050 and gives an estimate of 646 Mt and 1783 Tg CO 2 emissions in 2050. Dependent on how rapid technology improvements for diesel engines are introduced we present four different technology scenarios. (orig.)
Ship-to-Ship Radiocommunication Trial by Using Wireless LAN
Directory of Open Access Journals (Sweden)
Yasuyuki Niwa
2015-12-01
In a former field radiocommunication trial, omni-directional antennas were used and a few hundred kbps throughput between two ships was measured, which was not enough for our research target (over 1Mbps. In order to get faster throughput, a field radiocommunication trial was carried out again with a few types of directional antennas and RSSI (Received Signal Strength Indication and the throughput between two ships was measured simultaneously. As a result, multi-path (2-path model affected by the reflection of the sea surface was confirmed and also the characteristics of the directional antennas such as half-power angle were confirmed, but the measured throughput was fast enough to meet our expectation.
Note from the radioprotection group's shipping service
2006-01-01
The service for the import/export of radioactive materials reminds you that shipping requests for potentially radioactive materials must be made via the EDH request form by ticking the box 'radioactive material'. All the necessary information is given on the web site: http://cern.ch/service-rp-shipping Requests not complying with the above procedure will not be taken into account. Radioactive Shipping Service http://cern.ch/service-rp-shipping Tel. 73171 Fax: 69200
48 CFR 47.305-16 - Shipping characteristics.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Shipping characteristics... CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 47.305-16 Shipping characteristics... shipments of agreed size. (b) Guaranteed shipping characteristics. (1) The contracting officer shall insert...
Ships - inspiring objects in architecture
Marczak, Elzbieta
2017-10-01
Sea-going vessels have for centuries fascinated people, not only those who happen to work at sea, but first and foremost, those who have never set foot aboard a ship. The environment in which ships operate is reminiscent of freedom and countless adventures, but also of hard and interesting maritime working life. The famous words of Pompey: “Navigare necesseest, vivere non estnecesse” (sailing is necessary, living - is not necessary), which he pronounced on a stormy sea voyage, arouse curiosity and excitement, inviting one to test the truth of this saying personally. It is often the case, however, that sea-faring remains within the realm of dreams, while the fascination with ships demonstrates itself through a transposition of naval features onto land constructions. In such cases, ship-inspired motifs bring alive dreams and yearnings as well as reflect tastes. Tourism is one of the indicators of people’s standard of living and a measure of a society’s civilisation. Maritime tourism has been developing rapidly in recent decades. A sea cruise offers an insight into life at sea. Still, most people derive their knowledge of passenger vessels and their furnishings from the mass media. Passenger vessels, also known as “floating cities,” are described as majestic and grand, while their on-board facilities as luxurious, comfortable, exclusive and inaccessible to common people on land. Freight vessels, on the other hand, are described as enormous objects which dwarf the human being into insignificance. This article presents the results of research intended to answer the following questions: what makes ships a source of inspiration for land architecture? To what extent and by what means do architects draw on ships in their design work? In what places can we find structures inspired by ships? What ships inspire architects? This article presents examples of buildings, whose design was inspired by the architecture and structural details of sea vessels. An analysis of
India's ship recycling trade-off
Worrell, E.; Athanasopoulou, V.
2014-01-01
The special nature of India's steel industry lends particular importance to ship recycling as a source of scrap. Ship recycling in upgraded 'green' facilities can substitute other 'dirty' ironmaking processes, resulting in energy savings and air pollutant emission reductions for the Indian steel
Logistics Group
2001-01-01
Users are informed that as from 1 September 2001 all Shipping Requests must be made on EDH using the appropriate electronic form. The submission of user requests directly into EDH will help rationalise the activities of the Shipping Service (Import & Export), with requests being automatically forwarded to hierarchical supervisors thereby improving the processing speed and facilitating the follow-up. Thank you for your collaboration.
A building cost estimation method for inland ships
Hekkenberg, R.G.
2014-01-01
There is very little publicly available data about the building cost of inland ships, especially for ships that have dimensions that differ significantly from those of common ships. Also, no methods to determine the building cost of inland ships are described in literature. In this paper, a method
Federal Laboratory Consortium — The U. S. Navy dedicated the decommissioned Spruance Class destroyer ex-PAUL F. FOSTER (EDD 964), Test Ship, primarily for at sea demonstration of short range weapon...
Wang, Y.; Xue, Y.; Huang, B.; Lee, J.; De Sales, F.
2016-12-01
A long term simulation has been conducted using the Climate Forecast System (CFSv2) coupled to the SSiB-2 land model, which consists of the Global Forecast System atmospheric model (GFS) and the Modular Ocean model - version 4 (MOM4) as the ocean component. This study evaluates the model's performance in simulating sea surface temperature (SST) mean state, trend, and inter-annual and decadal variabilities. The model is able to produce the reasonable spatial distribution of the SST climatology; however, it has prominent large scale biases. In the middle latitude of the Northern Hemisphere, major cold biases is close to the warm side of the large SST gradients, which may be associated with the weaker Kuroshio and Gulf Stream extensions that diffuse the SST gradient. IN addition, warm biases extend along the west coast of the North America continent to the high latitude, which may be related with excessive Ekman down-welling and solar radiation fluxes reaching to the surface due to the lack of cloud there. Warm biases also exist over the tropical cold tough areas in the Pacific and Atlantic. The global SST trend and interannual variations are well captured except for that in the south Hemisphere after year 2000, which is mainly contributed by the bias from the southern Pacific Ocean. Although the model fails to accurately produce ENSO events in proper years, it does reproduce the ENSO frequency well; they are skewed toward more warm events after 1990. The model also shows ability in SST decadal variation, such as the so-called inter-decadal Pacific oscillation (IPO); however, its phases seem to go reversely compared with the observation.
The complex network of global cargo ship movements.
Kaluza, Pablo; Kölzsch, Andrea; Gastner, Michael T; Blasius, Bernd
2010-07-06
Transportation networks play a crucial role in human mobility, the exchange of goods and the spread of invasive species. With 90 per cent of world trade carried by sea, the global network of merchant ships provides one of the most important modes of transportation. Here, we use information about the itineraries of 16 363 cargo ships during the year 2007 to construct a network of links between ports. We show that the network has several features that set it apart from other transportation networks. In particular, most ships can be classified into three categories: bulk dry carriers, container ships and oil tankers. These three categories do not only differ in the ships' physical characteristics, but also in their mobility patterns and networks. Container ships follow regularly repeating paths whereas bulk dry carriers and oil tankers move less predictably between ports. The network of all ship movements possesses a heavy-tailed distribution for the connectivity of ports and for the loads transported on the links with systematic differences between ship types. The data analysed in this paper improve current assumptions based on gravity models of ship movements, an important step towards understanding patterns of global trade and bioinvasion.
Bio-indications of sunken ships and ship wrecks
Digital Repository Service at National Institute of Oceanography (India)
Parulekar, A
An evaluation of bottom fauna of ship-wreck sites in estuarine and coastal waters of Goa, India, revealed an exceptionally high biotic enrichment. In terms of number of species, faunal dispersion, faunal diversity, biomass and productivity, in space...
Ships and the Sailors Inside Them
National Research Council Canada - National Science Library
Sims, Philip
2004-01-01
.... Iron shipbuilding allowed safer and healthier ships but their internal compartmentation created communication problems which were gradually solved with mechanical systems Ships developed their own...
Prototypic fabrication of TRIGA irradiated fuel shipping casks
International Nuclear Information System (INIS)
Kim, B.K.; Lee, Y.W.; Whang, C.K.; Lee, J.B.
1980-01-01
This is the safety analysis report on the prototypic fabrication of ''TRIGA Irradiated Fuel Shipping Cask'' conducted by KAERI in 1980. The results of the evaluation show that the shipping cask is in compliance with the applicable regulation for the normal conditions of transport as well as hypothetical accident conditions. The prototypic fabrication of the shipping cask (type B) was carried out for the first time in Korea after getting technical experience from fabrication of the ''TRIGA Spent Fuel Shipping Cask'' and ''the KO-RI Unit 1 surveillance capsule shipping cask'' in 1979. This report contains structural evaluation, thermal evaluation, shielding, criticality, quality assurance, and handling procedures of the shipping cask
Challenges to Ship Hydrodynamics in the XXI Century
Directory of Open Access Journals (Sweden)
Lech Kobylinski
2014-09-01
Full Text Available The beginning of twenty-first century is characterized with important changes in world shipping and exploitation of ocean resources. Three important trends are clearly visible: environment protection, safety and economy. They materialize in important changes in the structure of world fleet where some existing ship types are going to disappear and new ship types emerge. Increasing the size of some ship types is another visible tendency. Stress on environment protection has serious impact on the hydrodynamic characteristics of ships whether with regard to safety zero accident rate is the goal. Important challenges to ship hydrodynamics caused by those tendencies are discussed in the paper.
International Nuclear Information System (INIS)
1976-01-01
The NOAA Ship Operations Report 1975 was developed to provide a summary of projects undertaken during calendar year 1975. The report was prepared from season, cruise and special reports submitted by ships of the fleet. This report is promulgated for inhouse dissemination in the National Oceanic and Atmospheric Administration, for collaborating and interested agencies, and for use by members of the scientific community. Throughout the year, ships routinely collected and transmitted weather data. Similarly, as NOAA participants in the Integrated Global Ocean Station System (IGOSS) service program, XBT observations were taken and either radioed or submitted in log form via mail. In addition, particulate and radionuclide samples were taken in cooperation with the Atomic Energy Commission, sediment samples were obtained for the Smithsonian Institution and observations were made of marine mammals
Single liner shipping service design
DEFF Research Database (Denmark)
Plum, Christian Edinger Munk; Pisinger, David; Salazar-González, Juan-José
2014-01-01
The design of container shipping networks is an important logistics problem, involving assets and operational costs measured in billions of dollars. To guide the optimal deployment of the ships, a single vessel round trip is considered by minimizing operational costs and flowing the best paying...
Auxiliary facilities on nuclear ship 'MUTSU'
International Nuclear Information System (INIS)
Tsujimura, Shotaro; Takigami, Yoshio.
1989-01-01
The nuclear ship 'MUTSU' has been moored at SEKINEHAMA, MUTU City in AOMORI Prefecture and several tests and works are being carried out on the ship. The construction of the auxiliary facilities for these works on the ship was completed in safety in August 1988. After that the facilities have fulfilled their function. The outlines of design, fabrication and construction of the facilities are described in this paper. (author)
Production Balance of Ship Erection
Institute of Scientific and Technical Information of China (English)
JIANG Ru-hong; TAN Jia-hua; LIU Cun-gen
2008-01-01
A network plan model of ship erection was established based on the network planning technologyand the work-package breakdown system. The load-oriented production control method was introduced to buildup a throughput diagram model thus it is possible to describe the ship erection process numerically. Based onthe digitaiized models some cases of production balance of ship erection were studied and three balance indexeswere put forward, they are the load balance rate, the input manpower balance rate and the maximum gantrycrane operating times. Such an analytic method based on the balance evaluation is the important foundationfor digitization and intelligentization of shipyard production management.
MASTER OF THE SHIP, MANAGER AND INSTRUCTOR
Directory of Open Access Journals (Sweden)
Florin IORDANOAIA
2010-01-01
Full Text Available The master of the ship is the person on the board who has the qualification and the necessary certificate of competency for running a maritime transport ship. He is the one who takes the ship into administration from the ship-owner, he is the only leader, the legal and direct chief of the entire crew, being invested with authority upon all the members of the crew. The master fulfils the attributes and displays his activity according to the legal laws of his flag, of the marine regulations and of the international conventions. In all the relationships which he establishes with physical or juridical people, the master represents the ship-owner, in a double condition, as an officer and as a commercial manager. In this paper, it is analysed the situation of the ship masters, the relationships which these masters have with the crew and the problems which appear during their voyage. At the end of the paper there are proposed measures to increase the quality of the training of the ship masters, to solve the situations connected with the members of the crew.
Ship dynamics for maritime ISAR imaging.
Energy Technology Data Exchange (ETDEWEB)
Doerry, Armin Walter
2008-02-01
Demand is increasing for imaging ships at sea. Conventional SAR fails because the ships are usually in motion, both with a forward velocity, and other linear and angular motions that accompany sea travel. Because the target itself is moving, this becomes an Inverse- SAR, or ISAR problem. Developing useful ISAR techniques and algorithms is considerably aided by first understanding the nature and characteristics of ship motion. Consequently, a brief study of some principles of naval architecture sheds useful light on this problem. We attempt to do so here. Ship motions are analyzed for their impact on range-Doppler imaging using Inverse Synthetic Aperture Radar (ISAR). A framework for analysis is developed, and limitations of simple ISAR systems are discussed.
Communication from the Radioactive Shipping Service
DDGS Unit
2011-01-01
The radioactive materials Import/Export service reminds you that all movements of potentially radioactive material must be declared in advance. For exports, shipping requests must be made via the EDH request form, ticking the box “radioactive material”. For imports, an electronic form must be completed before the arrival of the material. Requests which do not comply with the above procedure and any unauthorized imports of radioactive material will be refused.The same applies to imports/exports of radioactive sources. All necessary information is given in the web site: http://cern.ch/service-rp-shipping Yann Donjoux / Radioactive Shipping Service Phone: +41 22 767.31.71 Fax: +41 22 766.92.00 Email: service-rp-shipping@cern.ch
Nuclear powered freight ships - safe and reliable
International Nuclear Information System (INIS)
Schafstall, H.C.
1978-12-01
The five nuclear-powered ships built in the world so far have entered over 100 ports in 14 countries about 1000 times in 15 years, during which there were no accidents endangering the safety of a ship. However, for the expansion of freight shipping with nuclear power, comprehensive international regulations for safety requirements, responsibility etc., are necessary. Although the NEA/IAEO symposium excluded economic questions on the safety of nuclear powered ships, the trends regarding further development in individual countries became clear
Small, simple but useful: the SSI approach to a real-time system for decision making support
International Nuclear Information System (INIS)
Baeverstam, U.
1993-01-01
In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)
Structural health monitoring for ship structures
Energy Technology Data Exchange (ETDEWEB)
Farrar, Charles [Los Alamos National Laboratory; Park, Gyuhae [Los Alamos National Laboratory; Angel, Marian [Los Alamos National Laboratory; Bement, Matthew [Los Alamos National Laboratory; Salvino, Liming [NSWC, CADEROCK
2009-01-01
Currently the Office of Naval Research is supporting the development of structural health monitoring (SHM) technology for U.S. Navy ship structures. This application is particularly challenging because of the physical size of these structures, the widely varying and often extreme operational and environmental conditions associated with these ships missions, lack of data from known damage conditions, limited sensing that was not designed specifically for SHM, and the management of the vast amounts of data that can be collected during a mission. This paper will first define a statistical pattern recognition paradigm for SHM by describing the four steps of (1) Operational Evaluation, (2) Data Acquisition, (3) Feature Extraction, and (4) Statistical Classification of Features as they apply to ship structures. Note that inherent in the last three steps of this process are additional tasks of data cleansing, compression, normalization and fusion. The presentation will discuss ship structure SHM challenges in the context of applying various SHM approaches to sea trials data measured on an aluminum multi-hull high-speed ship, the HSV-2 Swift. To conclude, the paper will discuss several outstanding issues that need to be addressed before SHM can make the transition from a research topic to actual field applications on ship structures and suggest approaches for addressing these issues.
Report of Nuclear Powered Ship Council
International Nuclear Information System (INIS)
1982-01-01
From the forecast of energy balance in the world to 21st century, the diversification of energy supply and the technical development enabling it are necessary in Japan. The stable supply of marine fuel is important to maintain and develop the national life. At present, as the marine fuel substituting for petroleum, atomic energy is at the position nearest to practical use. In advanced countries, the basic technology required for the practical use of nuclear-powered merchant ships seems to have been established, but Japan is about 10 years behind them due to the delay of the Mutsu project. In order to maintain and improve the technical level of shipbuilders, the independent technology related to nuclear-powered ships must be established in Japan. In the economical examination of nuclear-powered ships, ice breakers and ice breaking tankers are advantageous, but in other types of ships, a number of conditions must be satisfied to be economical. The Mutsu must be operated to collect the data and experience, and the project of an improved marine prototype reactor must be decided. Also a demonstration ship must be built. The standards for the design, construction and operation of nuclear-powered ships and the public acceptance are necessary. (Kako, I.)
Ship exhaust gas plume cooling
Schleijpen, H.M.A.; Neele, P.P.
2004-01-01
The exhaust gas plume is an important and sometimes dominating contributor to the infrared signature of ships. Suppression of the infrared ship signatures has been studied by TNO for the Royal Netherlands Navy over considerable time. This study deals with the suppression effects, which can be
Note from the radioprotection group's shipping service
2006-01-01
Le service SHIPPING du groupe de radioprotection souhaite vous rappeler qu'avant toute expédition de matériel susceptible d'être radioactif, une demande de transport doit être établie par EDH en cochant la case appropriée (danger radioactif). Merci de bien vouloir prendre note des informations figurant dans le site Web: http://cern.ch/service-rp-shipping Toute demande non conforme ne sera pas prise en compte. Radioactive Shipping Service http://cern.ch/service-rp-shippingTél: 73171Fax: 69200
Energy Technology Data Exchange (ETDEWEB)
Kawabe, H. [National Defense Academy, Kanagawa (Japan); Masaoka, K. [University of Osaka Prefecture, Osaka (Japan). Faculty of Engineering
1998-06-01
There is a large number of studies on discussions concerning accuracy of visual observation of waves and the correction method thereon. This paper give considerations on observation accuracy placing a viewpoint on that by merchant ships. Based on ship meteorological observation tables reported to the Meteorological Agency of Japan on meteorology in North Pacific during 14 years from 1976 to1989, wave observation values taken by merchant ships and observation ships were compared statistically to investigate the accuracy of visual wave observations carried out by merchant ships. With regard to wave heights, the observation values taken by the observation ships and the merchant ships have strong correlation, where the merchant ships evaluate them somewhat higher than the observation ships. Regarding wave cycles of wind waves, the merchant ships tend to have the observation values on longer cycle side. Correlation between the observations values by the merchant ships and the observation ships is weak both in wind waves and swells. There is not much of variation in accuracy of observations during daytime and at night performed by the merchant ships. It will be necessary in the future to give considerations on a method to correct the observation values on wave cycles taken by the merchant ship, and on a correction method in which both of the wave cycles and the wave heights are corrected simultaneously to make the observation values of the merchant ship equal to those of the observation ships. Thus, the observation values reported by general merchant ships in a large number every year will have to be utilized more effectively. 11 refs., 21 figs., 2 tabs.
International Nuclear Information System (INIS)
Boersma, K Folkert; Vinken, Geert C M; Tournadre, Jean
2015-01-01
We address the lack of temporal information on ship emissions, and report on rapid short-term variations of satellite-derived ship NO x emissions between 2005 and 2012 over European seas. Our inversion is based on OMI observed tropospheric NO 2 columns and GEOS-Chem simulations. Average European ship NO x emissions increased by ∼15% from 2005 to 2008. This increase was followed by a reduction of ∼12% in 2009, a direct result of the global economic downturn in 2008–2009, and steady emissions from 2009 to 2012. Observations of ship passages through the Suez Canal and satellite altimeter derived ship densities suggests that ships in the Mediterranean Sea have reduced their speed by more than 30% since 2008. This reduction in ship speed is accompanied by a persistent 45% reduction of average, per ship NO x emission factors. Our results indicate that the practice of ‘slow steaming’, i.e. the lowering of vessel speed to reduce fuel consumption, has indeed been implemented since 2008, and can be detected from space. In spite of the implementation of slow steaming, one in seven of all NO x molecules emitted in Europe in 2012 originated from the shipping sector, up from one in nine in 2005. The growing share of the shipping contributions to the overall European NO x emissions suggests a need for the shipping sector to implement additional measures to reduce pollutant emissions at rates that are achieved by the road transport and energy producing sectors in Europe. (letter)
Nuclear powered ships. Findings from a feasibility study
International Nuclear Information System (INIS)
Namikawa, Shunichiro; Maerli, Morten Bremer; Hoffmann, Peter Nyegaard; Brodin, Erik
2011-01-01
Nuclear shipping is attractive for several reasons, one of which is its positive effect on emissions (CO 2 , NOx and SOx). The benefits, however, do not come without risks of possible harmful effects on humans and wildlife. Nuclear ships set themselves apart from conventional ships, as well as from on-shore nuclear power-plants, on several counts. 1) The reactor-unit are non-stationary, and the reactor is subject to the ship motions. 2) Ship reactors must be compact due to space constraints. 3) Special design considerations are required to ensure reactor safety and security, as well as to enable refuelling. 4) A naval nuclear fuel cycle infrastructure for fuel fabrication, handling, and disposal is needed. Technological feasibility of nuclear shipping is by itself inconclusive to a expansion into civilian applications and use. Civilian nuclear propulsion needs to be commercially viable and politically acceptable. Appropriate legislation must be in place, and nuclear shipping concepts with proven safety records and highest possible nuclear proliferation-resistance must be established. Possible 'showstoppers' to a viable nuclear civilian shipping industry are outlined in the paper in view of Political, Technical, Regulatory, Commercial, Safety and Security aspects. Further, different types of ships with different propulsion system are compared in lights of life cycle cost and air emission. (author)
Wallops Ship Surveillance System
Smith, Donna C.
