WorldWideScience

Sample records for ssy annual shipping

  1. SSI's International Development Co-operation (SIUS). Annual report 1998

    International Nuclear Information System (INIS)

    Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar

    1999-04-01

    SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998

  2. Ship-source oil pollution fund : annual report 1997-1998

    International Nuclear Information System (INIS)

    1998-01-01

    The Ship-source Oil Pollution Fund (SOPF) receives reports of oil pollution caused by ships in Canadian waters. The reports come from a variety of sources, including individuals who wish to be advised whether they are entitled for consideration under the Canada Shipping Act as potential claimants as a result of oil pollution damage and expenses they have suffered. The SOPF fully investigates all such reports and inquiries. A summary of each investigation that fall within the SOPF purview is provided in this report. This recitation includes a number of references to incidents dating as far back as the 1970s, providing for each incident the name of the ship, a summary of the incident, the damage caused, and the claims received and paid out by the fund. The balance of the SOPF on March 31, 1998 was just over $268 million. As of April 1, 1998 the maximum liability of the SOPF is about $128 million for all claims in respect of any one oil spill. The amount of liability is indexed annually to the consumer price index. 1 fig., 1 tab

  3. The TANF/SSI connection.

    Science.gov (United States)

    Wamhoff, Steve; Wiseman, Michael

    Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults

  4. SSI and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1987-01-01

    This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described

  5. Ship-Source Oil Pollution Fund annual report, 1991-1992

    International Nuclear Information System (INIS)

    1992-01-01

    The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1991 and ending 31 March 1992. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, United States legislation, the Haven incident, and the status of the fund. Twenty-three oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 4 figs., 1 tab

  6. Ship-Source Oil Pollution Fund annual report, 1992-1993

    International Nuclear Information System (INIS)

    1993-01-01

    The activities of the Ship-Source Oil Pollution Fund (SOPC) are reviewed for the fiscal year commencing 1 April 1992 and ending 31 March 1993. Topics covered include the Canadian compensation regime, activities of the International Oil Pollution Compensation Fund (to which the SOPC contributes), amendments to the Canada Shipping Act, major international incidents, the International Conference on the Revision of the 1969 Civil Liability Convention and the 1971 Fund Convention, the 1993 Oil Spill Conference, and the status of the fund. Twenty-nine oil spill incidents are described along with actions taken, if any, by the SOPC and details of any claims paid by the SOPC or the international fund. 3 figs

  7. Second Annual Maintenance, Inspection, and Test Report for PAS-1 Cask Certification for Shipping Payload B

    Energy Technology Data Exchange (ETDEWEB)

    KELLY, D.J.

    2000-10-09

    The Nuclear Packaging, Inc. (NuPac), PAS-1 cask is required to undergo annual maintenance and inspections to retain certification in accordance with U.S. Department of Energy (DOE) Certificate of Compliance USA/9184B(U) (Appendix A). The packaging configuration being tested and maintained is the NuPac PAS-1 cask for Payload B. The intent of the maintenance and inspections is to ensure the packaging remains in unimpaired physical condition. Two casks, serial numbers 2162-026 and 2162-027, were maintained, inspected, and tested at the 306E Development, Fabrication, and Test Laboratory, located at the Hanford Site's 300 Area. Waste Management Federal Services, Inc. (WMFS), a subsidiary of GTS Duratek, was in charge of the maintenance and testing. Cogema Engineering Corporation (Cogema) directed the operations in the test facility. The maintenance, testing, and inspections were conducted successfully with both PAS-1 casks. The work conducted on the overpacks included weighing, gasket replacement, and plastic pipe plug and foam inspections. The work conducted on the secondary containment vessel (SCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, and a helium leak test. The work conducted on the primary containment vessel (PCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, dimensional inspection of the vessel bottom, a helium leak test, and dye penetrant inspection of the welds. The vermiculite material used in the cask rack assembly was replaced.

  8. Second Annual Maintenance, Inspection, and Test Report for PAS-1 Cask Certification for Shipping Payload B

    International Nuclear Information System (INIS)

    KELLY, D.J.

    2000-01-01

    The Nuclear Packaging, Inc. (NuPac), PAS-1 cask is required to undergo annual maintenance and inspections to retain certification in accordance with U.S. Department of Energy (DOE) Certificate of Compliance USA/9184B(U) (Appendix A). The packaging configuration being tested and maintained is the NuPac PAS-1 cask for Payload B. The intent of the maintenance and inspections is to ensure the packaging remains in unimpaired physical condition. Two casks, serial numbers 2162-026 and 2162-027, were maintained, inspected, and tested at the 306E Development, Fabrication, and Test Laboratory, located at the Hanford Site's 300 Area. Waste Management Federal Services, Inc. (WMFS), a subsidiary of GTS Duratek, was in charge of the maintenance and testing. Cogema Engineering Corporation (Cogema) directed the operations in the test facility. The maintenance, testing, and inspections were conducted successfully with both PAS-1 casks. The work conducted on the overpacks included weighing, gasket replacement, and plastic pipe plug and foam inspections. The work conducted on the secondary containment vessel (SCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, and a helium leak test. The work conducted on the primary containment vessel (PCV) consisted of visual inspection of the vessel and threaded parts (i.e., fasteners), visual inspection of sealing surfaces, replacement of O-ring seals, dimensional inspection of the vessel bottom, a helium leak test, and dye penetrant inspection of the welds. The vermiculite material used in the cask rack assembly was replaced

  9. Inter-annual trend of the primary contribution of ship emissions to PM2.5 concentrations in Venice (Italy): Efficiency of emissions mitigation strategies