2011-01-01
Approved as a Wallops control center backup system, the Wallops Ship Surveillance Software is a day-of-launch risk analysis tool for spaceport activities. The system calculates impact probabilities and displays ship locations relative to boundary lines. It enables rapid analysis of possible flight paths to preclude the need to cancel launches and allow execution of launches in a timely manner. Its design is based on low-cost, large-customer- base elements including personal computers, the Windows operating system, C/C++ object-oriented software, and network interfaces. In conformance with the NASA software safety standard, the system is designed to ensure that it does not falsely report a safe-for-launch condition. To improve the current ship surveillance method, the system is designed to prevent delay of launch under a safe-for-launch condition. A single workstation is designated the controller of the official ship information and the official risk analysis. Copies of this information are shared with other networked workstations. The program design is divided into five subsystems areas: 1. Communication Link -- threads that control the networking of workstations; 2. Contact List -- a thread that controls a list of protected item (ocean vessel) information; 3. Hazard List -- threads that control a list of hazardous item (debris) information and associated risk calculation information; 4. Display -- threads that control operator inputs and screen display outputs; and 5. Archive -- a thread that controls archive file read and write access. Currently, most of the hazard list thread and parts of other threads are being reused as part of a new ship surveillance system, under the SureTrak project.
29 CFR 1915.164 - Ship's propulsion machinery.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Ship's propulsion machinery. 1915.164 Section 1915.164 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.164 Ship's...
47 CFR 80.59 - Compulsory ship inspections.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Compulsory ship inspections. 80.59 Section 80... STATIONS IN THE MARITIME SERVICES Applications and Licenses § 80.59 Compulsory ship inspections. (a) Inspection of ships subject to the Communications Act or the Safety Convention. (1) The FCC will not normally...
MASTER OF THE SHIP, MANAGER AND INSTRUCTOR
Florin IORDANOAIA
2010-01-01
The master of the ship is the person on the board who has the qualification and the necessary certificate of competency for running a maritime transport ship. He is the one who takes the ship into administration from the ship-owner, he is the only leader, the legal and direct chief of the entire crew, being invested with authority upon all the members of the crew. The master fulfils the attributes and displays his activity according to the legal laws of his flag, of the marine regulations and...
Čulin, Jelena; Bielić, Toni
2016-01-01
The environmental impact of shipping on marine environment includes discharge of garbage. Plastic litter is of particular concern due to abundance, resistance to degradation and detrimental effect on marine biota. According to recently published studies, a further research is required to assess human health risk. Monitoring data indicate that despite banning plastic disposal at sea, shipping is still a source of plastic pollution. Some of the measures to combat the problem are discussed.
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable
International Nuclear Information System (INIS)
Wen, Shuli; Lan, Hai; Hong, Ying-Yi; Yu, David C.; Zhang, Lijun; Cheng, Peng
2016-01-01
Highlights: • An uncertainty model of PV generation on board is developed based on the experiments. • The moving and swinging of the ship are considered in the optimal ESS sizing problem. • Optimal sizing of ESS in a hybrid PV/diesel/ESS ship power system is gained by the interval optimization method. • Different cases were studied to show the significance of the proposed method considering the swinging effects on the cost. - Abstract: Owing to low efficiency of traditional ships and the serious environmental pollution that they cause, the use of solar energy and an energy storage system (ESS) in a ship’s power system is increasingly attracting attention. However, the swinging of a ship raises crucial challenges in designing an optimal system for a large oil tanker ship, which are associated with uncertainties in solar energy. In this study, a series of experiments are performed to investigate the characteristics of a photovoltaic (PV) system on a moving ship. Based on the experimental results, an interval uncertainty model of on-board PV generation is established, which considers the effect of the swinging of the ship. Due to the power balance equations, the outputs of the diesel generator and the ESS on a large oil tanker are also modeled using interval variables. An interval optimization method is developed to determine the optimal size of the ESS in this hybrid ship power system to reduce the fuel cost, capital cost of the ESS, and emissions of greenhouse gases. Variations of the ship load are analyzed using a new method, taking five operating conditions into account. Several cases are compared in detail to demonstrate the effectiveness of the proposed algorithm.
Arctic shipping emissions inventories and future scenarios
Directory of Open Access Journals (Sweden)
J. J. Corbett
2010-10-01
Full Text Available This paper presents 5 km×5 km Arctic emissions inventories of important greenhouse gases, black carbon and other pollutants under existing and future (2050 scenarios that account for growth of shipping in the region, potential diversion traffic through emerging routes, and possible emissions control measures. These high-resolution, geospatial emissions inventories for shipping can be used to evaluate Arctic climate sensitivity to black carbon (a short-lived climate forcing pollutant especially effective in accelerating the melting of ice and snow, aerosols, and gaseous emissions including carbon dioxide. We quantify ship emissions scenarios which are expected to increase as declining sea ice coverage due to climate change allows for increased shipping activity in the Arctic. A first-order calculation of global warming potential due to 2030 emissions in the high-growth scenario suggests that short-lived forcing of ~4.5 gigagrams of black carbon from Arctic shipping may increase global warming potential due to Arctic ships' CO2 emissions (~42 000 gigagrams by some 17% to 78%. The paper also presents maximum feasible reduction scenarios for black carbon in particular. These emissions reduction scenarios will enable scientists and policymakers to evaluate the efficacy and benefits of technological controls for black carbon, and other pollutants from ships.
Improving the competitiveness of green ship recycling
Jain, K.P.
2017-01-01
The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and
Achieving Energy Efficient Ship Operations Under Third Party Management
DEFF Research Database (Denmark)
Taudal Poulsen, René; Sornn-Friese, Henrik
2015-01-01
Profitable energy saving measures are often not fully implemented in shipping, causing energy efficiency gaps. The paper identifies energy efficiency gaps in ship operations, and explores their causes. Lack of information on energy efficiency, lack of energy training at sea and onshore and lack...... of time to produce and provide reliable energy efficiency information cause energy efficiency gaps. The paper brings together the energy efficiency and ship management literatures, demonstrating how ship management models influence energy efficiency in ship operations. Achieving energy efficiency in ship...
Analysis of Ship Groundings on Soft Sea Beds
DEFF Research Database (Denmark)
Simonsen, Bo Cerup; Pedersen, Preben Terndrup
1997-01-01
it influences the ship heave and pitch motions as well as the friction between the ship and the soil.In this paper a rational calculation model is presented for the sea bed soil reaction forces on the ship bottom. The model is based on the assumption that the penetration of the ship bow generates a flow of pore......The consequences associated with ships running aground depend very much on the soil characteristics of the sea bed and the geometrical shape of the ship bow. The penetration into the sea bed depends on these factors and the penetration is an important factor for the ship motion because...... by the theory of frictional soils in rupture. Frictional stresses on the bow surface are assumed to be related to the normal pressure by a simple Coulumb relation. The total soil reaction as a function of velocity and penetration is found by integration of normal pressure and frictional stresses over...
Optimization of ship inner shell to improve the safety of seagoing transport ship
Directory of Open Access Journals (Sweden)
Yan-Yun YU
2013-09-01
Full Text Available A practical Ship Inner Shell Optimization Method (SISOM, the purpose of which is to improve the safety of the seagoing transport ship by decreasing the maximum Still Water Bending Moment (SWBM of the hull girder under all typical loading conditions, is presented in this paper. The objective of SISOM is to make the maximum SWBM minimum, and the section areas of the inner shell are taken as optimization variables. The main requirements of the ship performances, such as cargo hold capacity, propeller and rudder immersion, bridge visibility, damage stability and prevention of pollution etc., are taken as constraints. The penalty function method is used in SISOM to change the above nonlinear constraint problem into an unconstrained one, which is then solved by applying the steepest descent method. After optimization, the optimal section area distribution of the inner shell is obtained, and the shape of inner shell is adjusted according to the optimal section area. SISOM is applied to a product oil tanker and a bulk carrier, and the maximum SWBM of the two ships is significantly decreased by changing the shape of inner shell plate slightly. The two examples prove that SISOM is highly efficient and valuable to engineering practice.
Claremar, Björn; Haglund, Karin; Rutgersson, Anna
2017-10-01
The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km × 50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for the marine environment are largely unknown
Directory of Open Access Journals (Sweden)
B. Claremar
2017-10-01
Full Text Available The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km × 50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for
An Adaptive Ship Detection Scheme for Spaceborne SAR Imagery
Directory of Open Access Journals (Sweden)
Xiangguang Leng
2016-08-01
Full Text Available With the rapid development of spaceborne synthetic aperture radar (SAR and the increasing need of ship detection, research on adaptive ship detection in spaceborne SAR imagery is of great importance. Focusing on practical problems of ship detection, this paper presents a highly adaptive ship detection scheme for spaceborne SAR imagery. It is able to process a wide range of sensors, imaging modes and resolutions. Two main stages are identified in this paper, namely: ship candidate detection and ship discrimination. Firstly, this paper proposes an adaptive land masking method using ship size and pixel size. Secondly, taking into account the imaging mode, incidence angle, and polarization channel of SAR imagery, it implements adaptive ship candidate detection in spaceborne SAR imagery by applying different strategies to different resolution SAR images. Finally, aiming at different types of typical false alarms, this paper proposes a comprehensive ship discrimination method in spaceborne SAR imagery based on confidence level and complexity analysis. Experimental results based on RADARSAT-1, RADARSAT-2, TerraSAR-X, RS-1, and RS-3 images demonstrate that the adaptive scheme proposed in this paper is able to detect ship targets in a fast, efficient and robust way.
On the collision protection of ships
International Nuclear Information System (INIS)
Jones, N.
1976-01-01
A brief survey of the literature extant on the collision protection of ships is presented herein. An examination of the characteristics of different energy-absorbing methods suggests that honeycomb structures provide an alternative to deck structures which are currently used to achieve the collision protection of ships. Various features of honeycomb panels are explored and a particular structural arrangement which utilizes both sides of a hull and incorporates honeycomb panels is proposed for the collision protection of a ship. (Auth.)
Observations and computations of narrow Kelvin ship wakes
Francis Noblesse; Chenliang Zhang; Jiayi He; Yi Zhu; Chenjun Yang; Wei Li
2016-01-01
Computations of far-field ship waves, based on linear potential flow theory and the Hogner approximation, are reported for monohull ships and catamarans. Specifically, far-field ship waves are computed for six monohull ships at four Froude numbers F≡V/gL=0.58, 0.68, 0.86, 1.58 and for six catamarans with nondimensional hull spacing s≡S/L=0.25 at two Froude numbers Fs≡V/gS=1 and 2.5. Here, g is the gravitational acceleration, V and L denote the ship speed and length, and S is the separation di...
Directory of Open Access Journals (Sweden)
TengFei Wang
2017-03-01
Full Text Available A multi-ship collision avoidance decision-making and path planning formulation is studied in a distributed way. This paper proposes a complete set of solutions for multi-ship collision avoidance in intelligent navigation, by using a top-to-bottom organization to structure the system. The system is designed with two layers: the collision avoidance decision-making and the path planning. Under the general requirements of the International Regulations for Preventing Collisions at Sea (COLREGs, the performance of distributed path planning decision-making for anti-collision is analyzed for both give-way and stand-on ships situations, including the emergency actions taken by the stand-on ship in case of the give-way ship’s fault of collision avoidance measures. The Artificial Potential Field method(APF is used for the path planning in details. The developed APF method combined with the model of ship domain takes the target ships’ speed and course in-to account, so that it can judge the moving characteristics of obstacles more accurately. Simulation results indicate that the system proposed can work effectiveness.
Nuclear ship accidents, description and analysis
International Nuclear Information System (INIS)
Oelgaard, P.L.
1993-03-01
In this report available information on 44 reported nuclear ship events is considered. Of these 6 deals with U.S. ships and 38 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/ explosions, sea-water leaks into the submarines and sinking of vessels are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that some of the information of which this report is based, may be of dubious nature. Consequently some of the results of the assessments made may not be correct. (au)
International Nuclear Information System (INIS)
1973-01-01
The NOAA Fleet Operations Report 1973 was developed to provide a summary of project accomplishments during calendar year 1973. The report was prepared from season, cruise and special reports submitted by ships of the fleet. Centralized management of the NOAA Fleet was finalized by changing the operational control of the National Marine Fisheries Service (NMFS) Ships DAVID STARR JORDAN (FRS 44), TOWNSEND CROMWELL (FRS 43) and MURRE II (FRV 63) from NMFS to the National Ocean Survey on July 1, 1973. Throughout the year, ships routinely collected and transmitted weather data. Similarly, as NOAA participants in the Integrated Global Ocean Station System (IGOSS) service program, XBT observations were taken and either radioed or submitted in log form via mail. In addition, particulate and radionuclide samples were taken in cooperation with the Atomic Energy Commission, sediment samples were obtained for the Smithsonian Institution and observations were made of marine mammals
Feasibility Study on Nuclear Propulsion Ship according to Economic Evaluation
Energy Technology Data Exchange (ETDEWEB)
Gil, Youngmi; Yoo, Seongjin; Oh, June; Byun, Yoonchul; Woo, Ilguk [Daewoo Shipbuilding and Marine Engineering Co., Ltd, Seoul (Korea, Republic of); Kim, Jiho; Choi, Suhn [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)
2013-05-15
The use of nuclear ships has been extending to the icebreaker, the deep-water exploration ship, and the floating nuclear power plant. Prior to developing the new ship, the relevant regulations need to be considered. In this study, we reviewed the nuclear ship-related regulations. In addition, economic value is one of the most important factors which should be considered in the pre-design phase. To evaluate the economics of the nuclear ship, we calculated Capital Expenditure (abbreviated as CAPEX) and Operation Expenditure (abbreviated as OPEX) for various types of ships. We reviewed the nuclear ship-related regulations and evaluated the economics of the nuclear ship compared to the diesel ship. The calculation result shows that economic feasibility of the nuclear ship depends on the oil price as well as the cost of the nuclear reactor.
Designing Indonesian Liner Shipping Network
Directory of Open Access Journals (Sweden)
Armand Omar Moeis
2017-06-01
Full Text Available As the largest archipelago nation in the world, Indonesia’s logistics system has not shown excellence according to the parameters of logistics performance index and based on logistics costs percentages from overall GDP. This is due to the imbalances of trading on the western and eastern regions in Indonesia, which impacts the transportation systems costs to and from the eastern regions. Therefore, it is imperative to improve the competitiveness of Indonesian maritime logistics through maritime logistics network design. This research will focus on three levels of decision making in logistics network design, which include type of ships in the strategic level, shipping routes in the tactical level, and container allocation in the operational level with implementing butterfly routes in Indonesia’s logistics networking problems. Furthermore, this research will analyze the impact of Pendulum Nusantara and Sea Toll routes against the company profits and percentages of containers shipped. This research will also foresee how demand uncertainties and multi-period planning should affect decision making in designing the Indonesian Liner Shipping Network.
The Liner Shipping Fleet Repositioning Problem with Cargo Flows
DEFF Research Database (Denmark)
Tierney, Kevin; Jensen, Rune Møller
2012-01-01
We solve an important problem for the liner shipping industry called the Liner Shipping Fleet Repositioning Problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. Shippers wish...
Facts about Noroviruses on Cruise Ships
... Cruise Tips for Healthy Cruising Related Resources Cruise Ship Inspection Scores & Information Inspection Scores Cruise Line Directory Green ... 800-CDC-INFO ( 1-800-232-4636 ). Cruise Ship Inspection Scores & Information Inspection Scores Cruise Line Directory Green ...
Lack, D. A.; Corbett, J. J.
2012-05-01
The International Maritime Organization (IMO) has moved to address the health and climate impact of the emissions from the combustion of low-quality residual fuels within the commercial shipping industry. Fuel sulfur content (FS) limits and an efficiency design index for future ships are examples of such IMO actions. The impacts of black carbon (BC) emissions from shipping are now under review by the IMO, with a particular focus on the potential impacts of future Arctic shipping. Recognizing that associating impacts with BC emissions requires both ambient and onboard observations, we provide recommendations for the measurement of BC. We also evaluate current insights regarding the effect of ship speed (engine load), fuel quality and exhaust gas scrubbing on BC emissions from ships. Observations demonstrate that BC emission factors (EFBC) increases 3 to 6 times at very low engine loads (engine load, even with reduced load fuel savings. If fleets were required to operate at lower maximum engine loads, presumably associated with reduced speeds, then engines could be re-tuned, which would reduce BC emissions. Ships operating in the Arctic are likely running at highly variable engine loads (25-100%) depending on ice conditions and ice breaking requirements. The ships operating at low load may be emitting up to 50% more BC than they would at their rated load. Such variable load conditions make it difficult to assess the likely emissions rate of BC. Current fuel sulfur regulations have the effect of reducing EFBC by an average of 30% and potentially up to 80% regardless of engine load; a removal rate similar to that of scrubbers. Uncertainties among current observations demonstrate there is a need for more information on a) the impact of fuel quality on EFBC using robust measurement methods and b) the efficacy of scrubbers for the removal of particulate matter by size and composition.
Automatic production planning for the construction of complex ships
Rose, C.D.
2017-01-01
European shipyards specialize in building complex ship types including offshore vessels, yachts, dredgers, and cruise ships. One key difference between these ships and the simple cargo ships typically built in the Far East is the amount and variety of mission-related equipment required to operate
Liner Shipping Fleet Deployment with Sustainable Collaborative Transportation
Directory of Open Access Journals (Sweden)
Gang Du
2016-02-01
Full Text Available Facing sharp competition in the market for shipping companies, it is necessary to make reasonable and efficient decisions to optimize the container shipping line network so as to improve the shipping efficiency and reduce the transportation cost, as well as to realize the transportation sustainability. Therefore, the liner ship fleet deployment problem with collaborative transportation is proposed in this paper. This problem is formulated as a mixed-integer linear programming model that takes collaborative transportation into consideration. The model includes fixed cost, variable cost, berth cost, transport cost, penalty, compensation cost, and so on. To achieve the sustainable development of collaborative transportation, the shipping companies could make a selection between the internal routes and the external routes to serve each task by comparing the distance between the above routes. A real Asia-Europe-Oceania numerical experiment shows that the proposed sustainable collaborative transportation model can be efficiently solved by C++ calling ILOG CPLEX. Results demonstrate that the optimized shipping line network with sustainable collaborative transportation can improve the service efficiency, as well as the service level of shipping companies.
Leadership Profiling of Ocean Going Ship Masters1
Directory of Open Access Journals (Sweden)
Ioannis Theotokas
2014-12-01
This paper focuses on the ocean going ship Masters and aims at identifying their leadership profiles and understanding their attitudes and reactions in given circumstances. It analyses and discusses the results of a field study of ship officers of different nationalities employed as Masters on board ships of a leading international maritime group. Results of the research reveal that the characteristics and the competencies of ship Masters as identified using the specially developed questionnaire, are compatible with those proposed by situational leadership theories. Ship Masters seem to give priority to the people on board and their needs and try to be supportive in their decisions.
Distributed propulsion for ships
Nylund, Vilde
2017-01-01
It is anticipated that using distributed electric propulsion (DEP) on conventional ships will increase the total propulsive efficiency. This is mainly due to two reasons; firstly, because the total propeller disk area can be increased. Secondly, because each propeller can be optimised for the local wake where it is operating. In this work, the benefits of using DEP has been investigated for a 14 000 TEU container ship. Based on a literary study of the present state of propeller modelling ...
INFLUENCE OF OPERABILITY CRITERIA LIMITING VALUES ON SHIP SPEED
Directory of Open Access Journals (Sweden)
Jasna Prpić-Oršić
2016-09-01
Full Text Available When the ship is caught in heavy seas, there are two manoeuvres that the shipmaster can undertake to avoid excessive ship motion and hull damage: changing course or voluntary speed reduction. This paper presents a study of the effect of the various voluntary speed reduction criteria to attainable speed of ship on seaway. The speed loss is calculated by taking into account wind and wave effect on ship speed, the engine and propeller performance in actual seas as well as the mass inertia of the ship. The attainable ship speed for ship in head, following and beam waves by accounting for voluntary speed reduction is estimated for various significant wave height. The criteria of slamming, deck wetness, propeller emergence, excessive accelerations and roll are taken into account. The impact of variations of the limiting values of certain criteria due to which the captain intentionally reduces the ship speed is analysed and discussed.
Report of nuclear powered ship meeting
International Nuclear Information System (INIS)
Anon.
1983-01-01
The research and development of nuclear powered ships in Japan have been advanced centering around the Japan Nuclear Ship Development Agency established in 1963. It is regretful that the development of ''Mutsu'' is largely behind the schedule due to the radiation leak in 1974, and the expected objective has not yet been attained even today. The government decided to advance the research on the improvement of marine nuclear reactors in 1980, and this new research function was given to the Agency by changing its organization. However, recently various arguments have arisen concerning the way of the research and development of nuclear ships in Japan centering around ''Mutsu'', such as the necessity of developing nuclear ships, the enormous expenditure for the development, the aging of ''Mutsu'' more than 10 years after the construction, the introduction of nuclear ship technology from foreign countries and so on. By the end of fiscal 1984, the Agency is expected to merge with other organization related to atomic energy, therefore, it is necessary to decide the way of research and development. This meeting organized by the Atomic Energy Commission makes this report to show the way of thinking about the above arguments. (Kako, I.)
International Nuclear Information System (INIS)
2008-03-01
The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish
Development of software for handling ship's pharmacy.
Nittari, Giulio; Peretti, Alessandro; Sibilio, Fabio; Ioannidis, Nicholas; Amenta, Francesco
2016-01-01
Ships are required to carry a given amount of medicinal products and medications depending on the flag and the type of vessel. These medicines are stored in the so called ship's "medicine chest" or more properly - a ship pharmacy. Owing to the progress of medical sciences and to the increase in the mean age of seafarers employed on board ships, the number of pharmaceutical products and medical devices required by regulations to be carried on board ships is increasing. This may make handling of the ship's medicine chest a problem primarily on large ships sailing on intercontinental routes due to the difficulty in identifying the correspondence between medicines obtained abroad with those available at the national market. To minimise these problems a tool named Pharmacy Ship (acronym: PARSI) has been developed. The application PARSI is based on a database containing the information about medicines and medical devices required by different countries regulations. In the first application the system was standardised to comply with the Italian regulations issued on the 1st October, 2015 which entered into force on the 18 January 2016. Thanks to PARSI it was possible to standardize the inventory procedures, facilitate the work of maritime health authorities and make it easier for the crew, not professional in the field, to handle the 'medicine chest' correctly by automating the procedures for medicines management. As far as we know there are no other similar tools available at the moment. The application of the software, as well as the automation of different activities, currently carried out manually, will help manage (qualitatively and quantitatively) the ship's pharmacy. The system developed in this study has proved to be an effective tool which serves to guarantee the compliance of the ship pharmacy with regulations of the flag state in terms of medicinal products and medications. Sharing the system with the Telemedical Maritime Assistance Service may result in
A Ship Cargo Hold Inspection Approach Using Laser Vision Systems
SHEN Yang; ZHAO Ning; LIU Haiwei; MI Chao
2013-01-01
Our paper represents a vision system based on the laser measurement system (LMS) for bulk ship inspection. The LMS scanner with 2-axis servo system is installed on the ship loader to build the shape of the ship. Then, a group of real-time image processing algorithms are implemented to compute the shape of the cargo hold, the inclination angle of the ship and the relative position between the ship loader and the cargo hold. Based on those computed inspection data of the ship, the ship loader c...
Ultimate Strength of Ship Hulls under Torsion
DEFF Research Database (Denmark)
Paik, Jeom Kee; Thayamballi, Anil K.; Pedersen, Preben Terndrup
2001-01-01
For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength characte......For a ship hull with large deck openings such as container vessels and some large bulk carriers, the analysis of warping stresses and hatch opening deformations is an essential part of ship structural analyses. It is thus of importance to better understand the ultimate torsional strength...... characteristics of ships with large hatch openings. The primary aim of the present study is to investigate the ultimate strength characteristics of ship hulls with large hatch openings under torsion. Axial (warping) as well as shear stresses are normally developed for thin-walled beams with open cross sections...... subjected to torsion. A procedure for calculating these stresses is briefly described. As an illustrative example, the distribution and magnitude of warping and shear stresses for a typical container vessel hull cross section under unit torsion is calculated by the procedure. By theoretical and numerical...
46 CFR 71.75-5 - Passenger Ship Safety Certificate.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 71.75-5 Section 71.75-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS INSPECTION AND... Passenger Ship Safety Certificate. (a) All vessels on an international voyage are required to have a...
International Nuclear Information System (INIS)
Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.
1984-10-01
The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables
Civil Engineering for the SHiP facility
Osborne, John Andrew
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.
1981 state-by-state assessment of low-level radioactive wastes shipped to commercial disposal sites
International Nuclear Information System (INIS)
1982-12-01
This state-by-state report again uses the volume of low-level waste reported as received at each commercial disposal site as the nation baseline figure. A volume of 87,789 m 3 of radioactive waste containing 279,863 Ci of activity was reported disposed at the commercial sites in 1981. The distribution of these waste volumes by disposal site is presented in Table 1 and a summary of estimated volumes by generator categories is contained in Table 2. The total volume and curie values tabulated for each state were obtained directly from the commercial disposal site operators. Summary information on commercial nuclear power plant wastes was obtained from semiannual waste reports submitted to the NRC in accordance with the NRC Regulatory Guide 1.21. Data reported for the calendar year 1981 were used for this report where available. When report data were not available reactor information was obtained directly from the utility. The reported quantities of solid radioactive wastes generated by government installations shipped to commercial disposal sites are annually summarized in the SWIMS report. Records of radioactive wastes shippped to commercial disposal sites from the US Navy nuclear-powered ships and support facilities are maintained by the Nuclear Power Directorate, Naval Sea Systems Command, Department of the Navy, and are reported on an annual basis. Available information from other military departments such as the Army and the Air Force were included in this study. Wastes from these other military commands do not constitute a significant volume of radioactive source
Solvency and Liquidity in Shipping Companies
Directory of Open Access Journals (Sweden)
Heejung Yeo
2016-12-01
Full Text Available This study examines factors affecting the solvency of shipping firms. The paper uses a panel dataset and employs the GLM and FGLS regression analyses. This study explores the financial structure of top 130 shipping firms provided by the Factiva database during the period between 2009 and 2013. The paper finds that liquidity is closely related to the leverage of shipping companies. The negative association between the asset liquidity and the leverage level implies that there exist conflicts of interest between managers and investors. Shipping firms have a comfortable high liquidity position, but they have a high degree of leverage. They need to take steps to reduce debts. There is evidence of heterogeneity in the determinants of leverage level. The paper also finds that the variables such as profitability, FSIZE, FAGE influence differently the leverage level whether the debt is short-term or long-term.
46 CFR Sec. 5 - Measures to protect ship's payrolls.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Measures to protect ship's payrolls. Sec. 5 Section 5... SHIP'S PERSONNEL Sec. 5 Measures to protect ship's payrolls. (a) General Agents are not required to consider the amount of the payroll delivered to the Master at the conclusion of a voyage in determining the...
Model for Estimation of Fuel Consumption of Cruise Ships
Directory of Open Access Journals (Sweden)
Morten Simonsen
2018-04-01
Full Text Available This article presents a model to estimate the energy use and fuel consumption of cruise ships that sail Norwegian waters. Automatic identification system (AIS data and technical information about cruise ships provided input to the model, including service speed, total power, and number of engines. The model was tested against real-world data obtained from a small cruise vessel and both a medium and large cruise ship. It is sensitive to speed and the corresponding engine load profile of the ship. A crucial determinate for total fuel consumption is also associated with hotel functions, which can make a large contribution to the overall energy use of cruise ships. Real-world data fits the model best when ship speed is 70–75% of service speed. With decreased or increased speed, the model tends to diverge from real-world observations. The model gives a proxy for calculation of fuel consumption associated with cruise ships that sail to Norwegian waters and can be used to estimate greenhouse gas emissions and to evaluate energy reduction strategies for cruise ships.
An approach to high speed ship ride quality simulation
Malone, W. L.; Vickery, J. M.
1975-01-01
The high speeds attained by certain advanced surface ships result in a spectrum of motion which is higher in frequency than that of conventional ships. This fact along with the inclusion of advanced ride control features in the design of these ships resulted in an increased awareness of the need for ride criteria. Such criteria can be developed using data from actual ship operations in varied sea states or from clinical laboratory experiments. A third approach is to simulate ship conditions using measured or calculated ship motion data. Recent simulations have used data derived from a math model of Surface Effect Ship (SES) motion. The model in turn is based on equations of motion which have been refined with data from scale models and SES of up to 101 600-kg (100-ton) displacement. Employment of broad band motion emphasizes the use of the simulators as a design tool to evaluate a given ship configuration in several operational situations and also serves to provide data as to the overall effect of a given motion on crew performance and physiological status.
Game Strategies of Ship in the Collision Situations
Directory of Open Access Journals (Sweden)
Jozef Lisowski
2014-03-01
Full Text Available The paper introduced the basic model of process of safe ship control in a collision situation using a game model with j objects, which includes non-linear state equations and non-linear, time varying constraints of the state variables as well as the quality game control index in the forms of the game integral payment and the final payment. Approximated model of the process control as the model of multi-step matrix game in the form of dual linear programming problem has been adopted here. The Game Ship Control GSC computer program has been designed in the Matlab/Simulink software in order to determine the own ship's safe trajectory. These considerations have been illustrated with examples of a computer simulation using an GSC program for determining the safe ship's trajectory in real navigational situation. Simulation research were passed for five sets of strategies of the own ship and met ships.
Some considerations on the safety of nuclear ships
International Nuclear Information System (INIS)
Kuramoto, Masaaki
1978-01-01
For realizing the practical utilization of nuclear merchant ships, it is essential to gain their acceptance by maritime countries on an equal footing with conventional vessels, and to have the administrative procedures for their admission simplified. This, however cannot be expected to be attained overnight, and progressive measures will have to be adopted, to approach the ultimate goal step by step. The first step should be to demonstrate the safety of nuclear propulsion, for which nuclear ships must accumulate their mileages of safe service. The second important step is to simplify the procedures demanded of nuclear ships for access to ports, through the establishment of international safety standards and design criteria, the enforcement of safety measures covering the entrance of nuclear ships into ports, and the assurance of safety in he repair, inspection and refuelling operations of these ships. Among these measures, the considerations relevant to port entry are the subject of vital interest to both ship operators and port authorities
Accidents on ships in the Danish International Ship register
DEFF Research Database (Denmark)
Ádám, Balázs; Rasmussen, Hanna Barbara
to report accidents causing at least one day off work beyond the day of accident but the first source contains several accidents not fulfilling this criterion, too. Radio Medical is an independent service where all Danish ships may seek medical advice. The data sets were merged by identification number...... of our study is to describe trend of accidents and their contributing factors, with special focus on nationality, occurring in ships under Danish flag in the period 2010-2012. The study used two independent data sources, the Danish Maritime Authority and the Danish Radio Medical. It is mandatory...... to create a single database that has been studied by descriptive statistics and regression analysis. Findings show a stabilised number of accidents in the analysed period. The occurrence of accidents is influenced by nationality. There is a higher frequency of reported injuries found among Danish and other...
46 CFR 169.817 - Master to instruct ship's company.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Master to instruct ship's company. 169.817 Section 169.817 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS SAILING SCHOOL VESSELS Operations § 169.817 Master to instruct ship's company. The master shall conduct drills and give instructions as necessary to insure that al...
32 CFR 700.872 - Ships and craft in drydock.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Ships and craft in drydock. 700.872 Section 700... Special Circumstances/ships in Naval Stations and Shipyards § 700.872 Ships and craft in drydock. (a) The... ship or craft, not in commission, is in a naval drydock, the provisions of this article shall apply...
Infrared ship signature analysis and optimisation
Neele, F.P.
2005-01-01
The last decade has seen an increase in the awareness of the infrared signature of naval ships. New ship designs show that infrared signature reduction measures are being incorporated, such as exhaust gas cooling systems, relocation of the exhausts and surface cooling systems. Hull and
Merchant shipping (Safety Convention) Act 1977
International Nuclear Information System (INIS)
1977-01-01
When this Act comes into force, it will enable the United Kingdom to ratify and to give effect to the 1974 International Convention for the Safety of Life at Sea (the SOLAS Convention) which replaces the SOLAS Convention of 1960. Under the Act, the Secretary of State may make such rules as he considers appropriate regarding ships provided with nuclear power plants in accordance with Chapter VIII of the Annex to the 1974 Convention and to Recommendations attached to it, dealing with nuclear ships, and insofar as those provisions have not been implemented by the Merchant Shipping Acts 1894 to 1974. (NEA) [fr
Merk, Olaf
2014-01-01
Shipping emissions in ports are substantial, accounting for 18 million tonnes of CO2 emissions, 0.4 million tonnes of NOx, 0.2 million of SOx and 0.03 million tonnes of PM10 in 2011. Around 85% of emissions come from containerships and tankers. Containerships have short port stays, but high emissions during these stays. Most of CO2 emissions in ports from shipping are in Asia and Europe (58%), but this share is low compared to their share of port calls (70%). European ports have much less emi...
46 CFR 115.910 - Passenger Ship Safety Certificate.
2010-10-01
...) The route specified on the Certificate of Inspection and the SOLAS Passenger Ship Safety Certificate... 46 Shipping 4 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 115.910 Section 115... MORE THAN 150 PASSENGERS OR WITH OVERNIGHT ACCOMMODATIONS FOR MORE THAN 49 PASSENGERS INSPECTION AND...
Ships going slow in reducing their NOx emissions
Boersma, K.F.; Vinken, G.C.M.; Tournadre, J.
2015-01-01
Weaddress the lack of temporal information on ship emissions, and report on rapid short-term variations of satellite-derived shipNOx emissions between 2005 and 2012 over European seas. Our inversion is based onOMI observed troposphericNO2 columns and GEOS-Chem simulations. Average European shipNOx
S-CNN-BASED SHIP DETECTION FROM HIGH-RESOLUTION REMOTE SENSING IMAGES
Directory of Open Access Journals (Sweden)
R. Zhang
2016-06-01
Full Text Available Reliable ship detection plays an important role in both military and civil fields. However, it makes the task difficult with high-resolution remote sensing images with complex background and various types of ships with different poses, shapes and scales. Related works mostly used gray and shape features to detect ships, which obtain results with poor robustness and efficiency. To detect ships more automatically and robustly, we propose a novel ship detection method based on the convolutional neural networks (CNNs, called SCNN, fed with specifically designed proposals extracted from the ship model combined with an improved saliency detection method. Firstly we creatively propose two ship models, the “V” ship head model and the “||” ship body one, to localize the ship proposals from the line segments extracted from a test image. Next, for offshore ships with relatively small sizes, which cannot be efficiently picked out by the ship models due to the lack of reliable line segments, we propose an improved saliency detection method to find these proposals. Therefore, these two kinds of ship proposals are fed to the trained CNN for robust and efficient detection. Experimental results on a large amount of representative remote sensing images with different kinds of ships with varied poses, shapes and scales demonstrate the efficiency and robustness of our proposed S-CNN-Based ship detector.
Ship-Track Models Based on Poisson-Distributed Port-Departure Times
National Research Council Canada - National Science Library
Heitmeyer, Richard
2006-01-01
... of those ships, and their nominal speeds. The probability law assumes that the ship departure times are Poisson-distributed with a time-varying departure rate and that the ship speeds and ship routes are statistically independent...
46 CFR 176.910 - Passenger Ship Safety Certificate.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Passenger Ship Safety Certificate. 176.910 Section 176... 100 GROSS TONS) INSPECTION AND CERTIFICATION International Convention for Safety of Life at Sea, 1974, as Amended (SOLAS) § 176.910 Passenger Ship Safety Certificate. (a) A vessel, which carries more than...
46 CFR 35.01-10 - Shipping papers-TB/ALL.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Shipping papers-TB/ALL. 35.01-10 Section 35.01-10... Requirements § 35.01-10 Shipping papers—TB/ALL. Each loaded tank vessel shall have on board a bill of lading... agent of the owner: Provided, however, That in the case of unmanned barges where shipping papers are not...
Near Real Time Ship Detection Experiments
Brusch, S.; Lehner, S.; Schwarz, E.; Fritz, T.
2010-04-01
A new Near Real Time (NRT) ship detection processor SAINT (SAR AIS Integrated Toolbox) was developed in the framework of the ESA project MARISS. Data are received at DLRs ground segment DLR-BN (Neustrelitz, Germany). Results of the ship detection are available on ftp server within 30 min after the acquisition started. The detectability of ships on Synthetic Aperture Radar (SAR) ERS-2, ENVISAT ASAR and TerraSAR-X (TS-X) images is validated by coastal (live) AIS and space AIS. The monitoring areas chosen for surveillance are the North-, Baltic Sea, and Cape Town. The detectability in respect to environmental parameters like wind field, sea state, currents and changing coastlines due to tidal effects is investigated. In the South Atlantic a tracking experiment of the German research vessel Polarstern has been performed. Issues of piracy in particular in respect to ships hijacked at the Somali coast are discussed. Some examples using high resolution images from TerraSAR-X are given.
Observations and computations of narrow Kelvin ship wakes
Directory of Open Access Journals (Sweden)
Francis Noblesse
2016-01-01
Full Text Available Computations of far-field ship waves, based on linear potential flow theory and the Hogner approximation, are reported for monohull ships and catamarans. Specifically, far-field ship waves are computed for six monohull ships at four Froude numbers F≡V/gL=0.58, 0.68, 0.86, 1.58 and for six catamarans with nondimensional hull spacing s≡S/L=0.25 at two Froude numbers Fs≡V/gS=1 and 2.5. Here, g is the gravitational acceleration, V and L denote the ship speed and length, and S is the separation distance between the twin hulls of a catamaran. The computations show that, although the amplitudes of the waves created by a ship are strongly influenced by the shape of the ship hull, as well known, the ray angles where the largest waves are found are only weakly influenced by the hull shape and indeed are mostly a kinematic feature of the flow around a ship hull. An important practical consequence of this flow feature is that the apparent wake angle of general monohull ships or catamarans (with arbitrarily-shaped hulls can be estimated, without computations, by means of simple analytical relations; these relations, obtained elsewhere via parametric computations, are given here. Moreover, the influence of the two parameters Fs and s that largely determine the ray angles of the dominant waves created by a catamaran is illustrated via computations for three catamarans with hull spacings s=0.2, 0.35, 0.5 at four Froude numbers Fs=1, 1.5, 2, 2.5. These computations confirm that the largest waves created by wide and/or fast catamarans are found at ray angles that only depend on Fs (i.e. that do not depend on the hull spacing s in agreement with an elementary analysis of lateral interference between the dominant waves created by the bows (or sterns of the twin hulls of a catamaran. The dominant-waves ray angles predicted by the theory of wave-interference effects for monohull ships and catamarans are also compared with the observations of narrow Kelvin ship
The activity-based methodology to assess ship emissions - A review
International Nuclear Information System (INIS)
Nunes, R.A.O.; Alvim-Ferraz, M.C.M.; Martins, F.G.; Sousa, S.I.V.
2017-01-01
Several studies tried to estimate atmospheric emissions with origin in the maritime sector, concluding that it contributed to the global anthropogenic emissions through the emission of pollutants that have a strong impact on hu' health and also on climate change. Thus, this paper aimed to review published studies since 2010 that used activity-based methodology to estimate ship emissions, to provide a summary of the available input data. After exclusions, 26 articles were analysed and the main information were scanned and registered, namely technical information about ships, ships activity and movement information, engines, fuels, load and emission factors. The larger part of studies calculating in-port ship emissions concluded that the majority was emitted during hotelling and most of the authors allocating emissions by ship type concluded that containerships were the main pollutant emitters. To obtain technical information about ships the combined use of data from Lloyd's Register of Shipping database with other sources such as port authority's databases, engine manufactures and ship-owners seemed the best approach. The use of AIS data has been growing in recent years and seems to be the best method to report activities and movements of ships. To predict ship powers the Hollenbach (1998) method which estimates propelling power as a function of instantaneous speed based on total resistance and use of load balancing schemes for multi-engine installations seemed to be the best practices for more accurate ship emission estimations. For emission factors improvement, new on-board measurement campaigns or studies should be undertaken. Regardless of the effort that has been performed in the last years to obtain more accurate shipping emission inventories, more precise input data (technical information about ships, engines, load and emission factors) should be obtained to improve the methodology to develop global and universally accepted emission inventories
Crushing of ship bows in head-on collision
DEFF Research Database (Denmark)
Ocakli, H.; Zhang, S.; Pedersen, Preben Terndrup
2004-01-01
Semi-analytical methods for analysis of plate crushing and ship bow damage in head-on collisions are developed in this paper. Existing experimental and theoretical studies for crushing analysis of plated structures are summarized and compared. Simple formulae for determining the crushing force....... The approach developed can be used easily to determine the crushing resistance and damage extent of the ship bow when ship length and collision speed are known. The method can be used in probabilistic analysis of damage extents in ship collisions where a large number of calculations are generally required....
Ship Design and Construction. An Integrated University Course
DEFF Research Database (Denmark)
Andersen, Poul; Jensen, Jørgen Juncher
1996-01-01
This paper describes an integrated course in design and construction of merchant ships taught at the Department of Naval Architecture andOffshore Engineering, the Technical University of Denmark. During the course, the students make a preliminary design of a ship of selected type and also design...... its engine room. The teaching combines lectures with laboratory work at the drawing tables and computer terminals. During the summer holiday, sea time on board ships of the relevant types are offered. Experienced naval architects from shipyards and ship consultancies give lectures and instructions...
Logistical Analysis of the Littoral Combat Ship
National Research Council Canada - National Science Library
Rudko, David
2003-01-01
The purpose of the Littoral Combat Ship (LCS) is to provide the Navy with an affordable, small, multi-mission ship capable of independent, interdependent, and integrated operations inside the littorals...
International Nuclear Information System (INIS)
Quinn, G.J.; Burton, H.M.
1985-01-01
TMI-2 failed fuel will be shipped to the Idaho National Engineering Laboratory for use in the DOE Core Examination Program. The fuel debris will be loaded into three types of canisters during defueling and dry loaded into a spent fuel shipping cask. The cask design accommodates seven canisters per cask and has two separate containment vessels with ''leaktight'' seals. Shipments are expectd to begin in early 1986
Van Bruinessen, T.M.; Smulders, F.E.H.M.; Hopman, J.J.
2013-01-01
The research this paper reports on aims to develop a design and engineering strategy for complex ships in between incremental and radical innovation. The majority of European ship-design industry concentrates on the development of complex, one-off ‘specials’ for the offshore industry, like dredgers,
New Zealand code for nuclear powered shipping
International Nuclear Information System (INIS)
1976-06-01
This report recommends guidelines for the safety precautions and procedures to be implemented when New Zealand ports and approaches are used by nuclear powered merchant ships and nuclear powered naval ships
Diatom community structure on in-service cruise ship hulls.