    Science.gov (United States)

    Contini, Daniele; Gambaro, Andrea; Donateo, Antonio; Cescon, Paolo; Cesari, Daniela; Merico, Eva; Belosi, Franco; Citron, Marta

    2015-02-01

    Ships and harbour emissions are currently increasing, due to the increase of tourism and trade, with potential impact on global air pollution and climate. At local scale, in-port ship emissions influence air quality in coastal areas impacting on health of coastal communities. International legislations to reduce ship emissions, both at Worldwide and European levels, are mainly based on the use of low-sulphur content fuel. In this work an analysis of the inter-annual trends of primary contribution, ε, of tourist shipping to the atmospheric PM2.5 concentrations in the urban area of Venice has been performed. Measurements have been taken in the summer periods of 2007, 2009 and 2012. Results show a decrease of ε from 7% (±1%) in 2007 to 5% (±1%) in 2009 and to 3.5% (±1%) in 2012. The meteorological and micrometeorological conditions of the campaigns were similar. Tourist ship traffic during measurement campaigns increased, in terms of gross tonnage, of about 25.4% from 2007 to 2009 and of 17.6% from 2009 to 2012. The decrease of ε was associated to the effect of a voluntary agreement (Venice Blue Flag) for the use of low-sulphur content fuel enforced in the area between 2007 and 2009 and to the implementation of the 2005/33/CE Directive in 2010. Results show that the use of low-sulphur fuel could effectively reduce the impact of shipping to atmospheric primary particles at local scale. Further, voluntary agreement could also be effective in reducing the impact of shipping on local air quality in coastal areas.

  10. Dicty_cDB: SSI339 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY

  11. Preoperative antiseptic skin preparations and reducing SSI.

    Science.gov (United States)

    Al Maqbali, Mohammed Abdullah

    Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.

  12. Materials Assessment of Insulating Foam in the 9977 Shipping Package for Long-Term Storage - Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    McWilliams, A. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2016-08-01

    The 9977 shipping package is being evaluated for long-term storage applications in the K-Area Complex (KAC) with specific focus on the packaging foam material. A rigid closed cell polyurethane foam, LAST-A-FOAM® FR-3716, produced by General Plastics Manufacturing Company is sprayed and expands to fill the void between the inner container and the outer shell of the package. The foam is sealed in this annular space and is not accessible. During shipping and storage, the foam experiences higher than ambient temperatures from the heat generated by nuclear material within the package creating the potential for degradation of the foam. A series of experiments is underway to determine the extent of foam degradation. Foam samples of three densities have been aging at elevated temperatures 160 °F, 160 °F + 50% relative humidity (RH), 185 °F, 215 °F, and 250 °F since 2014. Samples were periodically removed and tested. After approximately 80 weeks, samples conditioned at 160 °F, 160 °F + 50% RH, and 185 °F have retained initial property values while samples conditioned at 215 °F have reduced intumescence. Samples conditioned at 250 °F have shown the most degradation, loss of volume, mass, absorbed energy under compression, intumescence, and increased flammability. Based on the initial data, temperatures up to 185 °F have not yet shown an adverse effect on the foam properties and it is recommended that exposure of FR-3716 foam to temperatures in excess of 250 °F be avoided or minimized. Testing will continue beyond the 96 week mark. This will provide additional data to help define the long-term behavior for the lower temperature conditions. Additional testing will be pursued in an attempt to identify transition points (threshold times and temperatures) at the higher temperatures of interest, as well as possible benefits of aging within the relatively oxygen-free environment the foam experiences inside the 9977 shipping package.

  13. "Jazz Ruuler" toob dzhässi Rock Cafesse

    Index Scriptorium Estoniae

    2008-01-01

    Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés

  14. 20 CFR 416.1100 - Income and SSI eligibility.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Income and SSI eligibility. 416.1100 Section 416.1100 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED... supplemental security income (SSI) benefits if you are an aged, blind, or disabled person who meets the...

  15. Post-Launch Support for DMSP SSIES Sensors

    National Research Council Canada - National Science Library

    Heelis, R. A

    2006-01-01

    ...) that is flown on the the Defense Meteorological Satellite Program (DMSP). The thermal plasma sensors that constitute the SSIES instrument complement provide measurements that describe the composition, velocity, and temperature of the ions and electrons...

  16. Shipping Fairways

    Data.gov (United States)

    Department of Homeland Security — Various shipping zones delineate activities and regulations for marine vessel traffic. Traffic lanes define specific traffic flow, while traffic separation zones...

  17. Test Ship

    Data.gov (United States)

    Federal Laboratory Consortium — The U. S. Navy dedicated the decommissioned Spruance Class destroyer ex-PAUL F. FOSTER (EDD 964), Test Ship, primarily for at sea demonstration of short range weapon...

  18. Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...

  19. Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010

    Data.gov (United States)

    Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...

  20. Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io

    Science.gov (United States)

    Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.

    2005-01-01

    Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.

  1. ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI

    Directory of Open Access Journals (Sweden)

    Rohini Murlidhar Gajbhiye

    2017-02-01

    Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20

  2. Arctic Shipping

    DEFF Research Database (Denmark)

    Hansen, Carsten Ørts; Grønsedt, Peter; Lindstrøm Graversen, Christian

    maritime industries (including shipping, offshore energy, ports, and maritime service and equipment suppliers) as well as addresses topics that cut across maritime industries (regulation and competitiveness). The topics and narrower research questions addressed in the initiative were developed in close...... at CBS and create the foundation for CBS as a stronger partner for the maritime industries, as well as for other universities and business school with a devotion to maritime economics research. The competitiveness initiative comprises a number of PhD projects and five short term mapping projects...