Hunsucker, Kelli Zargiel; Koka, Abhishek; Lund, Geir; Swain, Geoffrey
2014-10-01
Diatoms are an important component of marine biofilms found on ship hulls. However, there are only a few published studies that describe the presence and abundance of diatoms on ships, and none that relate to modern ship hull coatings. This study investigated the diatom community structure on two in-service cruise ships with the same cruise cycles, one coated with an antifouling (AF) system (copper self-polishing copolymer) and the other coated with a silicone fouling-release (FR) system. Biofilm samples were collected during dry docking from representative areas of the ship and these provided information on the horizontal and vertical zonation of the hull, and intact and damaged coating and niche areas. Diatoms from the genera Achnanthes, Amphora and Navicula were the most common, regardless of horizontal ship zonation and coating type. Other genera were abundant, but their presence was more dependent on the ship zonation and coating type. Samples collected from damaged areas of the hull coating had a similar community composition to undamaged areas, but with higher diatom abundance. Diatom fouling on the niche areas differed from that of the surrounding ship hull and paralleled previous studies that investigated differences in diatom community structure on static and dynamically exposed coatings; niche areas were similar to static immersion and the hull to dynamic immersion. Additionally, diatom richness was greater on the ship with the FR coating, including the identification of several new genera to the biofouling literature, viz. Lampriscus and Thalassiophysa. These results are the first to describe diatom community composition on in-service ship hulls coated with a FR system. This class of coatings appears to have a larger diatom community compared to copper-based AF systems, with new diatom genera that have the ability to stick to ship hulls and withstand hydrodynamic forces, thus creating the potential for new problematic species in the biofilm.
Quantitative analysis method for ship construction quality
Directory of Open Access Journals (Sweden)
FU Senzong
2017-03-01
Full Text Available The excellent performance of a ship is assured by the accurate evaluation of its construction quality. For a long time, research into the construction quality of ships has mainly focused on qualitative analysis due to a shortage of process data, which results from limited samples, varied process types and non-standardized processes. Aiming at predicting and controlling the influence of the construction process on the construction quality of ships, this article proposes a reliability quantitative analysis flow path for the ship construction process and fuzzy calculation method. Based on the process-quality factor model proposed by the Function-Oriented Quality Control (FOQC method, we combine fuzzy mathematics with the expert grading method to deduce formulations calculating the fuzzy process reliability of the ordinal connection model, series connection model and mixed connection model. The quantitative analysis method is applied in analyzing the process reliability of a ship's shaft gear box installation, which proves the applicability and effectiveness of the method. The analysis results can be a useful reference for setting key quality inspection points and optimizing key processes.
Orchestrating Transnational Environmental Governance in Maritime Shipping
DEFF Research Database (Denmark)
Lister, Jane; Taudal Poulsen, René; Ponte, Stefano
2015-01-01
Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body—the Interna......Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body......—the International Maritime Organization. Drawing on original empirical evidence and archival data, we introduce a four-factor framework to investigate two main questions: why is shipping lagging in its environmental governance; and what is the potential for the International Maritime Organization to orchestrate......, and growing regulatory fragmentation and uncertainty. The paper concludes with pragmatic recommendations for the International Maritime Organization to acknowledge the regulatory difficulties and seize the opportunity to orchestrate environmental progress....
The world's first supply ship powered by natural gas
International Nuclear Information System (INIS)
2003-01-01
The article describes the newly developed natural gas powered supply ship ''Viking Energy'', which reduces the emission of NOx by 200 tonnes per year. The shipping company has for many years been working on the developing of environmentally friendly ships with less fuel consumption. The gas is stored in liquid form at a temperature of 160 o C. The engines can run on gas or diesel as needed. These dual-fuel engines offers great flexibility, which is very desirable since liquid natural gas is not widely available along the coast. This type of engine has been used in power stations and on offshore platforms, but not in ships. The operating conditions are quite different for ships than for power stations. So far, both investment and operating costs are higher than for conventional ships
Mathematical Ship Modeling for Control Applications
DEFF Research Database (Denmark)
Perez, Tristan; Blanke, Mogens
2002-01-01
In this report, we review the models for describing the motion of a ship in four degrees of freedom suitable for control applications. We present the hydrodynamic models of two ships: a container and a multi-role naval vessel. The models are based on experimental results in the four degrees...
International Nuclear Information System (INIS)
1981-01-01
This annual report of the GKSS-Research Centre Geesthacht GmbH contains a survey of the research- and development work done in the year of the report and a survey on the organisation and situation of the society. The R and D programme can be divided in two parts: utilization of nuclear energy; utilization of the sea and the coasts. The first part concerns tasks on the sector of reactor safety compiled to a project which is fully integrated into the programme Reactor Safety of the Federal Ministy for Research and Technology. Development of nuclear-energy propelled vessels is continued to a smaller extent than before. The NS OTTO HAHN stopped operations in 1979. In 1980 a waste-disposed concept for the nuclear waste was developed, on the basis of which the GKSS received permission to put the ship out of service. (orig./RW) [de
Advanced Whale Detection Methods to Improve Whale-Ship Collision Avoidance
McGillivary, P. A.; Tougher, B.
2010-12-01
Collisions between whales and ships are now estimated to account for fully a third of all whale deaths worldwide. Such collisions can incur costly ship repairs, and may damage or disable ship steering requiring costly response efforts from state and federal agencies. While collisions with rare whale species are problematic in further reducing their low population numbers, collisions with some of the more abundant whale species are also becoming more common as their populations increase. The problem is compounded as ship traffic likewise continues to grow, thus posing a growing risk to both whales and ships. Federal agencies are considering policies to alter shipping lanes to minimize whale-ship collisions off California and elsewhere. Similar efforts have already been undertaken for the Boston Harbor ship approach, where a bend in the shipping lane was introduced to reduce ship traffic through a favorite area of the highly endangered North Atlantic Right Whale. The Boston shipping approach lane was also flanked with a system of moorings with whale detection hydrophones which broadcast the presence of calling whales in or near the ship channel to approaching ships in real time. When so notified, ships can post lookouts to avoid whale collisions, and reduce speed to reduce the likelihood of whale death, which is highly speed dependent. To reduce the likelihood and seriousness of whale-ship collisions off California and Alaska in particular, there is a need to better know areas of particularly high use by whales, and consider implementation of reduced ship speeds in these areas. There is also an ongoing discussion of altering shipping lanes in the Santa Barbara Channel to avoid habitual Blue whales aggregation areas in particular. However, unlike the case for Boston Harbor, notification of ships that whales are nearby to reduce or avoid collisions is complicated because many California and Alaska whale species do not call regularly, and would thus be undetected by
Reliability Based Ship Structural Design
DEFF Research Database (Denmark)
Dogliani, M.; Østergaard, C.; Parmentier, G.
1996-01-01
This paper deals with the development of different methods that allow the reliability-based design of ship structures to be transferred from the area of research to the systematic application in current design. It summarises the achievements of a three-year collaborative research project dealing...... with developments of models of load effects and of structural collapse adopted in reliability formulations which aim at calibrating partial safety factors for ship structural design. New probabilistic models of still-water load effects are developed both for tankers and for containerships. New results are presented...... structure of several tankers and containerships. The results of the reliability analysis were the basis for the definition of a target safety level which was used to asses the partial safety factors suitable for in a new design rules format to be adopted in modern ship structural design. Finally...
47 CFR 80.1099 - Ship sources of energy.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship sources of energy. 80.1099 Section 80.1099... Stations § 80.1099 Ship sources of energy. (a) There must be available at all times, while the ship is at... batteries used as part of a reserve source of energy for the radio installations. (b) A reserve source of...
Analysis of ship maneuvering data from simulators
Frette, V.; Kleppe, G.; Christensen, K.
2011-03-01
We analyze complex manuevering histories of ships obtained from training sessions on bridge simulators. Advanced ships are used in fields like offshore oil exploration: dive support vessels, supply vessels, anchor handling vessels, tugs, cable layers, and multi-purpose vessels. Due to high demands from the operations carried out, these ships need to have very high maneuverability. This is achieved through a propulsion system with several thrusters, water jets, and rudders in addition to standard propellers. For some operations, like subsea maintenance, it is crucial that the ship accurately keeps a fixed position. Therefore, bridge systems usually incorporate equipment for Dynamic Positioning (DP). DP is a method to keep ships and semi submersible rigs in a fixed position using the propulsion systems instead of anchors. It may also be used for sailing a vessel from one position to another along a predefined route. Like an autopilot on an airplane, DP may operate without human involvement. The method relies on accurate determination of position from external reference systems like GPS, as well as a continuously adjusted mathematical model of the ship and external forces from wind, waves and currents. In a specific simulator exercise for offshore crews, a ship is to be taken up to an installation consisting of three nearby oil platforms connected by bridges (Frigg field, North Sea), where a subsea inspection is to be carried out. Due to the many degrees of freedom during maneuvering, including partly or full use of DP, the chosen routes vary significantly. In this poster we report preliminary results on representations of the complex maneuvering histories; representations that allow comparison between crew groups, and, possibly, sorting of the different strategic choices behind.
Solving the Liner Shipping Fleet Repositioning Problem with Cargo Flows
DEFF Research Database (Denmark)
Tierney, Kevin; Askelsdottir, Björg; Jensen, Rune Møller
2015-01-01
We solve a central problem in the liner shipping industry called the liner shipping fleet repositioning problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between routes in a liner shipping network. Liner carriers wish...
Transport impacts on atmosphere and climate: Shipping
Eyring, Veronika; Isaksen, Ivar S. A.; Berntsen, Terje; Collins, William J.; Corbett, James J.; Endresen, Oyvind; Grainger, Roy G.; Moldanova, Jana; Schlager, Hans; Stevenson, David S.
2010-12-01
Emissions of exhaust gases and particles from oceangoing ships are a significant and growing contributor to the total emissions from the transportation sector. We present an assessment of the contribution of gaseous and particulate emissions from oceangoing shipping to anthropogenic emissions and air quality. We also assess the degradation in human health and climate change created by these emissions. Regulating ship emissions requires comprehensive knowledge of current fuel consumption and emissions, understanding of their impact on atmospheric composition and climate, and projections of potential future evolutions and mitigation options. Nearly 70% of ship emissions occur within 400 km of coastlines, causing air quality problems through the formation of ground-level ozone, sulphur emissions and particulate matter in coastal areas and harbours with heavy traffic. Furthermore, ozone and aerosol precursor emissions as well as their derivative species from ships may be transported in the atmosphere over several hundreds of kilometres, and thus contribute to air quality problems further inland, even though they are emitted at sea. In addition, ship emissions impact climate. Recent studies indicate that the cooling due to altered clouds far outweighs the warming effects from greenhouse gases such as carbon dioxide (CO 2) or ozone from shipping, overall causing a negative present-day radiative forcing (RF). Current efforts to reduce sulphur and other pollutants from shipping may modify this. However, given the short residence time of sulphate compared to CO 2, the climate response from sulphate is of the order decades while that of CO 2 is centuries. The climatic trade-off between positive and negative radiative forcing is still a topic of scientific research, but from what is currently known, a simple cancellation of global mean forcing components is potentially inappropriate and a more comprehensive assessment metric is required. The CO 2 equivalent emissions using
Contribution of ship traffic to aerosol particle concentrations downwind of a major shipping lane
DEFF Research Database (Denmark)
Kivekäs, N.; Massling, Andreas; Grythe, H.
2014-01-01
at a remote location. We studied the particle number concentration (12 to 490 nm in diameter), the mass concentration (12 to 150 nm in diameter) and number and volume size distribution of aerosol particles in ship plumes for a period of 4.5 months at Hovsore, a coastal site on the western coast of Jutland...... in Denmark. During episodes of western winds, the site is about 50 km downwind of a major shipping lane and the plumes are approximately 1 hour old when they arrive at the site. We have used a sliding percentile-based method for separating the plumes from the measured background values and to calculate...... the ship plume contribution to the total particle number and PM0.15 mass concentration (mass of particles below 150 nm in diameter, converted from volume assuming sphericity) at the site. The method is not limited to particle number or volume concentration, but can also be used for different chemical...
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Receipt and acknowledgement of distress alerts by ship stations and ship earth stations. 80.1121 Section 80.1121 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Global Maritime Distress and Safety System (GMDSS)...
Estimation of waves and ship responses using onboard measurements
DEFF Research Database (Denmark)
Montazeri, Najmeh
This thesis focuses on estimation of waves and ship responses using ship-board measurements. This is useful for development of operational safety and performance efficiency in connection with the broader concept of onboard decision support systems. Estimation of sea state is studied using a set...... of measured ship responses, a parametric description of directional wave spectra (a generalised JONSWAP model) and the transfer functions of the ship responses. The difference between the spectral moments of the measured ship responses and the corresponding theoretically calculated moments formulates a cost...... information. The model is tested on simulated data based on known unimodal and bimodal wave scenarios. The wave parameters in the output are then compared with the true wave parameters. In addition to the numerical experiments, two sets of full-scale measurements from container ships are analysed. Herein...
Directory of Open Access Journals (Sweden)
D. A. Lack
2012-05-01
Full Text Available The International Maritime Organization (IMO has moved to address the health and climate impact of the emissions from the combustion of low-quality residual fuels within the commercial shipping industry. Fuel sulfur content (FS limits and an efficiency design index for future ships are examples of such IMO actions. The impacts of black carbon (BC emissions from shipping are now under review by the IMO, with a particular focus on the potential impacts of future Arctic shipping.
Recognizing that associating impacts with BC emissions requires both ambient and onboard observations, we provide recommendations for the measurement of BC. We also evaluate current insights regarding the effect of ship speed (engine load, fuel quality and exhaust gas scrubbing on BC emissions from ships. Observations demonstrate that BC emission factors (EFBC increases 3 to 6 times at very low engine loads (<25% compared to EFBC at 85–100% load; absolute BC emissions (per nautical mile of travel also increase up to 100% depending on engine load, even with reduced load fuel savings. If fleets were required to operate at lower maximum engine loads, presumably associated with reduced speeds, then engines could be re-tuned, which would reduce BC emissions.
Ships operating in the Arctic are likely running at highly variable engine loads (25–100% depending on ice conditions and ice breaking requirements. The ships operating at low load may be emitting up to 50% more BC than they would at their rated load. Such variable load conditions make it difficult to assess the likely emissions rate of BC.
Current fuel sulfur regulations have the effect of reducing EFBC by an average of 30% and potentially up to 80% regardless of engine load; a removal rate similar to that of scrubbers.
Uncertainties among current observations demonstrate there is a need for more information on a the impact of fuel quality
49 CFR 172.201 - Preparation and retention of shipping papers.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Preparation and retention of shipping papers. 172..., TRAINING REQUIREMENTS, AND SECURITY PLANS Shipping Papers § 172.201 Preparation and retention of shipping papers. (a) Contents. When a description of hazardous material is required to be included on a shipping...
Summerville, Jessica R.; Cullis, Bethia L.; Druker, Eric R.; Rutledge, Gabriel B.; Braxton, Peter J.; Coleman, Richard L.
2007-01-01
Proceedings Paper (for Acquisition Research Program) Since the end of the Cold War, the perceived need for Navy ships has dropped, and so the shipbuilding budget has dropped. Seemingly coincidental with this budgetary pressure, and perversely aggravating the problem, ship costs began to rise steeply. We will set aside that ships have grown in weight by about three percent per year since World War II and that ever-more weapon systems are being put into them, and confine ourselves to discu...
IS INLAND SHIPPING NEEDED IN POLAND?
Directory of Open Access Journals (Sweden)
Ryszard Rolbiecki
2014-06-01
Full Text Available In Poland, inland shipping plays only a mariginal role in transport needs fulfillment. Inland shipping has a share of mere 0,3% in goods transport modal split. The reason for this is poor and variable technical parameters of inland waterways together with adverse legal regulations. Different situation takes place in Western European countries, in which the development of this mode of transport is viewed as a way of road transport develop-ment restraint. In Poland, the need to move some of the volume from road transport to in-land shipping is specifically observed within marine ports surroundings. Because of their complex nature, the investments in inland shipping infrastructure would also be helpful in solving the current problems of water management. Inland waterways in Poland guaran-tee neither an adequate level of flood protection, nor the water needs fulfillment of do-mestic economy. When it comes to water reserves, Poland is one of the most deficient countries in Europe. Thus there is a need to invest in inland waterways in Poland.
32 CFR 700.873 - Inspection incident to commissioning of ships.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Inspection incident to commissioning of ships... Inspection incident to commissioning of ships. When a ship is to be commissioned, the authority designated to place such ship in commission shall, just prior to commissioning, cause an inspection to be made to...
46 CFR 153.12 - IMO Certificates for United States Ships.
2010-10-01
... 8, or the Officer in Charge, Marine Inspection, issues a United States ship an IMO Certificate... 46 Shipping 5 2010-10-01 2010-10-01 false IMO Certificates for United States Ships. 153.12 Section... CARGOES SHIPS CARRYING BULK LIQUID, LIQUEFIED GAS, OR COMPRESSED GAS HAZARDOUS MATERIALS General § 153.12...
Legionella risk assessment in cruise ships and ferries.
Laganà, Pasqualina; Gambuzza, Maria Elsa; Delia, Santi
2017-06-12
Introduction. The increasing development of marine traffic has led to a rise in the incidence of legionellosis among travellers. It occurs in similar environments, especially closed and crowded, and aboard ships Legionella survives and multiplies easily in water pipes, spreading into the environment through air conditioning systems and water distribution points. Although in recent years in the construction of cruise ships preventive measures aimed at curbing the proliferation of Legionella (design, materials, focus on the operation and maintenance of the water system), have been taken account, little or no attention has been paid to small ships which, in many cases, are old and not well maintained. Objective. The aim of the study was to evaluate the frequency and severity of Legionella contamination in ferries and cruise ships in order to adopt more specific control measures. Materials and method. A prevalence study was carried out on 10 ferries and 6 cruise ships docking or in transit across the port of Messina (Sicily, Italy). Water and air samples collected from many critical points were tested for qualitative and quantitative identification of Legionella. Results and conclusions. Legionella pneumophila sg 1 was isolated from the samples of shower and tap water in 7 (70%) of the 10 ferries examined, and in 3 (33%) of the 6 cruise ships examined, and L. pneumophila sg 2-14 in 8 (80%) and 1 (16.7%) of these ships, respectively. No Legionella contamination was found in whirlpool baths, air and ice samples. In conclusion, the data obtained confirm higher levels of Legionella contamination in local ferries and cruise ships, underlining the need to adopt corrective actions more specific for these smaller vessels.
SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report
International Nuclear Information System (INIS)
2003-10-01
The Repository for Radioactive Operational Waste (SFR 1) is now the object of a new review by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). One of the stipulations for operating SFR 1 was that a new assessment of the long-term performance and environmental consequences of the repository should be conducted once every 10 years by the licensee, the Swedish Nuclear Fuel and Waste Management Co (SKB). During the time that SFR 1 has been in operation, experience has been gained of operating the facility and new knowledge of long-term performance of SFR 1 has been obtained. New regulations for nuclear facilities have been promulgated since SFR 1 was taken into operation (1988). A review committee comprising employees from SKI and SSI has conducted the review of SSR 2001. This review report has resulted in the committee's evaluation of the safety of SFR 1 and is the basis of the regulatory authorities' decision concerning any amendments to the stipulations for the operation of SFR 1. However, the review has found deficiencies in the follow up of the development of design basis norms since the facility was constructed as well as deficiencies in learning from operating experience. However, the overall evaluation is that the facility is being operated in an acceptable manner from the standpoint of safety. With respect to the long-term performance of the repository, it is a deficiency that SSR 2001 does not describe how compliance with the stipulated radiation protection requirements on optimisation and use of the best available technology (BAT) is achieved during operation. In the opinion of the review committee, issues relating to occupational radiation protection are being handled satisfactorily and the operational releases of radioactive substances are very small. Safety and Radiation Protection after Closure SKB's long-term repository performance assessment contains essential updates and improvements compared with the
Review of the total system related to operation of nuclear-powered ship
International Nuclear Information System (INIS)
Takamasa, Tomoji; Miyashita, Kunio
2000-01-01
It is essential to establish a marine reactor having excellent safety and reliability, which is capable of competing economically with conventional ships, and which can be accepted by international society, in order to be prepared for practical application of future nuclear-powered ships. For this purpose, it is important not only to demonstrate a marine reactor using a model or test device to simulate actual operation, but also to establish the environmental requirements for operation of a nuclear-powered ship, such as safety standards that are operationally and internationally common for ships, and to establish a repair base for nuclear-powered ships. Systems research for the practical application of nuclear-powered ships was conducted for five years, fiscal years 1992 through 1996, by a group in the Japan Atomic Energy Research Institute (JAERI), under the project title 'Review of the total system related to operation of nuclear-powered ships.' The project sought to summarize requirements for the practical application of nuclear-powered ships from the standpoint of the need side, e.g., what nuclear-powered ships will be requested, and what functions will be provided under the expected future social environment; to show a complete system concept for the operation of nuclear-powered ships; and to clarify the situations creating demand for nuclear-powered ships, as well as the system and environmental conditions to be established for operation of practical nuclear-powered ships. Study considerations included the size of the operation system for a nuclear-powered ship, a scenario for introducing a nuclear-powered container ship, and economic evolution from the effects on the whole shipping system, based on container ships, of introducing a nuclear-powered ship. The results of these considerations were made the framework for constructing an entire system and evaluating its economy. The treatment and disposal of radioactive waste from a nuclear-powered ship, and the
Design of Crashworthy Ship Strucures
DEFF Research Database (Denmark)
Toernqvist, Rikard
2003-01-01
The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration of the str......The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration...... in collision and grounding analysis is the prediction of the onset of fracture and crack propagation in the shell plating. In simulations of accidental loading on ships it is crucial that fracture is determined correctly, as it will influence the global deformation mode and the amount of damage to the hull...