  3. Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor

    DEFF Research Database (Denmark)

    Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten

    2008-01-01

    The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structurally...... related to amino acid permeases, but unable to transport amino acids. We isolated SSY1 mutants that constitutively activate a target promoter. Dose-response analysis showed that the mutants are hyperresponsive, requiring less inducer to give strong signaling than does the wild type. Another mutant (Ssy1p......T639I) turned out to be hyporesponsive, i.e., it signals only at high inducer concentration. In accordance with a transporter-like mechanism for Ssy1p function we suggest that the hyper- and hyporesponsive mutant forms differ from the wild-type sensor by being more and less inclined, respectively...

  4. FT4 Data Analysis Summary (SSI-ARC)

    Science.gov (United States)

    Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor

    2016-01-01

    Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.

  5. SSI response of a typical shear wall structure. Volume 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.

    1984-04-01

    The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables

  6. SSI's Review of RD and D Programme 98

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-06-01

    The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues.

  7. SSI's review of SKB's RDandD Program 2007; SSI:s granskning av SKB:s Fud-program 2007

    Energy Technology Data Exchange (ETDEWEB)

    Wiebert, Anders (and others)

    2008-05-15

    In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented

  8. The SSI project on decommissioning of nuclear plants - a preliminary study; SSI:s projekt avseende avveckling av kaerntekniska anlaeggningar - en foerstudie

    Energy Technology Data Exchange (ETDEWEB)

    Efraimsson, Henrik; Ehdwall, H.; Godaas, T.; Hofvander, P.; Lindhe, J.C.; Lumpus, J.; Lund, I.; Malmqvist, L.; Welleman, E

    1999-01-01

    SSI will amend and complete regulations and stipulations for nuclear plants in order to take into account issues which arise in connection with decommissioning. The objective of a pilot study, performed during 1998, was to identify the questions at issue, what the authority should control and how SSI should proceed with the work. The recommendations and the result of the pilot study are presented in this report 29 refs.

  9. 20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits... are living in the same household with anyone of the opposite sex who is not related to you. If you are...

  10. Categorization of Digital Games in English Language Learning Studies: Introducing the SSI Model

    Science.gov (United States)

    Sundqvist, Pia

    2013-01-01

    The main aim of the present paper is to introduce a model for digital game categorization suitable for use in English language learning studies: the Scale of Social Interaction (SSI) Model (original idea published as Sundqvist, 2013). The SSI Model proposes a classification of commercial off-the-shelf (COTS) digital games into three categories:…

  11. Treatment of surgical site infections (SSI) IN patients with peripheral arterial disease : an observational study

    NARCIS (Netherlands)

    van der Slegt, Jasper; Kluytmans, Jan A J W; de Groot, Hans G W; van der Laan, Lijckle

    INTRODUCTION: The management of surgical site infections (SSI's) in vascular surgery has been challenging over the years. To assess the outcomes associated with the various strategies, we performed a review of all SSI's after elective vascular procedures in patients with moderate to severe

  12. SSI's review of SKB's RD and D programme 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others

    2002-08-01

    In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  13. Green Shipping Practices of Shipping Firms

    Directory of Open Access Journals (Sweden)

    Young-Tae Chang

    2017-05-01

    Full Text Available The primary objective of this study is to provide an empirical research using structural equation modeling to identify the factors that motivate shipping firms to adopt green shipping practices (GSP. Furthermore, it also examines if adopting GSP can enhance the shipping firms’ environmental and productivity performance. The findings show that shipping firms are motivated to adopt GSP mostly by industrial norms set by institutionalized associations. They are also motivated by customers’ demand for environmental friendliness and their own strategy to make good image. Unlike our expectation, government regulations and international environmental laws are not significant in influencing shipping firms to adopt GSP. Moreover, adoption of green shipping practices can improve the environmental and productivity performance of the shipping firms.

  14. SSI response of a typical shear wall structure

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.

    1985-01-01

    The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)

  15. Green shipping management

    CERN Document Server

    Lun, Y H Venus; Wong, Christina W Y; Cheng, T C E

    2016-01-01

    This book presents theory-driven discussion on the link between implementing green shipping practices (GSP) and shipping firm performance. It examines the shipping industry’s challenge of supporting economic growth while enhancing environmental performance. Consisting of nine chapters, the book covers topics such as the conceptualization of green shipping practices (GSPs), measurement scales for evaluating GSP implementation, greening capability, greening and performance relativity (GPR), green management practice, green shipping network, greening capacity, and greening propensity. In view of the increasing quest for environment protection in the shipping sector, this book provides a good reference for firms to understand and evaluate their capability in carrying out green operations on their shipping activities.

  16. The shipping man adventures in ship finance

    CERN Document Server

    McCleery, Matthew

    2013-01-01

    When restless New York City hedge fund manager Robert Fairchild watches the Baltic Dry Cargo Index plunge 97%, registering an all-time high and a 25-year low within the span of just six months, he decides to buy a ship. Immediately fantasizing about naming a vessel after his wife, carrying a string of worry beads and being able to introduce himself as a "shipowner" at his upcoming college reunion, Fairchild immediately embarks on an odyssey into the most exclusive, glamorous and high stakes business in the world. From pirates off the coast of Somalia and on Wall Street to Greek and Norwegian shipping magnates, the education of Robert Fairchild is an expensive one. In the end, he loses his hedge fund, but he gains a life - as a Shipping Man. Part fast paced financial thriller, part ship finance text book, The Shipping Man is 310 pages of required reading for anyone with an interest in capital formation for shipping.