DEFF Research Database (Denmark)
Simonsen, Bo Cerup; Pedersen, Preben Terndrup
1997-01-01
The paper deals with analysis of grounding of high-speed crafts. It is the purpose to present a comprehensive mathematical model for calculation of the overall dynamic ship response during grounding. This procedure is applied to derive the motions, the time varying sectional forces and the local...... loads during grounding on plane, sloping, sandy bottoms for six different designs of fast monohull ships made from steel, aluminium or GRP sandwich materials. The results show that the effect of the hull flexibility is to reduce the overall dynamic sectional loads on the hull girder. The considered...... numerical examples also indicate that, even with impact speeds of 40 knots against a 1:10 sloping bottom, the global strength of the hull girder is not exceeded by the grounding induced loads.For the local deformation of high-speed ship hulls at the point of contact with the ground, the paper presents...
Experimental and theoretical study of magnetohydrodynamic ship models.
Cébron, David; Viroulet, Sylvain; Vidal, Jérémie; Masson, Jean-Paul; Viroulet, Philippe
2017-01-01
Magnetohydrodynamic (MHD) ships represent a clear demonstration of the Lorentz force in fluids, which explains the number of students practicals or exercises described on the web. However, the related literature is rather specific and no complete comparison between theory and typical small scale experiments is currently available. This work provides, in a self-consistent framework, a detailed presentation of the relevant theoretical equations for small MHD ships and experimental measurements for future benchmarks. Theoretical results of the literature are adapted to these simple battery/magnets powered ships moving on salt water. Comparison between theory and experiments are performed to validate each theoretical step such as the Tafel and the Kohlrausch laws, or the predicted ship speed. A successful agreement is obtained without any adjustable parameter. Finally, based on these results, an optimal design is then deduced from the theory. Therefore this work provides a solid theoretical and experimental ground for small scale MHD ships, by presenting in detail several approximations and how they affect the boat efficiency. Moreover, the theory is general enough to be adapted to other contexts, such as large scale ships or industrial flow measurement techniques.
Experimental and theoretical study of magnetohydrodynamic ship models.
Directory of Open Access Journals (Sweden)
David Cébron
Full Text Available Magnetohydrodynamic (MHD ships represent a clear demonstration of the Lorentz force in fluids, which explains the number of students practicals or exercises described on the web. However, the related literature is rather specific and no complete comparison between theory and typical small scale experiments is currently available. This work provides, in a self-consistent framework, a detailed presentation of the relevant theoretical equations for small MHD ships and experimental measurements for future benchmarks. Theoretical results of the literature are adapted to these simple battery/magnets powered ships moving on salt water. Comparison between theory and experiments are performed to validate each theoretical step such as the Tafel and the Kohlrausch laws, or the predicted ship speed. A successful agreement is obtained without any adjustable parameter. Finally, based on these results, an optimal design is then deduced from the theory. Therefore this work provides a solid theoretical and experimental ground for small scale MHD ships, by presenting in detail several approximations and how they affect the boat efficiency. Moreover, the theory is general enough to be adapted to other contexts, such as large scale ships or industrial flow measurement techniques.
Global ship accidents and ocean swell-related sea states
Directory of Open Access Journals (Sweden)
Z. Zhang
2017-11-01
Full Text Available With the increased frequency of shipping activities, navigation safety has become a major concern, especially when economic losses, human casualties and environmental issues are considered. As a contributing factor, the sea state plays a significant role in shipping safety. However, the types of dangerous sea states that trigger serious shipping accidents are not well understood. To address this issue, we analyzed the sea state characteristics during ship accidents that occurred in poor weather or heavy seas based on a 10-year ship accident dataset. Sea state parameters of a numerical wave model, i.e., significant wave height, mean wave period and mean wave direction, were analyzed for the selected ship accident cases. The results indicated that complex sea states with the co-occurrence of wind sea and swell conditions represent threats to sailing vessels, especially when these conditions include similar wave periods and oblique wave directions.
Global ship accidents and ocean swell-related sea states
Zhang, Zhiwei; Li, Xiao-Ming
2017-11-01
With the increased frequency of shipping activities, navigation safety has become a major concern, especially when economic losses, human casualties and environmental issues are considered. As a contributing factor, the sea state plays a significant role in shipping safety. However, the types of dangerous sea states that trigger serious shipping accidents are not well understood. To address this issue, we analyzed the sea state characteristics during ship accidents that occurred in poor weather or heavy seas based on a 10-year ship accident dataset. Sea state parameters of a numerical wave model, i.e., significant wave height, mean wave period and mean wave direction, were analyzed for the selected ship accident cases. The results indicated that complex sea states with the co-occurrence of wind sea and swell conditions represent threats to sailing vessels, especially when these conditions include similar wave periods and oblique wave directions.
International Nuclear Information System (INIS)
Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.
1995-09-01
Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs
Radiative Forcing Over Ocean by Ship Wakes
Gatebe, Charles K.; Wilcox, E.; Poudyal, R.; Wang, J.
2011-01-01
Changes in surface albedo represent one of the main forcing agents that can counteract, to some extent, the positive forcing from increasing greenhouse gas concentrations. Here, we report on enhanced ocean reflectance from ship wakes over the Pacific Ocean near the California coast, where we determined, based on airborne radiation measurements that ship wakes can increase reflected sunlight by more than 100%. We assessed the importance of this increase to climate forcing, where we estimated the global radiative forcing of ship wakes to be -0.00014 plus or minus 53% Watts per square meter assuming a global distribution of 32331 ships of size of greater than or equal to 100000 gross tonnage. The forcing is smaller than the forcing of aircraft contrails (-0.007 to +0.02 Watts per square meter), but considering that the global shipping fleet has rapidly grown in the last five decades and this trend is likely to continue because of the need of more inter-continental transportation as a result of economic globalization, we argue that the radiative forcing of wakes is expected to be increasingly important especially in harbors and coastal regions.
Capital structure in the global shipping industry
Directory of Open Access Journals (Sweden)
Paun Cristian
2016-01-01
Full Text Available The current economic crisis emerged from a particular financial crisis that started in the United States and being rapidly propagated all over the world. It did not affect a limited region or a limited economic sector. This crisis induced significant changes in all management areas, including financial management. This study is focused on financing strategies adopted by shipping companies during the crisis, analyzing relevant factors for a specific issue - the capital structure. The research methodology proposed for this analysis on relevant factors that could explain the capital structure of shipping is OLS regression applied on selected variables derived from the financial statements of the major shipping companies. The dependent variables reflecting capital structure are book value to total liabilities ratio and book value to total debt ratio. The explanatory variables are derived from the theory of capital structure. This study empirically illustrates the relevance of the capital structure theory for the studied economic sector and is a useful tool for the shipping companies, providing relevant information about the optimal capital structure adopted by shipping companies and about factors that influence this decision during a crisis period.
Significance of Waterway Navigation Positioning Systems On Ship's Manoeuvring Safety
Galor, W.
The main goal of navigation is to lead the ship to the point of destination safety and efficiently. Various factors may affect ship realisating this process. The ship movement on waterway are mainly limited by water area dimensions (surface and depth). These limitations cause the requirement to realise the proper of ship movement trajectory. In case when this re requirement cant't fulfil then marine accident may happend. This fact is unwanted event caused losses of human health and life, damage or loss of cargo and ship, pollution of natural environment, damage of port structures or blocking the port of its ports and lost of salvage operation. These losses in same cases can be catas- trophical especially while e.i. crude oil spilling could be place. To realise of safety navigation process is needed to embrace the ship's movement trajectory by waterways area. The ship's trajectory is described by manoeuvring lane as a surface of water area which is require to realise of safety ship movement. Many conditions affect to ship manoeuvring line. The main are following: positioning accuracy, ship's manoeuvring features and phenomena's of shore and ship's bulk common affecting. The accuracy of positioning system is most important. This system depends on coast navigation mark- ing which can range many kinds of technical realisation. Mainly used systems based on lights (line), radionavigation (local system or GPS, DGPS), or radars. If accuracy of positiong is higer, then safety of navigation is growing. This article presents these problems exemplifying with approaching channel to ports situated on West Pomera- nian water region.
Review of ship slamming loads and responses
Wang, Shan; Guedes Soares, C.
2017-12-01
The paper presents an overview of studies of slamming on ship structures. This work focuses on the hull slamming, which is one of the most important types of slamming problems to be considered in the ship design process and the assessment of the ship safety. There are three main research aspects related to the hull slamming phenomenon, a) where and how often a slamming event occurs, b) slamming load prediction and c) structural response due to slamming loads. The approaches used in each aspect are reviewed and commented, together with the presentation of some typical results. The methodology, which combines the seakeeping analysis and slamming load prediction, is discussed for the global analysis of the hull slamming of a ship in waves. Some physical phenomena during the slamming event are discussed also. Recommendations for the future research and developments are made.
Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97
Energy Technology Data Exchange (ETDEWEB)
Hora, Stephen
2002-09-01
The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.
[Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].
Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria
2011-08-01
The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.
Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97
International Nuclear Information System (INIS)
Hora, Stephen
2002-09-01
The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches
Radiation protection studies for the SHiP facility
Strabel, Claudia Christina; Vincke, Helmut
2015-01-01
The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.
Analysis of Methods of Determining the Safe Ship Trajectory
Directory of Open Access Journals (Sweden)
Jozef Lisowski
2016-07-01
Full Text Available The paper describes six methods of optimal and game theory and artificial neural network for synthesis of safe control in collision situations at sea. The application of optimal and game control algorithms to determine the own ship safe trajectory during the passing of other encountered ships in good and restricted visibility at sea is presented. The comparison of the safe ship control in collision situation: multi-step matrix non-cooperative and cooperative games, multi-stage positional non-cooperative and cooperative games have been introduced. The considerations have been illustrated with examples of computer simulation of the algorithms to determine safe of own ship trajectories in a navigational situation during passing of eight met ships.
Improving the competitiveness of green ship recycling
Jain, K.P.
2017-01-01
The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and artificial reefs. As the decision is a commercial one, the selection of a yard is predominantly based on the offer price, which depends on the location of the yard and the recycling process employed.Among...
Dark matter at the SHiP experiment
International Nuclear Information System (INIS)
Timiryasov, Inar
2016-01-01
We study prospects of dark matter searches in the SHiP experiment. SHiP (Search for Hidden Particles) is the recently proposed fixed target experiment which will exploit the high-intensity beam of 400 GeV protons from the CERN SPS. In addition to the hidden sector detector, SHiP will be equipped with the ν_τ detector, which presumably would be sensitive to dark matter particles. We describe appropriate production and detection channels and estimate SHiP’s sensitivity for a scalar dark matter coupled to the Standard model through the vector mediator
Routing and scheduling and fleet management for liner shipping
DEFF Research Database (Denmark)
Kjeldsen, Karina Hjortshøj
2009-01-01
The problem of routing, scheduling and fleet management in global liner shipping is presented. The developed model incorporates the ships' speed as a decision variable. Furthermore, the model must be able to handle problems of the size and complexity experienced by the global liner shipping...
Maneuverability of Ships with small Draught in Steady Wind
Directory of Open Access Journals (Sweden)
Daeng Paroka
2016-04-01
Full Text Available Wind force and moment may force a ship to drastically decrease its speed and use a large drift angle as well as a large rudder angle in order to maintain its course. Shipswith a small draught might have more risk in maneuvering to its point of view compared with a ship with a larger draught. This paper discusses maneuverability of a ship with a small draught in steady wind. The effect of wind on ship speed, drift angle, and rudder angle are investigated in a steady state condition. Five different ratios of wind velocity to ship speed from 1.0 to 20.0 are used in the simulation. The variation in wind direction is examined from 0°to 180°. Results of the numerical simulation show that thewind has a significant effect on the reduction in ship speed with a wind direction less than 100°. The drift angle increases due to increasing wind velocity in the same wind direction. Wind direction also has a significant effect on the drift angle especially when the wind direction is less than 140°. The same phenomenon was found for the rudder angle. The necessary rudder angle is greater than the maximum rudder angle of the ship when the wind direction is 60°with a wind velocity to ship speed ratio of 20 or more.
The activity-based methodology to assess ship emissions - A review.
Nunes, R A O; Alvim-Ferraz, M C M; Martins, F G; Sousa, S I V
2017-12-01
Several studies tried to estimate atmospheric emissions with origin in the maritime sector, concluding that it contributed to the global anthropogenic emissions through the emission of pollutants that have a strong impact on hu' health and also on climate change. Thus, this paper aimed to review published studies since 2010 that used activity-based methodology to estimate ship emissions, to provide a summary of the available input data. After exclusions, 26 articles were analysed and the main information were scanned and registered, namely technical information about ships, ships activity and movement information, engines, fuels, load and emission factors. The larger part of studies calculating in-port ship emissions concluded that the majority was emitted during hotelling and most of the authors allocating emissions by ship type concluded that containerships were the main pollutant emitters. To obtain technical information about ships the combined use of data from Lloyd's Register of Shipping database with other sources such as port authority's databases, engine manufactures and ship-owners seemed the best approach. The use of AIS data has been growing in recent years and seems to be the best method to report activities and movements of ships. To predict ship powers the Hollenbach (1998) method which estimates propelling power as a function of instantaneous speed based on total resistance and use of load balancing schemes for multi-engine installations seemed to be the best practices for more accurate ship emission estimations. For emission factors improvement, new on-board measurement campaigns or studies should be undertaken. Regardless of the effort that has been performed in the last years to obtain more accurate shipping emission inventories, more precise input data (technical information about ships, engines, load and emission factors) should be obtained to improve the methodology to develop global and universally accepted emission inventories for an
Numerical Study on the Effect of Buffer Bow Structure in Ship-to-ship Collisions
DEFF Research Database (Denmark)
Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup
2005-01-01
tankers, the introduction of buffer bulbous bows has been proposed. Relatively soft buffer bows absorb part of the kinetic energy of the striking ship before penetrating the inner hull of the struck vessel. The purpose of the present paper is to verify the effectiveness of a prototype buffer bulbous bow......) and the forward velocity of the struck ship on the collapse mode of the bow of the striking vessel are investigated. Collapse modes, contact forces and energy absorption capabilities of the buffer bows are compared with those of conventional bows....
Modelling ship operational reliability over a mission under regular inspections
Christer, A.H.; Lee, S.K.
1997-01-01
A ship is required to operate for a fixed mission period. Should a critical item of equipment fail at sea, the ship is subject to a costly event with potentially high risk to ship and crew. Given warning of a pending defect, the ship can try to return to port under its own power and thus attempt to
A Mathematical Model for Analysis on Ships Collision Avoidance ...
African Journals Online (AJOL)
This study develops a mathematical model for analysis on collision avoidance of ships. The obtained model provides information on the quantitative effect of the ship's engine's response and the applied reversing force on separation distance and stopping abilities of the ships. Appropriate evasive maneuvers require the ...
A Way Forward for Ship Classification and Technical Services
Directory of Open Access Journals (Sweden)
Lam-Bee Goh
2014-04-01
Full Text Available Classification societies are one of key organizations that promote the highest standards in ship safety and quality shipping. The paper reviews the ship classification industry and identifies what the classification societies can do to add value to the maritime industry more effectively. To meet this objective, an analysis of the five competitive forces is carried out, together with an opinion survey performed on some of the leading shipping companies, to assess and to establish some of the key factors which should be considered when formulating an overall business strategy for the growth of the classification services business. The findings from the study are discussed with the strategic options and choices. A classification services industrial value chain analysis together with ship management and operation is undertaken to explore the opportunities for classification societies. These findings also provide guidance to policy-makers who design and seek to implement more effective international shipping policies.
Social Security Administration — This dataset provides annual volumes for API language preferences at the national level of individuals filing claims for SSI Blind and Disabled benefits for federal...
Social Security Administration — This data set provides annual volumes for language preferences at the national level of individuals filing claims for SSI Blind and Disabled benefits from federal...
Can we always ignore ship-generated food waste?
International Nuclear Information System (INIS)
Polglaze, John
2003-01-01
Considerable quantities of food waste can be generated at a rapid rate in ships, particularly those with large numbers of people onboard. By virtue of the amounts involved and its nature, food waste is potentially the most difficult to manage component of a ship's garbage stream, however, in most sea areas it may be dealt with by the simple expedient of direct discharge to sea. As a consequence, only minimal attention is paid to food waste management by many ship and port operators and advisory bodies, and there is a paucity of information in the available literature. The determination that management of ships' food waste is inconsequential is, however, incorrect in many circumstances. Disposal to sea is not always possible due to restrictions imposed by MARPOL 73/78 and other marine pollution control instruments. Effective management of food waste can be critical for ships that operate in areas where disposal is restricted or totally prohibited
The Ship Movement Trajectory Prediction Algorithm Using Navigational Data Fusion.
Borkowski, Piotr
2017-06-20
It is essential for the marine navigator conducting maneuvers of his ship at sea to know future positions of himself and target ships in a specific time span to effectively solve collision situations. This article presents an algorithm of ship movement trajectory prediction, which, through data fusion, takes into account measurements of the ship's current position from a number of doubled autonomous devices. This increases the reliability and accuracy of prediction. The algorithm has been implemented in NAVDEC, a navigation decision support system and practically used on board ships.
Fuel exchanger for nuclear ships
International Nuclear Information System (INIS)
Suda, Koji; Kanbara, Takahisa; Watanabe, Masaharu.
1984-01-01
Purpose: To prevent enviromental contamination landing radioactive materials from the inside of a ship. Constitution: A provisional cabin having a shape covering a reactor hatch and a hatch cover is disposed on the upper deck of a ship body. A ceiling shutter is disposed to the cabin. A protection cylinder having a shutter and a filter fan is attached on the cabin. Materials to be discharged out of the ship are transported to a fuel exchange tower on land by using a crane while being contained in the protection cylinder with the shutter being closed. The protection cylinder is connected by means of a wire rope to a loop-wheel machine which disposed on the trolly of a crane. While the bellows through which the suspending wire for the discharged products passes is perforated, since the inside of the cylinder is depressurized by a filter fan, there is no air leakage through the perforation to the outside. (Ikeda, J.)
Fuel exchanger for nuclear ships
Energy Technology Data Exchange (ETDEWEB)
Suda, Koji; Kanbara, Takahisa; Watanabe, Masaharu
1984-11-29
To prevent enviromental contamination by radioactive materials from the inside of a ship a provisional cabin having a shape covering a reactor hatch and a hatch cover is disposed on the upper deck of a ship body. A ceiling shutter is disposed to the cabin. A protection cylinder having a shutter and a filter fan is attached on the cabin. Materials to be discharged out of the ship are transported to a fuel exchange tower on land by using a crane while being contained in the protection cylinder with the shutter being closed. The protection cylinder is connected by means of a wire rope to a loop-wheel machine which is disposed on the trolly of a crane. While the bellows through which the suspending wire for the discharged products passes is perforated, since the inside of the cylinder is depressurized by a filter fan, there is no air leakage through the perforation to the outside.
Directory of Open Access Journals (Sweden)
A. Lauer
2007-10-01
atmosphere (ToA under clear-sky condition of about −0.014 W/m² to −0.038 W/m² for a global annual average. The corresponding all-sky direct aerosol forcing ranges between −0.011 W/m² and −0.013 W/m². The indirect aerosol effect of ships on climate is found to be far larger than previously estimated. An indirect radiative effect of −0.19 W/m² to −0.60 W/m² (a change in the atmospheric shortwave radiative flux at ToA is calculated here, contributing 17% to 39% of the total indirect effect of anthropogenic aerosols. This contribution is high because ship emissions are released in regions with frequent low marine clouds in an otherwise clean environment. In addition, the potential impact of particulate matter on the radiation budget is larger over the dark ocean surface than over polluted regions over land.
Strength of Ship Plates under Combined Loading
DEFF Research Database (Denmark)
Cui, W.; Wang, Y.; Pedersen, Preben Terndrup
2002-01-01
Strength of ship plates plays a significant role in the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified analytical methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates subjec...
Annual report 1991 TECO Energy Inc
International Nuclear Information System (INIS)
Anon.
1992-01-01
Achievements of TECO energy during 1991 are summarized in the annual report which includes financial statements for the year up to 31 December 1991. Methane production from coal seams in the Black Warrior Basin of Alabama, by TECO Coalbed Methane, increased to 55 million cubic feet per day. The purchase of Gulf-States Paper's interest in two coalbed methane projects brought TECO's total commitment in coalbed methane to 135 million dollars. TECO Coal acquired additional reserves of low-sulphur coal in bringing total holdings to 175 million tons. Work continued on construction of TECO Power Services' combined cycle power plant. Tampa Electric announced plans to build a power plant in Polk County using the latest coal gasification technology TECO Transport ampersand Trade's shipping and transloading companies performed well during the year
International Nuclear Information System (INIS)
2001-03-01
SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have
Federal Laboratory Consortium — Performing Advanced Hydrodynamic ModelingEngineers and ship pilots can now overcome the challenges of evaluating navigation channel designs, modifications and safety...
Strength of ship plates under combined loading
DEFF Research Database (Denmark)
Cui, Weiching; Wang, Yongjun; Pedersen, Preben Terndrup
2000-01-01
Strength of ship plates plays a significant role for the ultimate strength analysis of ship structures. In recent years several authors have proposed simplified methods to calculate the ultimate strength of unstiffened plates. The majority of these investigations deal with plates subjected to lon...