  17. Bundle Prevention Form Filling Completeness of Surgical Site Infection (SSI on Sectio Caesarea Patients in 2016

    Directory of Open Access Journals (Sweden)

    Adita Puspitasari Swastya Putri

    2017-04-01

    Full Text Available Hospital Acquired Infections (HAIs is an infection acquired during a patient undergoing treatment proedur and medical measures in health care facilities within ≥ 48 hours or within ≤ 30 days and infection was observed after the patients leaving the health care facility. The one of Hais what often happens is Surgical Site Infection (SSI so that SSI surveillance is needed for prevention and control of infection. Bundle prevention is an instrument used for data collection the incidence of SSI in Hospital X Surabaya. This study aims to look at the picture of existence, charging and completeness of bundle SSI prevention on patients sectio caesarea in Hospital X Surabaya. The study design used is cross sectional with a total sample of 47 patients were taken by simple random sampling on patients sectio caesarea in January-June 2016. The result showed that 64% of patient records status is not accompanied by SSI prevention bundle with charging and completeness of the data that is still below the predetermined standard that is equal to 80%. Although SSI surveillance is in conformity with the guidelines infection surveillance but there are still some shortcomings in terms of the accuracy of the data so that the information obtained is still not able to be reported as well. Keywords: surveillance, SSI, hospital

  18. Ship emissions and their externalities for Greece

    Science.gov (United States)

    Tzannatos, Ernestos

    2010-06-01

    The existing and emerging international and European policy framework for the reduction of ship exhaust emissions dictates the need to produce reliable national, regional and global inventories in order to monitor emission trends and consequently provide the necessary support for future policy making. Furthermore, the inventories of ship exhaust emissions constitute the basis upon which their external costs are estimated in an attempt to highlight the economic burden they impose upon the society and facilitate the cost-benefit analysis of the proposed emission abatement technologies, operational measures and market-based instruments prior to their implementation. The case of Greece is of particular interest mainly because the dense ship traffic within the Greek seas directly imposes the impact of its exhaust emission pollutants (NO x, SO 2 and PM) upon the highly populated, physically sensitive and culturally precious Greek coastline, as well as upon the land and seas of Greece in general, whereas the contribution of Greece in the global CO 2 inventory at a time of climatic change awareness cannot be ignored. In this context, this paper presents the contribution of Greece in ship exhaust emissions of CO 2, NO x, SO 2 and PM from domestic and international shipping over the last 25 years (1984-2008), utilizing the fuel-based (fuel sales) emission methodology. Furthermore, the ship exhaust emissions generated within the Greek seas and their externalities are estimated for the year 2008, through utilizing the fuel-based (fuel sales) approach for domestic shipping and the activity-based (ship traffic) approach for international shipping. On this basis, it was found that during the 1984 to 2008 period the fuel-based (fuel sales) ship emission inventory for Greece increased at an average annual rate of 2.85%. In 2008, the CO 2, NO x, SO 2 and PM emissions reached 12.9 million tons (of which 12.4 million tons of CO 2) and their externalities were found to be around 3

  19. DoSSiER: Database of Scientific Simulation and Experimental Results

    CERN Document Server

    Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea

    2017-01-01

    The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.

  20. SSI [soil-structure interactions] and structural benchmarks

    International Nuclear Information System (INIS)

    Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.

    1986-01-01

    This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils

  1. Commercial nuclear ships

    International Nuclear Information System (INIS)

    Poirier d'Ange d'Orsay, P.; Andrieu, J.L.

    1975-01-01

    Following discussion of the arguments in favour of nuclear merchant ships and development of nuclear ship propulsion, the rentability of nuclear ships is dealt with in a comparative study with conventional ships regarding fuel costs, investments and environmental impact. The structure and components of a nuclear ship are described, with emphasis on its safety equipment. The problem of insurance is examined, particularly in connection with the difficulty in applying insurance for liability due to the present uncertainties of the legal position at international level. French legislation does not solve the problem of visiting foreign nuclear ships. The risk concept at operational, design and construction stages is also discussed. Unresolved difficulties, especially concerning the construction of nuclear ships, uncertainties in competitivity analyses between conventional and nuclear propulsion, and implementation of specific and complete legislation on nuclear ships are also mentioned, particularly in the context of their visits to ports [fr

  2. Guide to ship sanitation

    National Research Council Canada - National Science Library

    2011-01-01

    "The third edition of the Guide to Ship Sanitation presents the public health significance of ships in terms of disease and highlights the importance of applying appropriate control measures"--Back cover...

  3. Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area, December 2010

    Data.gov (United States)

    Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...

  4. NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...

  5. An Arsenal Ship Design

    Science.gov (United States)

    1996-12-01

    and dental services underway. 5. Disbursing Office In addition to being paperless, the Arsenal Ship is also a cashless ship. The ship does not have...1, Society of Naval Architects & Marine Engineers, 1988. 57. Gillmer, T.C., and Johnson, B., Introduction to Naval Architecture, Naval Institute...Vending Machines Cashless ship (i.e. Use MARC card) O 10.4.3 Provide Crew Entertainment O 10.4.3.1 Closed Circuit TV Shipboard Multi-Media Resource Center

  6. Performance Monitoring of Ships

    DEFF Research Database (Denmark)

    Hansen, Søren Vinther

    The purpose of the research project is to establish a reliable index in the performance evaluation of ships. During operation the ship will experience added resistance due to fouling of hull and propeller. The added resistance will lead to increased fuel consumption and thus increased emissions...... to the environment. The monitoring of the ship’s performance can be used as decision support in determining when actions to improve performance should be taken. The performance evaluation is based on a model of the ship and the added resistance from wind and waves during operation. Logged data on board the ship...... is used as input to the system and by comparing model and ship behaviour, an index describing the ship’s performance is generated. The work in this thesis is based on data logged through the automation system on board a PostPanmax container ship where data have been logged through a year. A routine...