A framework to bridge the energy efficiency gap in shipping
International Nuclear Information System (INIS)
Jafarzadeh, Sepideh; Utne, Ingrid Bouwer
2014-01-01
Environmental concerns, emission regulations, fuel prices, and emission taxes increase the demand to improve energy efficiency in shipping. However, several barriers prevent the adoption of cost-effective energy saving measures. In this article a framework is offered to overcome the barriers encountered in shipping. 12 participants from five ship owners in Norway, two equipment suppliers, and a research institute have provided input to this study. The framework makes the barriers evident to ship owners and (energy) managers. It helps them to prioritize and overcome the critical barriers to improve energy efficiency in a consistent manner. Researchers and policy makers can also utilize the framework as it makes challenges to energy efficiency apparent. Finally, due to its generic structure it can be applied to industries other than shipping. - Highlights: • The article offers a framework for overcoming barriers to energy efficiency. • The framework is developed based on input from five ship owners in Norway, two equipment suppliers, and a research institute. • The article presents challenges and barriers to energy efficiency in shipping. • Possible measures for overcoming barriers in shipping are suggested. • The framework is generic in nature and can be applied to other industries
Social Security Administration — This data set provides annual volumes for language preferences at the national level of individuals filing claims for SSI Aged benefits from federal fiscal year 2011...
Social Security Administration — This data set provides annual volumes for API language preferences at the national level of individuals filing claims for SSI Blind and Disabled benefits for federal...
Social Security Administration — This data set provides annual volumes for API language preferences at the national level of individuals filing claims for SSI Aged benefits from federal fiscal year...
World Ships: The Solar-Photon Sail Option
Matloff, G. L.
The World Ship, a spacecraft large enough to simulate a small-scale terrestrial internal environment, may be the best feasible option to transfer members of a technological civilization between neighboring stars. Because of the projected size of these spacecraft, journey durations of ~1,000 years seem likely. One of the propulsion options for World Ships is the hyper-thin, likely space-manufactured solar-photon sail, unfurled as close to the migrating civilization's home star as possible. Because the sail and associated structure can be wound around the habitat while not in use, it represents the only known ultimately feasible interstellar propulsion system that can be applied for en route galactic-cosmic ray shielding as well as acceleration/ deceleration. This paper reviews the three suggested sail configurations that can be applied to world ship propulsion: parachute, hollow-body and hoop sails. Possible existing and advanced sail and structure materials and the predicted effects on the sail of the near-Sun space environment are reviewed. Consideration of solar-photon-sail World Ships also affects SETI (the Search for Extraterrestrial Intelligence). Can we detect such craft in flight? When in a star's lifetime is migration using such craft likely? What classes of stars are good candidates for solar-sail World-Ship searches?
Effect of stern hull shape on turning circle of ships
Jaswar, Maimun, A.; Wahid, M. A.; Priyanto, A.; Zamani, Pauzi, Saman
2012-06-01
Many factors such as: stern hull shape, length, draught, trim, propulsion system and external forces affecting the drift angle influence rate of turn and size of turning circle of ships. This paper discusses turning circle characteristics of U and V stern hull shape of Very Large Crude Oil Carrier (VLCC) ships. The ships have same principal dimension such as length, beam, and draught. The turning circle characteristics of the VLCC ships are simulated at 35 degree of rudder angle. In the analysis, firstly, turning circle performance of U-type VLCC ship is simulated. In the simulation, initial ship speed is determined using given power and rpm. Hydrodynamic derivatives coefficients are determined by including effect of fullness of aft run. Using the obtained, speed and hydrodynamic coefficients, force and moment acting on hull, force and moment induced by propeller, force and moment induced by rudder are determined. Finally, ship trajectory, ratio of speed, yaw angle and drift angle are determined. Results of simulation results of the VLCC ship are compared with the experimental one as validation. Using the same method, V-type VLCC is simulated and the simulation results are compared with U-type VLCC ship. Results shows the turning circle of U-type is larger than V-type due to effect stern hul results of simulation are.
Thermal Evaluation of a KRI-BGM Shipping Cask
International Nuclear Information System (INIS)
Bang, K. S.; Lee, J. C.; Seo, K. S.
2007-01-01
Radioactive isotopes are used extensively in the fields of industry, medical treatment, food and agriculture. Use of radioactive isotopes is expected to increase continuously with the growth of each field. In order to safely transport radioactive isotopes from the place of manufacture to the place of use, a shipping package is required. Therefore KAERI is developing the KRI-BGM shipping cask to transport the Ir-192 bulk radioactive material, which is produced at the HANARO research reactor. The shipping package should satisfy the requirements which are prescribed in the Korea MOST Act 2001-23, IAEA Safety Standard Series No. TS-R-1, US 10 CFR Part 71 and the US 49 CFR Part 173. These regulatory classify the KRI-BGM shipping cask as a Type B package, and their regulatory guidelines state that the Type B package for transporting radioactive materials should be able to withstand a period of 30 minutes under a thermal condition of 800 .deg. C. However, the polyurethane, which is to be used as the filling within the cavity of the KRIBGM shipping cask, has a very weak characteristic in a high temperature. Therefore it is difficult for the depleted uranium(hereafter DU), which is used as shielding material, to be protected under a thermal condition of 800 .deg. C. Accordingly, the KRI-BGM shipping cask, which applied non-combustible polyurethane and fireproof materials as the filling, was fabricated. The thermal tests by using prototype cask have been performed to estimate the thermal integrity of the KRI-BGM shipping cask under a thermal condition of 800 .deg. C
Directory of Open Access Journals (Sweden)
Dariusz TARNAPOWICZ
2013-07-01
Full Text Available ‘Shore to ship’ system – ships’ power supply from the local electrical substations – is one of the effective ways to limit the negative impact of the ships lying in ports on the environment. Energy infrastructure of the port installation necessary to provide ships with power supply has to be designed so that different types of ships can use it. The important issue concerning ‘shore to ship’ system is the quality of power supply. This can be achieved via sustaining continuity of power supply while switching from the ships’ electrical network over to the national grid. In this article the author presents the way of synchronizing the national grid with the ships’ electrical network during ship’s lying in port. Such synchronization would allow for uninterruptible work of the ship’s electrical devices.
Full-scale tests of spent-nuclear-fuel shipping systems
International Nuclear Information System (INIS)
Yoshimura, H.R.; Huerta, M.
1976-01-01
Sandia Laboratories will be conducting, for the U.S. Energy Research and Development Administration, a series of tests involving spent-nuclear-fuel shipping systems. Large shipping casks in the 20500 to 70000-kg range will be included in the following full-scale tests: (1) Runaway tractor-trailer crash into a solid concrete barrier while carrying a shipping cask. (2) High-speed locomotive grade-crossing impact with a truck carrying a shipping cask. (3) High-speed derailment, collision, and fire involving a special railcar and shipping cask. The hardware and testing procedures for each of the tests are described. The analysis conducted in advance of the tests addresses the modelling technique used and a description of the scale-model tests. Analytical modelling being done before running the full-scale tests is also described. (author)
Fuel exchanging machine for a nuclear ship
International Nuclear Information System (INIS)
Hayashi, Tetsuji.
1984-01-01
Purpose: To prevent atmospheric contaminations upon fuel exchange thereby keep the environmental circumstance clean in the periphery of the nuclear ship. Constitution: A nuclear reactor container is disposed to the inside of a containing vessel in the ship body and a shutter is mounted to the upper opening of the ship body. Further, a landing container having a bottom opening equipped with shutter for alingning the upper opening equipped with shuuter of the ship is elevatably suspended to the trolley of a crane by way of a wire rope and a winch, and a fuel exchange cask is elevatably disposed to the inside of the landing container. Further, airs in the inside of the container is adapted to be discharged externally through a filter by means of a blower and the inside is kept at a negative pressure. Thus, since the containing vessel is covered with the landing container upon fuel exchanging operation, atmospheric contamination can be prevented sufficiently. (Sekiya, K.)
Towards seasonal Arctic shipping route predictions
Haines, K.; Melia, N.; Hawkins, E.; Day, J. J.
2017-12-01
In our previous work [1] we showed how trans-Arctic shipping routes would become more available through the 21st century as sea ice declines, using CMIP5 models with means and stds calibrated to PIOMAS sea ice observations. Sea ice will continue to close shipping routes to open water vessels through the winter months for the foreseeable future so the availability of open sea routes will vary greatly from year to year. Here [2] we look at whether the trans-Arctic shipping season period can be predicted in seasonal forecasts, again using several climate models, and testing both perfect and imperfect knowledge of the initial sea ice conditions. We find skilful predictions of the upcoming summer shipping season can be made from as early as January, although typically forecasts may show lower skill before a May `predictability barrier'. Focussing on the northern sea route (NSR) off Siberia, the date of opening of this sea route is twice as variable as the closing date, and this carries through to reduced predictability at the start of the season. Under climate change the later freeze-up date accounts for 60% of the lengthening season, Fig1 We find that predictive skill is state dependent with predictions for high or low ice years exhibiting greater skill than for average ice years. Forecasting the exact timing of route open periods is harder (more weather dependent) under average ice conditions while in high and low ice years the season is more controlled by the initial ice conditions from spring onwards. This could be very useful information for companies planning vessel routing for the coming season. We tested this dependence on the initial ice conditions by changing the initial ice state towards climatologically average conditions and show directly that early summer sea-ice thickness information is crucial to obtain skilful forecasts of the coming shipping season. Mechanisms for this are discussed. This strongly suggests that good sea ice thickness observations
49 CFR 172.202 - Description of hazardous material on shipping papers.
2010-10-01
... papers. 172.202 Section 172.202 Transportation Other Regulations Relating to Transportation PIPELINE AND... INFORMATION, TRAINING REQUIREMENTS, AND SECURITY PLANS Shipping Papers § 172.202 Description of hazardous material on shipping papers. (a) The shipping description of a hazardous material on the shipping paper...
47 CFR 80.277 - Ship Security Alert System (SSAS).
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship Security Alert System (SSAS). 80.277... Security Alert System (SSAS). (a) Vessels equipped with a Ship Security Alert System pursuant to the Safety..., “RTCM Standard 11020.0—Ship Security Alert Systems (SSAS) using the Cospas-Sarsat System,” Version 1.0...
Swan Queen, shipping, and boundary regulation in fandom
Directory of Open Access Journals (Sweden)
Victoria M. Gonzalez
2016-09-01
Full Text Available There are a number of fan activities and practices that are subject to regulation. The mechanisms of regulation in shipping, however, are not always clear. Shipping, the fan activity of romantically pairing two fictional characters, has become a popular and contentious facet of fan interaction. The case that will be examined in this article is that of the Swan Queen ship, which pairs two female characters from Once Upon a Time (2011–. The lengths that fans have gone to support and promote this ship led to rather intense discussion and infighting among members of the Once Upon a Time fandom. I utilize comments and posts made on Tumblr to examine the mechanisms that dictate inclusion and exclusion in shipper communities. In doing so, I hope to identify the kinds of shipper activities that are subject to regulation and the kinds of boundaries that this regulation establishes. Shipping is dictated not only by fans' imaginations but also by boundaries that are performed and regulated on digital forums.
Decommissioning plan of the nuclear-powered ship 'Mutsu'
International Nuclear Information System (INIS)
1992-01-01
The nuclear-powered ship 'Mutsu' is to be decommissioned at Sekinehama Port immediately after finishing the experimental voyage based on the 'Fundamental plan on the research required for the development of nuclear ships in Japan Atomic Energy Research Institute' decided in March, 1985. The decommissioning plan which determines the methods of the works regarding the decommissioning and others is as follows. In order to utilize the ship hull of Mutsu, the reactor room including the reactor and shielding is removed in a lump, and the removal and isolation method of preserving it as it is on land is adopted. The measures for environment preservation and ensuring the safety of residents are taken, and the sufficient work control is carried out for preventing accidents and reducing the radiation exposure of workers. The ship is used as the ship with ordinary propulsion system for ocean research and the research and development of marine reactors. The utilization of Sekinehama and Ominato facilities is investigated. The reactor room removed from Mutsu is exhibited to public, being preserved safely in a building. (K.I.)
Prevention of Polluting Rivers and Lakes from Ships
Directory of Open Access Journals (Sweden)
Natalija Jolić
2005-09-01
Full Text Available Traffic on rivers and lakes in Europe has been ve1y well developed.The reason for this is the transport cost, relative speedand good connectivity of major European cities by rivers andcanals. In Croatia, this transport mode is lagging behind therest of Europe. Croatia is located at an interesting section of theriver transversal, but due to several reasons, river navigation inCroatia has not been developed to any major extent. As operatingriver ships the most frequent types are: towboats, pushboatsand self-propelled ships. The installed diesel engines, propulsionand auxiliary engines run at high power. Proportional tothe increase in the power of installed engines is also the increasein the volume of waste produced by the engines. Also, the olderthe engine, the greater volume of waste it produces. Ships mayalso cause pollution by wastewaters and garbage. This pollutionthreat grows with the greater number of people on boardand the age of the ship. In order to minimize these possibilitiesof pollution, it is necesswy to control all the time the properfunctioning of the ships, train the staff and construct receptionfacilities on land.
Ergonomical valorization of working spaces in multipurpose ships.
Seif, Mehdi; Degiuli, Nastija; Muftić, Osman
2003-06-01
In this work it is shown how anthropological data are among the most needed factors in ergonomical valorization of crew working spaces. Ship's working or living environment involves many unique human factors, which should be specially considered in our case as limitation of crew space. In this work we have chosen ships of different years of construction to prove this tendency. As a micro study, the work posture analysis using the pulling force experiment is performed in order to determine lumbar moment, intra-abdominal pressure as a measure of evaluating and comparing different crew work positions. As a macro-study, the "crew work posture analysis" was carried out by the use of the data collected from real cases. The most probable work postures in different spaces of a ship are classified and after some corrections of the work place the profile and its grade were determined. The "statistical analysis for real ship's spaces" is also performed, as well as another macro study, in order to show some real designed ship spaces from the point of view of the allocated volume.
The mechanics of ship impacts against bridges
DEFF Research Database (Denmark)
Pedersen, Preben Terndrup; Zhang, Shengming
1998-01-01
a glancing blow between the ship and the bridge structure. This model is based on rigid body mechanics and well suited for inclusion in a probabilistic analysis procedure. Finally, some empirical expressions are presented which relate the energy absorbed by crushing of ship structures to the maximum impact...
Underactuated ship tracking control : theory and experiments
Pettersen, K.Y.; Nijmeijer, H.
2001-01-01
We consider complete state tracking feedback control of a ship having two controls, namely surge force and yaw moment. The ship model has similarities with chained form systems but cannot directly be transformed in chained form. In particular, the model has a drift vector field as opposed to the
Investigation into the feasibility of alternative plutonium shipping forms
International Nuclear Information System (INIS)
Mishima, J.; Lindsey, C.G.
1983-06-01
Pacific Northwest Laboratory (PNL), operated for the Department of Energy by the Battelle Memorial Institute, is conducting a study for the Nuclear Regulatory Commission on the feasibility of altering current plutonium shipping forms to reduce or eliminate the airborne dispersibility of PuO 2 which might occur during a shipping accident. Plutonium used for fuel fabrication is currently shipped as a PuO 2 powder with a significant fraction in the respirable size range. If the high-strength container is breached due to stresses imposed during a transportation accident, the PuO 2 powder could be subject to airborne dispersion. The available information indicated that a potential accident involving fire accompanied by crush/impact forces would lead to failure of current surface shipping containers (no assumptions were made on the possibility of such a severe accident). Criteria were defined for an alternate shipping form to mitigate the effects of such an accident. Candidate techniques and materials were evaluated as alternate shipping forms by a task team consisting of personnel from PNL and Rockwell Hanford Operations (RHO). At this time, the most promising candidate for an alternate plutonium shipping form appears to be pressing PuO 2 into unsintered (green) pellets. These green pellets satisfy the criteria for a less dispersible form without requiring significant process changes. Discussions of all candidates considered are contained in a series of appendices. Recommendations for further investigations of the applicability of green pellets as an alternate shipping form are given, including the need for a cost-benefit study
Using waste heat of ship as energy source for an absorption refrigeration system
International Nuclear Information System (INIS)
Salmi, Waltteri; Vanttola, Juha; Elg, Mia; Kuosa, Maunu; Lahdelma, Risto
2017-01-01
Highlights: • A steady-state thermodynamic model is developed for absorption refrigeration in a ship. • Operation profile of B.Delta37 bulk carrier is used as an initial data. • Suitability of water-LiBr and ammonia-water working pairs were validated. • Coefficient of performance (COP) was studied in ISO and tropical conditions. • Estimated energy savings were 47 and 95 tons of fuel every year. - Abstract: This work presents a steady-state thermodynamic model for absorption refrigeration cycles with water-LiBr and ammonia-water working pairs for purpose of application on a ship. The coefficient of performance was studied with different generator and evaporator temperatures in ISO and tropical conditions. Absorption refrigeration systems were examined using exhaust gases, jacket water, and scavenge air as energy sources. Optimal generator temperatures for different refrigerant temperatures were found using different waste heat sources and for the absorption cycle itself. Critical temperature values (where the refrigeration power drops to zero) were defined. All of these values were used in order to evaluate the cooling power and energy production possibilities in a bulk carrier. The process data of exhaust gases and cooling water flows in two different climate conditions (ISO and tropical) and operation profiles of a B. Delta37 bulk carrier were used as initial data in the study. With the case ship data, a theoretical potential of saving of 70% of the electricity used in accommodation (AC use) compressor in ISO conditions and 61% in tropical conditions was recognized. Those estimates enable between 47 and 95 tons of annual fuel savings, respectively. Moreover, jacket water heat recovery with a water-LiBr system has the potential to provide 2.2–4.0 times more cooling power than required during sea-time operations in ISO conditions, depending on the main engine load.
Port entry of nuclear ships differences, procedures and conditions
International Nuclear Information System (INIS)
McMichael, D.; Bianchi, H.
1978-01-01
There are about 250 nuclear propelled ships, only 2 of them are merchant ships: the US freighter Savannah and the bulk carrier Otto Hahn of the Federal Republic of Germany. This paper is restricted to the experience with both of these ships, showing partly similar and partly different procedures for port entry. They have called at 107 ports in 40 countries. The Savannah was operated in the periods from 1962 - 1971 and the Otto Hahn is still in operation. The endeavours of the OECD and IMCO to review and to harmonize international rules for nuclear merchant ships should be supported and continued
47 CFR 80.79 - Inspection of ship station by a foreign Government.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Inspection of ship station by a foreign... Requirements-Ship Stations § 80.79 Inspection of ship station by a foreign Government. The Governments or appropriate administrations of countries which a ship visits may require the license of the ship station or...
Monitoring shipping emissions in the German Bight using MAX-DOAS measurements
Seyler, André; Wittrock, Folkard; Kattner, Lisa; Mathieu-Üffing, Barbara; Peters, Enno; Richter, Andreas; Schmolke, Stefan; Burrows, John P.
2017-04-01
Shipping is generally the most energy efficient transportation mode, but, at the same time, it accounts for four fifths of the worldwide total merchandise trade volume. As a result, shipping contributes a significant part to the emissions from the transportation sector. The majority of shipping emissions occurs within 400 km of land, impacting on air pollution in coastal areas and harbor towns. The North Sea has one of the highest ship densities in the world and the vast majority of ships heading for the port of Hamburg sail through the German Bight and into the river Elbe. A three-year time series of ground-based MAX-DOAS measurements of NO2 and SO2 on the island Neuwerk in the German Bight has been analyzed for contributions from shipping emissions. Measurements of individual ship plumes as well as of background pollution are possible from this location, which is 6-7 kilometers away from the main shipping lane towards the harbor of Hamburg. More than 2000 individual ship plumes have been identified in the data and analyzed for the emission ratio of SO2 to NO2, yielding an average ratio of 0.3 for the years 2013/2014. Contributions of ships and land-based sources to air pollution levels in the German Bight have been estimated, showing that despite the vicinity to the shipping lane, the contribution of shipping sources to air pollution is only about 40%. Since January 2015, much lower fuel sulfur content limits of 0.1% (before: 1.0%) apply in the North and Baltic Sea Emission Control Area (ECA). Comparing MAX-DOAS measurements from 2015/2016 (new regulation) to 2013/2014 (old regulation), a large reduction in SO2/NO2 ratios in shipping emissions and a significant reduction (by a factor of eight) in ambient coastal SO2 levels have been observed. In addition to that, selected shipping emission measurements from other measurement sites and campaigns are presented. This study is part of the project MeSMarT (Measurements of Shipping emissions in the Marine Troposphere
Structural analysis of a ship on global aspect using ANSYS
Rahman, M. Muzibur; Kamol, Rajia Sultana; Islam, Reyana
2017-12-01
Ship is a complex geometry which undergoes a combination of loadings such as hydrostatic, hydrodynamic, wind, wave etc. at sea and thus adequate strength in a ship has always been one of the most challenging tasks for the ship designers. International Maritime Organization (IMO) and classification societies are providing the standards to ensure the adequacy of strength for the ship against all demands throughout its service life. Thus, structural analysis is needed to assess the overall strength of hull, and the means in this regard are based on finite element method which may be applied either local or global aspect of the ship. This paper is an attempt to carry out the structural analysis of a ship in global aspect using ANSYS software to locate the most stress concentration and deformed area, which will have ultimate effect on fatigue fracture.