  7. Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas; Vatrapu, Ravi

    2015-01-01

    systems researchers engaged in the design and development of a prototype for an innovative IT-artifact called Shipping Information Pipeline which is a kind of “an internet” for shipping information. The instrumental aim is to enable information seamlessly to cross the organizational boundaries......This paper presents a design science approach to solving persistent problems in the international shipping eco system by creating the missing common information infrastructures. Specifically, this paper reports on an ongoing dialogue between stakeholders in the shipping industry and information...... and national borders within international shipping which is a rather complex domain. The intellectual objective is to generate and evaluate the efficacy and effectiveness of design principles for inter-organizational information infrastructures in the international shipping domain that can have positive...

  8. Chemical similarity searches using latent semantic structural indexing (LaSSI) and comparison to TOPOSIM.

    Science.gov (United States)

    Hull, R D; Fluder, E M; Singh, S B; Nachbar, R B; Kearsley, S K; Sheridan, R P

    2001-04-12

    Similarity searches based on chemical descriptors have proven extremely useful in aiding large-scale drug screening. Here we present results of similarity searching using Latent Semantic Structure Indexing (LaSSI). LaSSI uses a singular value decomposition on chemical descriptors to project molecules into a k-dimensional descriptor space, where k is the number of retained singular values. The effect of the projection is that certain descriptors are emphasized over others and some descriptors may count as partially equivalent to others. We compare LaSSI searches to searches done with TOPOSIM, our standard in-house method, which uses the Dice similarity definition. Standard descriptor-based methods such as TOPOSIM count all descriptors equally and treat all descriptors as independent. For this work we use atom pairs and topological torsions as examples of chemical descriptors. Using objective criteria to determine how effective one similarity method is versus another in selecting active compounds from a large database, we find for a series of 16 drug-like probes that LaSSI is as good as or better than TOPOSIM in selecting active compounds from the MDDR database, if the user is allowed to treat k as an adjustable parameter. Typically, LaSSI selects very different sets of actives than does TOPOSIM, so it can find classes of actives that TOPOSIM would miss.

  9. Summary of Requirements for Sewage Sludge Incinerators (SSI): New Source Performance Standards (NSPS) and Emission Guidelines (EG)

    Science.gov (United States)

    This November 2011 document summarizes the various requirements of the sewage sludge incinerators (SSI) new source performance standards (NSPS) and emission guidelines (EG), broken down into compliance categories.

  10. Liner Shipping Fleet Repositioning

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller

    2011-01-01

    Liner shipping fleet repositioning consists of moving vessels between services in a liner ship- ping network in order to better orient the overall network to the world economy, and to ensure the proper maintenance of vessels. Thus, fleet repositioning involves sailing and loading activities subject......, can be accurately modeled. Numerous liner shipping fleet repositioning problems are solved each year by the world’s shipping firms without the assistance of any decision support, even though humans can require between two to three days to find a reasonable solution. Finding optimal repositionings...

  11. Buckling of Ship Structures

    CERN Document Server

    Shama, Mohamed

    2013-01-01

    Buckling of Ship Structures presents a comprehensive analysis of the buckling problem of ship structural members. A full analysis of the various types of loadings and stresses imposed on ship plating and primary and secondary structural members is given. The main causes and consequences of the buckling mode of failure of ship structure and the methods commonly used to control buckling failure are clarified. This book contains the main equations required to determine the critical buckling stresses for both ship plating and the primary and secondary stiffening structural members. The critical buckling stresses are given for ship plating subjected to the induced various types of loadings and having the most common boundary conditions encountered in ship structures.  The text bridges the gap existing in most books covering the subject of buckling of ship structures in the classical analytical format, by putting the emphasis on the practical methods required to ensure safety against buckling of ship structur...

  12. SSI's review of SKB's RDandD programme 2001; SSI's granskning av SKB's FUD-program 2001

    Energy Technology Data Exchange (ETDEWEB)

    Hedberg, B.; Larsson, Carl-Magnus; Wiebert, A.; Dverstorp, B.; Jensen, Mikael; Norden, M.; Loefgren, T.; Brewitz, E.; Lindhe, J.C.; Pensjoe, Aa

    2002-02-01

    In the report SSI's review of SKB's RDandD programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need of a strategy document, SKB's safety and system analysis and SKB's biosphere studies.

  13. Crushing Strength of Ship Structures

    DEFF Research Database (Denmark)

    Cerup-Simonsen, Bo; Abramowicz, W.; Høstgaard-Brene, C.N.S.

    1999-01-01

    The crushing response of ship structures is of primary importance to the designers and practicing engineers concerned with accidental loading and accident reconstruction of marine vehicles. Ship to-ship collisions, ship-harbor infrastructure interaction or ship-offshore structure interaction...... are just few examples of accident scenarios where the detailed knowledge of the crushing response of ship structure is crucial for a reliable engineering analysis....

  14. Prerequisites concerning SSI:s review of applications for an encapsulation facility and a repository for spent nuclear fuel

    International Nuclear Information System (INIS)

    Oehlen, Elisabeth

    2006-09-01

    The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect

  15. Using Social Media to Promote Pre-Service Science Teachers' Practices of Socio-Scientific Issue (SSI) - Based Teaching

    Science.gov (United States)

    Pitiporntapin, Sasithep; Lankford, Deanna Marie

    2015-01-01

    This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…

  16. [Psychopathology service on ships].

    Science.gov (United States)

    Nowosielski, Radosław; Mazurek, Tomasz; Florkowski, Antoni

    2010-06-01

    The aim of this study was to describe the specific engineering services and suitability of candidates for the psychophysical performance. Navy ships are equipped with equipment and weapons are controlled by electronic devices ship and crew. Advanced technology puts high demands on operator. For the ship's staff are recruited soldiers of the psychophysical characteristics predisposing to this kind of action. The paper uses personal experience to work in military units of the Navy, and data from the literature. Terms of sailing ships off the summer season are defined as difficult. The crew during a combat mission felt the risks associated with movements of the ship in difficult meteorological conditions, and associated with the implementation of the task. The development of ship's technical equipment, working in isolated groups, functioning within a limited space, noise, vibration, electromagnetic waves heighten the emotional burden on crew members. Military service on Navy ships require high psycho-physical predisposition, resistance to stress. The crucial factor is proper selection among the candidates based on psychiatric and psychological counseling for military and medical jurisprudence. Also plays a significant role for training doctors and specialists in psychoprophylaxy of military units in the field of mental hygiene.

  17. Effective and Safe Ships

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Amdahl, Jørgen; Rutgersson, Olle

    1996-01-01

    A Joint Nordic Research project "Effecive and Safe Ships" is presented. The project is aiming to develop methods and tools for quantitative evaluation fo ship safety. This report is the report of the preliminary phase where the plan for the main project is developed. The objectives of the project...... are described. The areas of safety that are presented are collisions, groundings, cargo shifting and ship fire. The areas of lack of knowledge are identified and the tasks within each subproject suggested. The proposal for the main project is presented in the summary. Background material of the state-of-the art...

  18. Additional Evidence of Convergent Validity between SRSS-IE and SSiS-PSG Scores

    Science.gov (United States)

    Lane, Kathleen Lynne; Oakes, Wendy Peia; Ennis, Robin Parks; Royer, David James

    2015-01-01

    We report findings of a validity study comparing two screening tools: the Student Risk Screening Scale-Internalizing and Externalizing (SRSS-IE) and the Social Skills Improvement System-Performance Screening Guide (SSiS-PSG; Elliott & Gresham, 2007). Participants were 1,680 kindergarten through sixth-grade elementary students from three…

  19. 20 CFR 416.1826 - Showing that you are not married when you apply for SSI.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...

  20. 75 FR 1271 - Technical Revisions to the Supplemental Security Income (SSI) Regulations on Income and Resources

    Science.gov (United States)

    2010-01-11

    ... Economic Growth and Tax Relief Reconciliation Act of 2001 (EGTRRA), an amendment to the National Flood... calculating their income. Exclusion of Child Tax Credit (CTC) From Income and Resources We exclude from income... principal place of residence, or the SSI applicant or beneficiary maintains an active intent to return to...

  1. Civilian nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-03-01

    This report contains a review of the information available on nuclear powered ships, built for civilian purposes. In the introduction a short discussion is given of the reasons for the limited use of nuclear ships for these purposes. In the second section a brief review is presented of data for the three experimental/merchant ships build by the United States, Germany and Japan, i.e. NS Savannah, NS Otto Hahn and NS Mutsu. In the third section the Soviet/Russian icebreaker NS Lenin is considered. Its design, operational experience and the introduction of a new nuclear propulsion plant is reviewed. In the fourth section the newer Soviet/Russian icebreakers with nuclear propulsion are considered. Finally design of the Soviet/Russian icebreaker transport/container ship NS Sevmorput is reviewed in the fifth section. The future Russian plans for nuclear vessels for the arctic waters are briefly discussed. (au)

  2. Ship construction and welding

    CERN Document Server

    Mandal, Nisith R

    2017-01-01

    This book addresses various aspects of ship construction, from ship types and construction materials, to welding technologies and accuracy control. The contents of the book are logically organized and divided into twenty-one chapters. The book covers structural arrangement with longitudinal and transverse framing systems based on the service load, and explains basic structural elements like hatch side girders, hatch end beams, stringers, etc. along with structural subassemblies like floors, bulkheads, inner bottom, decks and shells. It presents in detail double bottom construction, wing tanks & duct keels, fore & aft end structures, etc., together with necessary illustrations. The midship sections of various ship types are introduced, together with structural continuity and alignment in ship structures. With regard to construction materials, the book discusses steel, aluminum alloys and fiber reinforced composites. Various methods of steel material preparation are discussed, and plate cutting and form...

  3. Optimization in liner shipping

    DEFF Research Database (Denmark)

    Brouer, Berit Dangaard; Karsten, Christian Vad; Pisinger, David

    2017-01-01

    Seaborne trade is the lynchpin in almost every international supply chain, and about 90% of non-bulk cargo worldwide is transported by container. In this survey we give an overview of data-driven optimization problems in liner shipping. Research in liner shipping is motivated by a need for handling...... still more complex decision problems, based on big data sets and going across several organizational entities. Moreover, liner shipping optimization problems are pushing the limits of optimization methods, creating a new breeding ground for advanced modelling and solution methods. Starting from liner...... shipping network design, we consider the problem of container routing and speed optimization. Next, we consider empty container repositioning and stowage planning as well as disruption management. In addition, the problem of bunker purchasing is considered in depth. In each section we give a clear problem...