Virtual Ship Architecture Description Document Issue 1.00
National Research Council Canada - National Science Library
Best, John
2000-01-01
The Virtual Ship concept calls for simulation models of systems to be brought together to create a virtual representation of a warship, in a process analogous to the construction of a physical ship...
Size-resolved particle emission factors for individual ships
Jonsson, Åsa M.; Westerlund, Jonathan; Hallquist, Mattias
2011-07-01
In these experiments size-resolved emission factors for particle number (EFPN) and mass (EFPM) have been determined for 734 individual ship passages for real-world dilution. The method used is an extractive sampling method of the passing ship plumes where particle number/mass and CO2 were measured with high time resolution (1 Hz). The measurements were conducted on a small island located in the entrance to the port of Gothenburg (N57.6849, E11.838), the largest harbor in Scandinavia. This is an emission control area (ECA) and in close vicinity to populated areas. The average EFPN and EFPM were 2.55 ± 0.11 × 1016 (kg fuel)-1 and 2050 ± 110 mg (kg fuel)-1, respectively. The determined EF for ships with multiple passages showed a great reproducibility. Size-resolved EFPN were peaking at small particle sizes ˜35 nm. Smaller particle sizes and hence less mass were observed by a gas turbine equipped ship compared to diesel engine equipped ships. On average 36 to 46% of the emitted particles by number were non-volatile and 24% by mass (EFPN 1.16 ± 0.19 × 1016 [kg fuel]-1 and EFPM 488 ± 73 mg [kg fuel]-1, respectively). This study shows a great potential to gain large data-sets regarding ship emission determining parameters that can improve current dispersion modeling for health assessments on local and regional scales. The global contributions of total and non-volatile particle mass from shipping using this extensive data-set from an ECA were estimated to be at least 0.80 Tgy-1 and 0.19 Tgy-1.
Computerized waste-accountability shipping and packaging system
International Nuclear Information System (INIS)
Jackson, J.A.; Baston, M. Jr.; DeVer, E.A.
1981-01-01
The Waste Accountability, Shipping and Packaging System (WASP) is a real-time computerized system designed and implemented by Mound Facility to meet the stringent packaging and reporting requirements of radioactive waste being shipped to burial sites. The system stores packaging data and inspection results for each unit and prepares all necessary documents at the time of shipment. Shipping data specific for each burial site are automatically prepared on magnetic tape for transmission to the computing center at that site. WASP has enabled Mound Facility to effectively meet the requirements of the burial sites, diminishing the possibility of being rejected from a site because of noncompliance
Impact of future Arctic shipping on high-latitude black carbon deposition (Invited)
Corbett, J. J.; Browse, J.; Carslaw, K. S.; Schmidt, A.
2013-12-01
The retreat of Arctic sea-ice has led to renewed calls to exploit Arctic shipping routes. The diversion of ship traffic through the Arctic will shorten shipping routes and possibly reduce global shipping emissions. However, deposition of black carbon (BC) aerosol emitted by additional Arctic ships could cause a reduction in the albedo of snow and ice, accelerating snow-melt and sea-ice loss. We use recently compiled Arctic shipping emission inventories for 2004 and 2050 together with a global aerosol microphysics model GLOMAP coupled to the chemical transport model TOMCAT to quantify the contribution of future Arctic shipping to high-latitude BC deposition. Emission rates of SOx (SO2 and SO4) and particulate matter (PM) were estimated for 2050 under both business-as-usual and high-growth scenarios. BC particles are assumed to be water-insoluble at emission but can become active in cloud drop formation through soluble material accumulation. After BC particles become cloud-active they are more efficiently wet scavenged, which accounts for 80% of modeled BC deposition. Current-day Arctic shipping contributes 0.3% to the BC mass deposited north of 60N (250 Gg). About 50% of modelled BC deposition is on open ocean, suggesting that current Arctic ship traffic may not significantly contribute to BC deposition on central Arctic sea ice. However, 6 - 8% of deposited BC on the west coast of Greenland originates from local ship traffic. Moreover, in-Arctic shipping contributes some 32% to high-latitude ship-sourced deposition despite accounting for less than 1.0% of global shipping emissions. This suggests that control of in-Arctic shipping BC emissions could yield greater decrease in high-latitude BC deposition than a similar control strategy applied only to the extra-Arctic shipping industry. Arctic shipping in 2050 will contribute less than 1% to the total BC deposition north of 60N due to the much greater relative contribution of BC transported from non-shipping sources
Development of ship structure health monitoring system based on IOT technology
Yang, Sujun; Shi, Lei; Chen, Demin; Dong, Yuqing; Hu, Zhenyi
2017-06-01
It is very important to monitor the ship structure, because ships are affected by all kinds of wind wave and current environment factor. At the same time, internet of things (IOT) technology plays more and more important role of in the development of industrial process. In the paper, real-time online monitoring of the ship can be realized by means of IOT technology. Ship stress, vibration and dynamic parameters are measured. Meanwhile, data is transmitted to remote monitoring system through intelligent data gateway. Timely remote support can be realized for dangerous stage of ship. Safe navigation of ships is guaranteed through application of the system.
Energy Technology Data Exchange (ETDEWEB)
Inoue, Shoichiro [Japan Atomic Energy Research Inst., Tokyo (Japan)
1996-02-01
The nuclear-powered ship `Mutsu` was launched in June, 1969, and used Ominato, Aomori Prefecture, as its home port. The initial criticality of the reactor was attained in August, 1974. However, radiation leak occurred, and the repair of shielding and the general safety checkup were carried out in Sasebo since 1980. The ship moved to the new home port Sekinehama in 1988, and after the trial, it received the certificate of inspection from Science and Technology Agency and Ministry of Transport. Thus `Mutsu` was completed as the nuclear-powered ship. The experimental voyage was begun in February, 1991, and finished in January, 1992. The reconstruction works are in progress to change `Mutsu` to a large ocean observation and research ship. The course of the research and development, the reactor power raising test and the sea trial, the experimental voyage and the results attained by `Mutsu` are reported. One of the important items is the training of the crew who operate nuclear-powered ships and nuclear reactors, and about 400 seamen took part in the operation of `Mutsu`. (K.I.).
Energy Technology Data Exchange (ETDEWEB)
Nakata, Y.; Otsuka, M.; Ozawa, H.; Konosu, M. [Mitsui Engineering and Shipbuilding Co. Ltd., Tokyo (Japan)
1997-08-01
A compact and lightweight underwater RTV robot (RTV-SHIP) that enables the remote sensing in the double-shell structure of a tanker and the six-freedom motion control was developed based on the technology of the conventional portable underwater robot. The motion performance test in a water tank showed that the RTV-SHIP can freely access the manhole in the double-shell structure of a tanker and completely satisfies the thrust and swing force required for movement and measurement in a tank. The in-tank function confirmation test also shows that the main measurement items such as positioning in the tank, large deflection of panels, and plate thickness have a satisfactory measurement accuracy and that the RTV-SHIP has the same tone discrimination function as for a visual check. The method of inputting the tank shape during measurement and miniaturizing the recording unit should be improved until the RTV-SHIP is put to practical use. This system can be widely used by improving the above points according to the result of a future measurement test for the actual ships. 1 ref., 9 figs.
International Nuclear Information System (INIS)
Inoue, Shoichiro
1996-01-01
The nuclear-powered ship 'Mutsu' was launched in June, 1969, and used Ominato, Aomori Prefecture, as its home port. The initial criticality of the reactor was attained in August, 1974. However, radiation leak occurred, and the repair of shielding and the general safety checkup were carried out in Sasebo since 1980. The ship moved to the new home port Sekinehama in 1988, and after the trial, it received the certificate of inspection from Science and Technology Agency and Ministry of Transport. Thus 'Mutsu' was completed as the nuclear-powered ship. The experimental voyage was begun in February, 1991, and finished in January, 1992. The reconstruction works are in progress to change 'Mutsu' to a large ocean observation and research ship. The course of the research and development, the reactor power raising test and the sea trial, the experimental voyage and the results attained by 'Mutsu' are reported. One of the important items is the training of the crew who operate nuclear-powered ships and nuclear reactors, and about 400 seamen took part in the operation of 'Mutsu'. (K.I.)
E-navigation Services for Non-SOLAS Ships
Directory of Open Access Journals (Sweden)
Kwang An
2016-06-01
Full Text Available It is clearly understood that the main benefits of e-navigation are improved safety and better protection of the environment through the promotion of standards of navigational system and a reduction in human error. In order to meet the expectations on the benefit of e-navigation, e-navigation services should be more focused on non-SOLAS ships. The purpose of this paper is to present necessary e-navigation services for non-SOLAS ships in order to prevent marine accidents in Korean coastal waters. To meet the objectives of the study, an examination on the present navigation and communication system for non-SOLAS ships was performed. Based on the IMO's e-navigation Strategy Implementation Plan (SIP and Korea's national SIP for e-navigation, future trends for the development and implementation of e-navigation were discussed. Consequently, Electronic Navigational Chart (ENC download and ENC up-date service, ENC streaming service, route support service and communication support service based on Maritime Cloud were presented as essential e-navigation services for non-SOLAS ships. This study will help for the planning and designing of the Korean e-navigation system. It is expected that the further researches on the navigation support systems based on e-navigation will be carried out in order to implement the essential e-navigation services for non-SOLAS ships.
Methanol plant ship: implementation study. Export trade information
International Nuclear Information System (INIS)
1988-01-01
The study compiled the economic, commercial and financing requirements of a floating plant ship with a production capacity of 3,000 tons of methanol a day. The raw material for the methanol production would be supplied from a natural gas reserve off the coast of Trinidad. The report has a separate section for each aspect of the plant ship project, such as methanol storage; logistics of transporting methanol to the United States; the required sub-sea installation to bring natural gas to the plant ship; and plant ship design and equipment. It gives a detailed description of a proposed organizational structure and its tax consequences. The project's financial requirements and economic impact are examined. The environmental consequences and other operator issues are analyzed. Tables and figures accompany the report
Using Face Recognition System in Ship Protection Process
Directory of Open Access Journals (Sweden)
Miroslav Bača
2006-03-01
Full Text Available The process of security improvement is a huge problem especiallyin large ships. Terrorist attacks and everyday threatsagainst life and property destroy transport and tourist companies,especially large tourist ships. Every person on a ship can berecognized and identified using something that the personknows or by means of something the person possesses. The bestresults will be obtained by using a combination of the person'sknowledge with one biometric characteristic. Analyzing theproblem of biometrics in ITS security we can conclude that facerecognition process supported by one or two traditional biometriccharacteristics can give very good results regarding ship security.In this paper we will describe a biometric system basedon face recognition. Special focus will be given to crew member'sbiometric security in crisis situation like kidnapping, robbelyor illness.
Applicabilities of ship emission reduction methods
Energy Technology Data Exchange (ETDEWEB)
Guleryuz, Adem [ARGEMAN Research Group, Marine Division (Turkey)], email: ademg@argeman.org; Kilic, Alper [Istanbul Technical University, Maritime Faculty, Marine Engineering Department (Turkey)], email: enviromarineacademic@yahoo.com
2011-07-01
Ships, with their high consumption of fossil fuels to power their engines, are significant air polluters. Emission reduction methods therefore need to be implemented and the aim of this paper is to assess the advantages and disadvantages of each emissions reduction method. Benefits of the different methods are compared, with their disadvantages and requirements, to determine the applicability of such solutions. The methods studied herein are direct water injection, humid air motor, sea water scrubbing, diesel particulate filter, selected catalytic reduction, design of engine components, exhaust gas recirculation and engine replacement. Results of the study showed that the usefulness of each emissions reduction method depends on the particular case and that an evaluation should be carried out for each ship. This study pointed out that methods to reduce ship emissions are available but that their applicability depends on each case.
International Nuclear Information System (INIS)
Deadrick, F.J.; Cabayan, H.S.; Kunz, K.F.; Bevensee, R.M.; Martin, L.C.; Egbert, R.W.
1980-01-01
Scale-model tests were conducted to establish the adequacy and limitations of model measurements as tools for predicting electromagnetic pulse (EMP) coupling voltages and currents to the critical antennas, cables, and metallic structures on ships. The scale-model predictions are compared with the results of the full-scale EMP simulation test of the Canadian ASW ship, HMCS Huron. (The EMP coupling predictions in this report were made without prior knowledge of the results of the data from the HMCS Huron tests.) This report establishes that the scale-model tests in conjunction with the data base from EMP coupling modules provides the necessary information for source model development and permits effective, low-cost study of particular system configurations. 184 figures, 9 tables
Optimal ship forms for minimum total resistance in shallow water
Zhao, Lian-en
1984-01-01
Optimal ship forms for minimum total resistance in shallow water Optimal ship forms for minimum total resistance in shallow water: An attempt is made to obtain shallow-water optimal ship forms for total resistance by means of "tent" function representation under the constraints that the main dimensions of the ship and the water-line area were kept constant. The objective function in the quadratic programming is the sum of wave-making resistance calculated by Sretenski's formula and viscou...
46 CFR 153.976 - Transfer of packaged cargo or ship's stores.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Transfer of packaged cargo or ship's stores. 153.976 Section 153.976 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SHIPS CARRYING BULK LIQUID, LIQUEFIED GAS, OR COMPRESSED GAS HAZARDOUS MATERIALS Operations Cargo Transfer Procedures § 153.976 Transfer of...
Ships as future floating farm systems?
Moustafa, Khaled
2018-04-03
Environmental and agriculture challenges such as severe drought, desertification, sprawling cities and shrinking arable lands in large regions in the world compel us to think about alternative and sustainable farming systems. Ongoing projects to build floating cities in the sea suggest that building specific ships for farming purposes (as farming ships or farming boats) would also be attainable to introduce new farming surfaces and boost food production worldwide to cope with food insecurity issues.
Sooväli-Sepping, Helen, 1974-
2016-01-01
TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik
Analysis of SHIP1 expression and activity in Crohn's disease patients.
Directory of Open Access Journals (Sweden)
Rajesh Somasundaram
Full Text Available SH2 domain containing inositol-5-phosphatase (SHIP1 is an important modulator of innate and adaptive immunity. In mice, loss of SHIP1 provokes severe ileitis resembling Crohn's disease (CD, as a result of deregulated immune responses, altered cytokine production and intestinal fibrosis. Recently, SHIP1 activity was shown to be correlated to the presence of a CD-associated single nucleotide polymorphism in ATG16L1. Here, we studied SHIP1 activity and expression in an adult cohort of CD patients.SHIP1 activity, protein and mRNA expression in peripheral blood mononuclear cells from CD patients in clinical remission were determined by Malachite green assay, Western blotting and qRT-PCR respectively. Genomic DNA was genotyped for ATG16L1 rs2241880.SHIP1 protein levels are profoundly diminished in a subset of patients; however, SHIP1 activity and expression are not correlated to ATG16L1 SNP status in this adult cohort.Aberrant SHIP1 activity can contribute to disease in a subset of adult CD patients, and warrants further investigation.
Zhang, Xueying; Craft, Elena; Zhang, Kai
2017-07-01
Mobile emissions are a major source of urban air pollution and have been associated with a variety of adverse health outcomes. The Houston Ship Channel area is the home of a large number of diesel-powered vehicles emitting fine particulate matter (PM2.5; ≤2.5 μm in aerodynamic diameter) and nitrogen oxides (NOx). However, the spatial variability of traffic-related air pollutants in the Houston Ship Channel area has rarely been investigated. The objective of this study is to characterize spatial variability of PM2.5 and NOx concentrations attributable to on-road traffic in the Houston Ship Channel area in the year of 2011. We extracted the road network from the Texas Department of Transportation Road Inventory, and calculated emission rates using the Motor Vehicle Emission Simulator version 2014a (MOVES2014a). These parameters and preprocessed meteorological parameters were entered into a Research LINE-source Dispersion Model (RLINE) to conduct a simulation. Receptors were placed at 50 m resolution within 300 m to major roads and at 150 m resolution in the rest of the area. Our findings include that traffic-related PM2.5 were mainly emitted from trucks, while traffic-related NOx were emitted from both trucks and cars. The traffic contributed 0.90 μg/m3 PM2.5 and 29.23 μg/m3 NOx to the annual average mass concentrations of on-road air pollution, and the concentrations of the two pollutants decreased by nearly 40% within 500 m distance to major roads. The pollution level of traffic-related PM2.5 and NOx was higher in winter than those in the other three seasons. The Houston Ship Channel has earlier morning peak hours and relative late afternoon hours, which indicates the influence of goods movement from port activity. The varied near-road gradients illustrate that proximities to major roads are not an accurate surrogate of traffic-related air pollution.
Expected Enhancement of the Ship Monitoring and Control System
Directory of Open Access Journals (Sweden)
Vinko Tomas
2012-10-01
Full Text Available The intemational legislation places strict requirements onthe safety of navigation and the marine environment. One ofthe solutions to the problem is to enhance the ship navigationcontrol and maintenance with extensive use of informationtechnology, which has largely contributed to the growth of communicationtechnology. On the basis of an analysis of ship systemsautomation in the past, this paper deals with the developmentsand improvements to be expected ill the near future.Four generations of shipboard automation are presented, includingthe characteristics and requirements that the automationof ship control and monitming systems must fulflll in orderto be classified under a particular generation. Fields of furtherenhancement are considered as these will be decisive in increasingthe efficiency of business operations and ship safety.For the pwpose of supporting the claims above, actual trends inthe development of standards, equipment and systems havebeen analysed as well as their impact Oil the ship owner and thecrew.
The Bøle ship, Skien, Norway - Research history, dendrochronology and provenance
DEFF Research Database (Denmark)
Daly, Aoife; Nymoen, Pål
2008-01-01
The wreck-site at Bøle near Skien was first reported in 1950 during dredging in the river. The Bøle ship is one of the most significant medieval ship-finds in Norway, and the manner of its discovery is referred to as a tragedy in ship archaeology. New investigations at the site in 2004–2006 revea......The wreck-site at Bøle near Skien was first reported in 1950 during dredging in the river. The Bøle ship is one of the most significant medieval ship-finds in Norway, and the manner of its discovery is referred to as a tragedy in ship archaeology. New investigations at the site in 2004...
Revision of the basic plans of the first nuclear-powered ship development
International Nuclear Information System (INIS)
1978-01-01
Along with the law for Japan Nuclear Ship Development Agency, the basic plans of development of the first nuclear-powered ship have been revised. After explaining the basic policy concerning the matter, the development program is described as follows: ship type/kind, nuclear power plant, construction, training of ship crew, experimental voyage, compilation of the development results, and works after the experimental voyage. The first nuclear-powered ship of about 8,000 tons gross tonnage, 10,000 horsepower main engine output, and about 16 knots, sea speed will be the ship for special cargo transport and crew training. A pressurized water reactor is used for the power plant. Following the repair of shielding and the overall inspection of safety, the ship is to be completed as early as possible. After completion of the ship, its experimental voyage will be carried out, aiming at the aspects of operational familiarization, ship performance, reliability, port call experience, etc. (Mori, K
Technical and management considerations in conducting type B shipping container tests
International Nuclear Information System (INIS)
Whitney, M.A.; Leader, D.R.; Phipps, D.P.
1994-01-01
The Code of Federal Regulations (CFR) mandate that type B shipping containers are capable of surviving specific drop tests. One approach for demonstrating compliance to the CFRs is to drop test a shipping container. This paper will discuss the technical and management considerations in conducting such drop tests on the 9975 family of shipping containers. For both technical and management considerations this paper will comment on loading the shipping container, dropping the shopping container, and examination of the shipping container after the drop tests
29 CFR 1918.87 - Ship's cargo elevators.
2010-07-01
... 29 Labor 7 2010-07-01 2010-07-01 false Ship's cargo elevators. 1918.87 Section 1918.87 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR LONGSHORING Handling Cargo § 1918.87 Ship's cargo elevators. (a) Safe working load. The safe workin...
Expert judgements in performance assessments. Report of an SKI/SSI seminar
International Nuclear Information System (INIS)
Wilmot, R.D.; Galson, D.A.; Hora, S.C.
2000-09-01
Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to
Expert judgements in performance assessments. Report of an SKI/SSI seminar
Energy Technology Data Exchange (ETDEWEB)
Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)
2000-09-01
Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session
Wind Forces on Container Ships
DEFF Research Database (Denmark)
Andersen, Ingrid Marie Vincent
2012-01-01
An investigation of the wind forces acting on a 9,000+ TEU container ship has been carried out through a series of wind tunnel tests. It was investigated how the wind forces depend on the container configuration on the deck using a 1:450 scale model and a series of appropriate container...... are presented as nondimensional coefficients. It is concluded, that the measured forces and moment depend on the container configuration on deck, and the results may provide a general idea of how the magnitude of the wind forces is affected by a given container stacking configuration on a similar container ship....
Flooding and sinking of nuclear merchant ships
International Nuclear Information System (INIS)
Lettnin, H.K.J.; Wehowsky, P.