  4. Nuclear ship accidents

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-05-01

    In this report available information on 28 nuclear ship accident and incidents is considered. Of these 5 deals with U.S. ships and 23 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the nuclear propulsion plants, radiation exposures, fires/explosions and sea water leaks into the submarines are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that much of the available information is of a rather dubious nature. consequently some of the assessments made may not be correct. (au)

  5. Ship propulsion reactors technology

    International Nuclear Information System (INIS)

    Fribourg, Ch.

    2002-01-01

    This paper takes the state of the art on ship propulsion reactors technology. The french research programs with the corresponding technological stakes, the reactors specifications and advantages are detailed. (A.L.B.)

  6. Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses

    Energy Technology Data Exchange (ETDEWEB)

    Han, Seung-ju [KHNP CRI, Daejeon (Korea, Republic of); You, Dong-Hyun [KEPCO Engineering and Construction, Gimcheon (Korea, Republic of); Jang, Jung-bum; Yun, Kwan-hee [KEPCO Research Institute, Daejeon (Korea, Republic of)

    2016-10-15

    The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45.

  7. Towards Real Time Simulation of Ship-Ship Interaction

    DEFF Research Database (Denmark)

    Lindberg, Ole; Bingham, Harry B.; Engsig-Karup, Allan Peter

    2012-01-01

    We present recent and preliminary work directed towards the development of a simplified, physics-based model for improved simulation of ship-ship interaction that can be used for both analysis and real-time computing (i.e. with real-time constraints due to visualization). The goal is to implement...... accurate (realistic) and much faster ship-wave and ship-ship simulations than are currently possible. The coupling of simulation with visualization should improve the visual experience such that it can be perceived as more realistic in training. Today the state-of-art in real-time ship-ship interaction...... (GPUs) can provide the basis for efficient simulations in combination with an accurate free-surface model for Ship-Ship simulation. Another area of application is the determination of wave disturbances from a ship in a coastal environment, channels and harbours. The model proposed in the following can...

  8. SHIPPING REQUESTS ON EDH

    CERN Multimedia

    Logistics Group

    2001-01-01

    Users are informed that as from 1 September 2001 all Shipping Requests must be made on EDH using the appropriate electronic form. The submission of user requests directly into EDH will help rationalise the activities of the Shipping Service (Import & Export), with requests being automatically forwarded to hierarchical supervisors thereby improving the processing speed and facilitating the follow-up. Thank you for your collaboration.

  9. Recent situations around nuclear ships

    International Nuclear Information System (INIS)

    Mizuno, Hiroshi

    1978-01-01

    The philosophy when the safety standard for nuclear ships is drawn up and the international rules specifically for nuclear ships are summarized. As for the safety standard for nuclear ships, the safety requirements for ordinary ships, for the ships transporting nuclear reactors, for ordinary nuclear reactors, and for the reactors moving around the seas must be included. As for the international rules for nuclear ships, there are chapter 8 ''Nuclear ships'' in the International Convention on the Safety of Life at Sea, 1960 and 1974, and Safety Consideration in the Use of Ports and Approaches by Nuclear Merchant Ships. Also there are national rules and standards in Japan and foreign countries. One of the means to explore the practicality of nuclear ships is the investigation of the economy. At this time, the social merits and demerits of nuclear ships must be compared with conventional ships by taking total expenses into account without omission. When oil is depleted, the age of nuclear ships will not necessarily begin, and the will be still some competitors. The investigations concerning the economy of nuclear ships have been carried out in various countries. The present state of the development of nuclear ships in Japan and foreign countries is explained. Many conferences and symposia have been held concerning nuclear ships, and those held recently are enumerated. The realization of nuclear ship age cannot be anticipated from existing papers and shipbuilding projects. (Kako, I.)

  10. Outer Dynamics of Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    The purpose of these notes is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisons with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding...

  11. Outer Dynamics of Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    The purpose is to present analysis procedures for the motion of ships during ship-ship collisions and for ship collisions with offshore structures. The aim is to estimate that part of the lost kinetic energy which will have to be absorbed by rupture and plastic damage of the colliding structures....

  12. From the American Academy of Pediatrics: Policy statements--Supplemental Security Income (SSI) for children and youth with disabilities.

    Science.gov (United States)

    2009-12-01

    The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.

  13. Accidents in nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1996-12-01

    This report starts with a discussion of the types of nuclear vessels accidents, in particular accidents which involve the nuclear propulsion systems. Next available information on 61 reported nuclear ship events in considered. Of these 6 deals with U.S. ships, 54 with USSR ships and 1 with a French ship. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/explosions, sea-water leaks into the submarines and sinking of vessels are considered. For each event a summary of available information is presented, and comments are added. In some cases the available information is not credible, and these events are neglected. This reduces the number of events to 5 U.S. events, 35 USSR/Russian events and 1 French event. A comparison is made between the reported Soviet accidents and information available on dumped and damaged Soviet naval reactors. It seems possible to obtain good correlation between the two types of events. An analysis is made of the accident and estimates are made of the accident probabilities which are found to be of the order of 10 -3 per ship reactor years. It if finally pointed out that the consequences of nuclear ship accidents are fairly local and does in no way not approach the magnitude of the Chernobyl accident. It is emphasized that some of the information on which this report is based, may not be correct. Consequently some of the results of the assessments made may not be correct. (au)

  14. 77 FR 59749 - Special Local Regulations for Marine Events; San Francisco Bay Navy Fleet Week Parade of Ships...