1978-01-01
In contrast to land-based power plants for ship reactors the marine environment brings up the peril of sinking. But this peril is low for nuclear ships with its high safety standard. An evaluation of casualties from 1964 - 1974 for ships>8000 GRT allows to estimate a very low sink probability for nuclear ships in the range of 10 -7 to 10 -8 p.a. In spite of this low probability a sinking cannot be excluded absolutely. Therefore passive means must be provided for sinking in deep waters: to maintain the integrity of at least one enclosure as activity barrier; to supply seawater into the safety containment for decay heat removal. For sinking in shallow waters and flooding at least one of the redundant decay heat removal systems including power supply stays operable. A mathematical tool is available for the design of flood openings of sufficient cross sections to flood the containment and to reach a pressure balance in case of postulated sinking in deep waters of any depth
Trace of the nuclear powered ship 'Mutsu'
International Nuclear Information System (INIS)
1992-01-01
The development of the nuclear powered ship 'Mutsu' required the long period of about 30 years from 1963 to 1992. When this period is looked back, it is roughly divided into the period from the initial planning to the construction, the period of the power increase test and the occurrence of radiation leak, the period of the repair of shielding and the general safety checkup as the countermeasures, the period of the checkup and maintenance based on the new research plan, the period of the power increase test and the sea trial, and the period of the experimental voyage after the completion. The course of the development of the nuclear powered ship 'Mutsu' is shown. The design of Mutsu, the incidental land facilities for Mutsu, the power increase test and the experimental voyage of Mutsu, the law system for nuclear powered ships, the research and development of an improved marine nuclear reactor and the development of nuclear powered ships in the world are reported. Nuclear powered warships are operated in USA, USSR, UK, France and China. (K.I.)
PARTICIPATION BASED MODEL OF SHIP CREW MANAGEMENT
Directory of Open Access Journals (Sweden)
Toni Bielić
2014-10-01
Full Text Available 800x600 This paper analyse the participation - based model on board the ship as possibly optimal leadership model existing in the shipping industry with accent on decision - making process. In the paper authors have tried to define master’s behaviour model and management style identifying drawbacks and disadvantages of vertical, pyramidal organization with master on the top. Paper describes efficiency of decision making within team organization and optimization of a ship’s organisation by introducing teamwork on board the ship. Three examples of the ship’s accidents are studied and evaluated through “Leader - participation” model. The model of participation based management as a model of the teamwork has been applied in studying the cause - and - effect of accidents with the critical review of the communication and managing the human resources on a ship. The results have showed that the cause of all three accidents is the autocratic behaviour of the leaders and lack of communication within teams. Normal 0 21 false false false HR X-NONE X-NONE MicrosoftInternetExplorer4
Ship propulsion reactors technology
International Nuclear Information System (INIS)
Fribourg, Ch.
2002-01-01
This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)
Directory of Open Access Journals (Sweden)
P. Pisoft
2010-07-01
Full Text Available In general, regional and global chemistry transport models apply instantaneous mixing of emissions into the model's finest resolved scale. In case of a concentrated source, this could result in erroneous calculation of the evolution of both primary and secondary chemical species. Several studies discussed this issue in connection with emissions from ships and aircraft. In this study, we present an approach to deal with the non-linear effects during dispersion of NOx emissions from ships. It represents an adaptation of the original approach developed for aircraft NOx emissions, which uses an exhaust tracer to trace the amount of the emitted species in the plume and applies an effective reaction rate for the ozone production/destruction during the plume's dilution into the background air. In accordance with previous studies examining the impact of international shipping on the composition of the troposphere, we found that the contribution of ship induced surface NOx to the total reaches 90% over remote ocean and makes 10–30% near coastal regions. Due to ship emissions, surface ozone increases by up to 4–6 ppbv making 10% contribution to the surface ozone budget. When applying the ship plume parameterization, we show that the large scale NOx decreases and the ship NOx contribution is reduced by up to 20–25%. A similar decrease was found in the case of O3. The plume parameterization suppressed the ship induced ozone production by 15–30% over large areas of the studied region. To evaluate the presented parameterization, nitrogen monoxide measurements over the English Channel were compared with modeled values and it was found that after activating the parameterization the model accuracy increases.
Directory of Open Access Journals (Sweden)
Arsham Mazaheri
2013-03-01
Full Text Available Ship traffic is one of the factors that is presented in almost all of the existing grounding models, and is considered as one of the affecting factors on the likelihood of grounding accident. This effect in grounding accident is mostly accepted by the experts as a common sense or simply by just generalizing the ship-ship collision cases to grounding accidents. There is no available research on the actual causal link between the ship traffic and grounding accident in the literature. In this paper, authors have utilized the statistical analysis on historical grounding accident data in the Gulf of Finland between the years 1989 and 2010 and the AIS data of the same area in year 2010, as the source of ship traffic data, to investigate the possible existence of any correlation between the ship traffic and the grounding accident. The results show that for the studied area (Gulf of Finland there is no correlation between the traffic density and the grounding accident. However, the possibility of the existence of minor relation between the traffic distribution and grounding accident is shown by the result. This finding, however, needs further investigation for more clarification.
State of the Japanese nuclear research ship MUTSU
International Nuclear Information System (INIS)
Lettnin, H.
1981-01-01
A short introductary comment of the German-Japanese cooperation on the field of nuclear ship propulsion is given, which since several years had led to the development of a nuclear propelled containership with 80 000 shp. Against this background the cooperation with the Japanese was renewed for checking the shield modification of NS MUTSU by GKSS. Before the modification of the shielding is dealt with in more detail the design concept of ship and reactor plant of the vessel is presented. The observed defects as well as the rebuilding concept of the changed shielding incl. the shielding calculations. The constructive modifications have led to reconsiderations of safety aspects for ship and reactor. Finally a short description of the repair site in Sasebo is given and an outlook on the nuclear ship development in Japan. (orig.) [de
Unknown
2003-01-01
Showing two sailors having their hair cut (? one is possibly being shaved) on board ship. Three other sailors can be seen standing on the right-hand side of the photograph. The photograph is from an album inscribed 'H.M.S. Lancaster; Mediterranean Photographic Album: Diary of Events and Important Places Visited during the Commission 1910-1912' on the cover. This album was the property of Sydney Harold Liddle.
A quantitative assessment of Arctic shipping in 2010–2014
Eguíluz, Victor M.
2016-08-01
Rapid loss of sea ice is opening up the Arctic Ocean to shipping, a practice that is forecasted to increase rapidly by 2050 when many models predict that the Arctic Ocean will largely be free of ice toward the end of summer. These forecasts carry considerable uncertainty because Arctic shipping was previously considered too sparse to allow for adequate validation. Here, we provide quantitative evidence that the extent of Arctic shipping in the period 2011–2014 is already significant and that it is concentrated (i) in the Norwegian and Barents Seas, and (ii) predominantly accessed via the Northeast and Northwest Passages. Thick ice along the forecasted direct trans-Arctic route was still present in 2014, preventing transit. Although Arctic shipping remains constrained by the extent of ice coverage, during every September, this coverage is at a minimum, allowing the highest levels of shipping activity. Access to Arctic resources, particularly fisheries, is the most important driver of Arctic shipping thus far.
SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results
Directory of Open Access Journals (Sweden)
Francesca Ceroni
2014-11-01
Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.
Legionella risk assessment in cruise ships and ferries
Directory of Open Access Journals (Sweden)
Pasqualina Laganà
2017-06-01
Legionella pneumophila sg 1 was isolated from the samples of shower and tap water in 7 (70% of the 10 ferries examined, and in 3 (33% of the 6 cruise ships examined, and L. pneumophila sg 2–14 in 8 (80% and 1 (16.7% of these ships, respectively. No Legionella contamination was found in whirlpool baths, air and ice samples. In conclusion, the data obtained confirm higher levels of Legionella contamination in local ferries and cruise ships, underlining the need to adopt corrective actions more specific for these smaller vessels.
It's safety first on N-fuel carrier ship
International Nuclear Information System (INIS)
Anon.
1983-01-01
The 3 000t deadweight ship to carry irradiated nuclear fuel ordered recently from Appledore Shipbuilders will be one of the most sophisticated ships built at the firm's modern and totally-enclosed north Devon yard. The ship will be used to carry irradiated nuclear fuel from Japan to be reprocessed at British Nuclear Fuels site at Sellafield and at the Cogema plant in northern France. It has been designed to conform to the most exacting requirements of Pacific Nuclear Transport and will incorporate every safeguard for the shipment of irradiated nuclear fuels
Wave-induced Hydroelastic response of fast monohull ships
DEFF Research Database (Denmark)
Jensen, Jørgen Juncher
1996-01-01
High-speed ships are weight sensitive structures and high strength steel, aluminium or composites are preferred building materials. it is characteristic for these materials that they result in larger hull flexibility than more conventional materials. Therefore, for large fast ships the lowest...... of a quadratic strip theory formulated in the frequency domain. The springing response is thereby excited partly be resonance and partly by non-linear excitation. Special emphasis is given to the influence of springing on fatigue damage as the extreme responses even for very flexible ships are quite insensitive...
Directory of Open Access Journals (Sweden)
J.-P. Jalkanen
2012-03-01
Full Text Available A method is presented for the evaluation of the exhaust emissions of marine traffic, based on the messages provided by the Automatic Identification System (AIS, which enable the positioning of ship emissions with a high spatial resolution (typically a few tens of metres. The model also takes into account the detailed technical data of each individual vessel. The previously developed model was applicable for evaluating the emissions of NOx, SOx and CO2. This paper addresses a substantial extension of the modelling system, to allow also for the mass-based emissions of particulate matter (PM and carbon monoxide (CO. The presented Ship Traffic Emissions Assessment Model (STEAM2 allows for the influences of accurate travel routes and ship speed, engine load, fuel sulphur content, multiengine setups, abatement methods and waves. We address in particular the modeling of the influence on the emissions of both engine load and the sulphur content of the fuel. The presented methodology can be used to evaluate the total PM emissions, and those of organic carbon, elemental carbon, ash and hydrated sulphate. We have evaluated the performance of the extended model against available experimental data on engine power, fuel consumption and the composition-resolved emissions of PM. We have also compared the annually averaged emission values with those of the corresponding EMEP inventory, As example results, the geographical distributions of the emissions of PM and CO are presented for the marine regions of the Baltic Sea surrounding the Danish Straits.
Detecting potential ship objects from satellite pictures
International Nuclear Information System (INIS)
Luo, B.; Yang, C.C.; Chang, S.K.; Yang, M.C.K.
1984-01-01
Heuristic techniques are presented to detect potential ship objects from satellite pictures. These techniques utilize some noise structures of the pixel gray levels, and certain inherent features of a ship in a satellite picture. The scheme has been implemented and successfully tested on SEASAT satellite pictures. A general approach for database-oriented object detection is also suggested
2012-04-18
...The Coast Guard will enforce Special Local Regulations for the Smoking the Sound boat races in the Biloxi Ship Channel, Biloxi, MS from 8 a.m. until 6 p.m. on April 28 and April 29, 2012. This action is necessary for the safeguard of participants and spectators, including all crews, vessels, and persons on navigable waters during the Smoking the Sound boat races. During the enforcement period, entry into, transiting or anchoring in the regulated area is prohibited to all vessels not registered with the sponsor as participants or official patrol vessels, unless specifically authorized by the Captain of the Port (COTP) Mobile or the designated Coast Guard Patrol Commander.
International Nuclear Information System (INIS)
Toomer, D.V.
1991-06-01
This document identifies the inspection, testing and operating requirements for the packaging, loading, and shipping of uranium trioxide (UO 3 ) in 55-gallon DOT Specification 6M shipping packagings from the Idaho Chemical Processing Plant (ICPP). Compliance with this document assures established controls for the purchasing, packaging, loading, and shipping of DOT Specification 6M shipping packagings are maintained in strict accordance with applicable Code of Federal Regulations (CFRs) and Department of Energy (DOE) Orders. 7 refs., 3 figs., 1 tab
MODEL PENDANAAN ARMADA KAPAL NASIONAL FUNDING MODEL of NATIONAL SHIP ARMADA
Directory of Open Access Journals (Sweden)
Mohd Ridwan
2012-02-01
Full Text Available Domination of Foreign ship armada in trading activity of exsport/import and interisland in Indonesia,couse deficit state 99 trilium rupiah per year. The national shipping armada can not serve sea transportto support commercial activity. They have not provides enough ship armada capacity for tradingcommodity, and dosent enaugh funding development of new ship armada, so that national armada freightcapacity always downwards along increasingly ship age. Economic from transportation sector of seawhich capital intensive, labour intensive and high tech, requires a policy of government which insubvention with funding especially from banking sector and finance companies non bank. It is requiredmodel or funding pattern which to support the sector, expected later national ship armada can transportall commerce commodity of exsport/import and interisland in country
The Two Regimes of Postwar Shipping
DEFF Research Database (Denmark)
Iversen, Martin Jes; Tenold, Stig
2014-01-01
the bargaining that accompanied the shift from the national regime to the competitive regime. Specifically, we show that the new regime primarily accommodated the interests of private actors such as shipping companies, rather than the interests of the authorities and the trade unions.......The aim of this article is to illustrate the most important changes in the regulatory framework of the shipping sector from the 1960s to 2010, and to analyse the basis for, and effects of, these changes. In order to explain how the transformation has occurred, we use two traditional maritime...... nations—Denmark and Norway—as case studies. First, we introduce the two regimes of Danish and Norwegian shipping: ‘the national regime’ from the early 1960s to the mid-1970s; and ‘the competitive regime’, which was fully established by the middle of the 1990s and still persists. Then, we briefly sketch...
THE EFFECT OF VESSEL SUPPLY ON SHIP-DEMOLITION PRICES
Directory of Open Access Journals (Sweden)
Nikos Kagkarakis
2017-02-01
Full Text Available The ship-demolition is one of the four main markets that form the shipping industry and plays an important role on the seaborne trade, as it mitigates imbalances between supply and demand for transportation services by adjusting the merchant fleet supply. The aim of this study is to examine whether the factors that determine the supply of vessels for demolition are capable of affecting materially the ship-demolition price formation. The availability of ships for demolition is primarily a function of the fleet’s age and the conditions on the freight and secondhand markets. The analysis is conducted on the crude tanker and the bulk carrier segments and the vector autoregressive model methodology is employed, whereby the effect of both the supply and the demand factors on the ship-demolition prices is examined. The results indicate that the supply side has limited effect on the price formation in the industry, which is driven by the demand for the steel-scrap commodity.
Wastewater Pollution from Cruise Ships in the Adriatic Sea
Directory of Open Access Journals (Sweden)
Tina Perić
2016-08-01
Full Text Available The global growth of cruise tourism has brought increasing concern for the pollution of the marine environment. Marine pollution from sanitary wastewater is a problem especially pronounced on large cruise ships where the number of people on board may exceed 8,000. To evaluate future marine pollution in any selected period of time it is necessary to know the movement of ships in the Adriatic Sea. This paper presents the problem of marine pollution by sanitary wastewater from cruise ships, wastewater treatment technology and a model of cruise ship traffic in the Adriatic Sea considering MARPOL Annex IV areas of limited wastewater discharge. Using the model, it is possible to know in advance the routes of the cruisers and retention time in certain geographic areas. The data obtained by this model can be used as input parameters for evaluation model of wastewater pollution or for evaluation of other types of pollution from cruise ships.
Econometric analysis of ship life cycles - are safety inspections effective?
G.E. Bijwaard (Govert); S. Knapp (Sabine)
2008-01-01
textabstractDue to the shipping industry’s international legal framework and the existence of loopholes in the system, an estimated 5-10 percent of substandard ships exist which are more likely to have incidents with high economic cost. This article uses ship life cycles to provide insight into
46 CFR 91.60-5 - Cargo Ship Safety Construction Certificate.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cargo Ship Safety Construction Certificate. 91.60-5... VESSELS INSPECTION AND CERTIFICATION Certificates Under International Convention for Safety of Life at Sea, 1974 § 91.60-5 Cargo Ship Safety Construction Certificate. (a) All vessels on an international voyage...
46 CFR 189.60-10 - Cargo Ship Safety Equipment Certificate.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Cargo Ship Safety Equipment Certificate. 189.60-10... VESSELS INSPECTION AND CERTIFICATION Certificates Under International Convention for Safety of Life at Sea, 1974 § 189.60-10 Cargo Ship Safety Equipment Certificate. (a) All vessels on an international voyage...
46 CFR 189.60-5 - Cargo Ship Safety Construction Certificate.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Cargo Ship Safety Construction Certificate. 189.60-5... VESSELS INSPECTION AND CERTIFICATION Certificates Under International Convention for Safety of Life at Sea, 1974 § 189.60-5 Cargo Ship Safety Construction Certificate. (a) All vessels on an international voyage...
Simple Assessment of Post-Grounding Loads and Strength of Ships
DEFF Research Database (Denmark)
Paik, Jeom Kee; Pedersen, Preben Terndrup
1997-01-01
The aim of the present study is to determine the sectional forces induced by the ship grounding and also to assess the residual strength of grounded ship hulls. An analytical approach is used to estimate the grounding- induced sectional forces of ships. The extent and location of structural damage...
Social Security Administration — This dataset provides annual volume of SSI Aged initial claims at the national level from federal fiscal year 2016 shown two ways—we base one on a 52-week reporting...
Effect of ship motion on spinal loading during manual lifting
Faber, G.S.; Kingma, I.; Delleman, N.; Dieën, J. van
2008-01-01
This study investigated the effects of ship motion on peak spinal loading during lifting. All measurements were done on a ship at sea. In 1-min trials, which were repeated over a wide range of sailing conditions, subjects lifted an 18 kg box five times. Ship motion, whole body kinematics, ground
46 CFR 189.60-15 - Cargo Ship Safety Radio Certificate.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Cargo Ship Safety Radio Certificate. 189.60-15 Section... VESSELS INSPECTION AND CERTIFICATION Certificates Under International Convention for Safety of Life at Sea, 1974 § 189.60-15 Cargo Ship Safety Radio Certificate. Every vessel equipped with a radio installation...
46 CFR 91.60-10 - Cargo Ship Safety Equipment Certificate.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Cargo Ship Safety Equipment Certificate. 91.60-10... VESSELS INSPECTION AND CERTIFICATION Certificates Under International Convention for Safety of Life at Sea, 1974 § 91.60-10 Cargo Ship Safety Equipment Certificate. (a) All vessels on an international voyage are...
Chemical tracers of shipping emissions in a Mediterranean harbour
Viana, M.; Amato, F.; Alastuey, A.; Querol, X.; Román, A.; García, M.
2009-04-01
, 30 m3/h) at a rate of 2 samples per week for each size fraction. This resulted in 78 and 77 valid PM10 and PM2.5 samples, respectively. All samples were weighed and analysed for major and trace elements following the methodology described by Querol et al. (2004). The data collected over the annual period was analysed as a function of the wind sectors defining the main PM sources: 0-45° (open sea), 45-135° (harbour) and 135-360° (land). PM levels and chemical composition were evaluated for each of these sectors, and initial results on hourly PM levels (24000 data points) showed striking similarities between the results from the open sea (46 µgPM10/m3, 22 µgPM2.5/m3, 14 µgPM1/m3) and the harbour (44 µgPM10/m3, 21 µgPM2.5/m3, 13 µgPM1/m3) sectors, which were markedly different from those recorded from the land (37 µgPM10/m3, 16 µgPM2.5/m3, 11 µgPM1/m3). This indicated that the impact of shipping emissions on urban background PM levels do not represent only harbour emissions, but also emissions produced during vessel traffic into and out of the harbour, and also across from Melilla and through the Gibraltar Strait. The same kind of analysis was carried out for the levels of tracers species and tracer ratios, in search for a marker of shipping emissions. Results showed that the V/Ni ratio followed a similar pattern to that detected for PM levels, with similar values for the open sea and harbour sectors (4.1 and 4.0, respectively), which differed widely from the ratio obtained from land (12.4). These results evidence the value of the V/Ni ratio as a marker for shipping emissions in Melilla. Further research is ongoing in search of other tracer species and/or tracer ratios. Furthermore, a source apportionment analysis will be carried our by means of PMF, which will be followed by a Multi-linear Engine (ME) analysis with pulling towards the marker V/Ni ratio and aimed at quantifying the impact on urban PM levels of shipping emissions in Melilla. Acknowledgements
Keuning, J.A.
2008-01-01
The invention concerns a ship designed for use at high speed and heavy seas having a single long and slender hull with a narrow beam and a more or less vertical bow, whereby the front half of the hull has more or less vertical sides, minimal flare in the bow sections and towards the bow an increase in draught at its center line combined with a more or less similar increase of freeboard and whereby the aft end of the hull has a flat or slightly V-shaped bottom with one or more propellers and/o...
Directory of Open Access Journals (Sweden)
Anne Kristine Byhring
2014-10-01
Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.
Low-resolution ship detection from high-altitude aerial images
Qi, Shengxiang; Wu, Jianmin; Zhou, Qing; Kang, Minyang
2018-02-01
Ship detection from optical images taken by high-altitude aircrafts such as unmanned long-endurance airships and unmanned aerial vehicles has broad applications in marine fishery management, ship monitoring and vessel salvage. However, the major challenge is the limited capability of information processing on unmanned high-altitude platforms. Furthermore, in order to guarantee the wide detection range, unmanned aircrafts generally cruise at high altitudes, resulting in imagery with low-resolution targets and strong clutters suffered by heavy clouds. In this paper, we propose a low-resolution ship detection method to extract ships from these high-altitude optical images. Inspired by a recent research on visual saliency detection indicating that small salient signals could be well detected by a gradient enhancement operation combined with Gaussian smoothing, we propose the facet kernel filtering to rapidly suppress cluttered backgrounds and delineate candidate target regions from the sea surface. Then, the principal component analysis (PCA) is used to compute the orientation of the target axis, followed by a simplified histogram of oriented gradient (HOG) descriptor to characterize the ship shape property. Finally, support vector machine (SVM) is applied to discriminate real targets and false alarms. Experimental results show that the proposed method actually has high efficiency in low-resolution ship detection.