    Science.gov (United States)

    2012-10-01

    ... Local Regulations for Marine Events; San Francisco Bay Navy Fleet Week Parade of Ships and Blue Angels... Francisco Bay for the annual U.S. Navy and City of San Francisco sponsored Fleet Week Parade of Navy Ships... Fleet Week Parade of Ships and Blue Angels Demonstration in accordance with 33 CFR 100.1105. Regulations...

  15. EX1301: Ship Shakedown and Patch Test Exploration, NE Canyons and Seamounts on NOAA Ship Okeanos Explorer between 20130318 and 20130405

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Following annual ship shakedown and patch tests, EX1301 will complete the comprehensive mapping of the Northeast canyons and the adjacent continental shelf carried...

  16. Ship operations report, 1973

    International Nuclear Information System (INIS)

    1973-01-01

    The NOAA Fleet Operations Report 1973 was developed to provide a summary of project accomplishments during calendar year 1973. The report was prepared from season, cruise and special reports submitted by ships of the fleet. Centralized management of the NOAA Fleet was finalized by changing the operational control of the National Marine Fisheries Service (NMFS) Ships DAVID STARR JORDAN (FRS 44), TOWNSEND CROMWELL (FRS 43) and MURRE II (FRV 63) from NMFS to the National Ocean Survey on July 1, 1973. Throughout the year, ships routinely collected and transmitted weather data. Similarly, as NOAA participants in the Integrated Global Ocean Station System (IGOSS) service program, XBT observations were taken and either radioed or submitted in log form via mail. In addition, particulate and radionuclide samples were taken in cooperation with the Atomic Energy Commission, sediment samples were obtained for the Smithsonian Institution and observations were made of marine mammals

  17. Automated ship image acquisition

    Science.gov (United States)

    Hammond, T. R.

    2008-04-01

    The experimental Automated Ship Image Acquisition System (ASIA) collects high-resolution ship photographs at a shore-based laboratory, with minimal human intervention. The system uses Automatic Identification System (AIS) data to direct a high-resolution SLR digital camera to ship targets and to identify the ships in the resulting photographs. The photo database is then searchable using the rich data fields from AIS, which include the name, type, call sign and various vessel identification numbers. The high-resolution images from ASIA are intended to provide information that can corroborate AIS reports (e.g., extract identification from the name on the hull) or provide information that has been omitted from the AIS reports (e.g., missing or incorrect hull dimensions, cargo, etc). Once assembled into a searchable image database, the images can be used for a wide variety of marine safety and security applications. This paper documents the author's experience with the practicality of composing photographs based on AIS reports alone, describing a number of ways in which this can go wrong, from errors in the AIS reports, to fixed and mobile obstructions and multiple ships in the shot. The frequency with which various errors occurred in automatically-composed photographs collected in Halifax harbour in winter time were determined by manual examination of the images. 45% of the images examined were considered of a quality sufficient to read identification markings, numbers and text off the entire ship. One of the main technical challenges for ASIA lies in automatically differentiating good and bad photographs, so that few bad ones would be shown to human users. Initial attempts at automatic photo rating showed 75% agreement with manual assessments.

  18. Effects of different SSI parameters on the floor response spectra of a nuclear reactor building

    International Nuclear Information System (INIS)

    Kabir, A.F.; Bolourchi, S.; Maryak, M.E.

    1991-01-01

    The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth

  19. The SSI TOOLBOX Source Term Model SOSIM - Screening for important radionuclides and parameter sensitivity analysis

    International Nuclear Information System (INIS)

    Avila Moreno, R.; Barrdahl, R.; Haegg, C.

    1995-05-01

    The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs

  20. SSI's Review of the RDandD Program 2004 of the Swedish Nuclear Fuel and Waste Management Co; SSI:s granskning av SKB:s Fud-program 2004

    Energy Technology Data Exchange (ETDEWEB)

    Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others

    2005-06-01

    In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.

  1. A Longitudinal Examination of a SSI-Embedded Experiential Environmental Education Course and Environmental Behaviors

    Science.gov (United States)

    Newton, Mark H.

    A qualitative, multiple case study design examining the association between an SSI-embedded experiential environmental education course and post-secondary students' environmental behaviors. Seven students were purposefully selected and three exemplar students are the focus of the study. The results indicate an association between how students conceptualized contentious environmental issues and their environmental behaviors. Additionally, students demonstrated changes in their socioscientific reasoning (SSR) after completing the course.

  2. Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model

    International Nuclear Information System (INIS)

    Kang, Joo-Hyung; Lee, Sang-Hoon

    2008-01-01

    Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated

  3. Are nuclear ships environmentally safer than conventionally powered ships

    International Nuclear Information System (INIS)

    Bone, C.A.; Molgaard, C.A.; Helmkamp, J.C.; Golbeck, A.L.

    1988-01-01

    An epidemiologic analysis was conducted to determine if risk of hospitalization varied by age, ship type, or occupation between nuclear and conventional powered ship crews in the U.S. Navy. Study cohorts consisted of all male enlisted personnel who served exclusively aboard conventional or nuclear powered aircraft carriers and cruisers during the years 1975-1979; cases were those men hospitalized during this period (N = 48,242). Conventional ship personnel showed significantly elevated rates of injury and disease when compared to nuclear ship personnel. The largest relative risks by age occurred for conventional ship crewmen less than 30 years old. Seaman, logistics (supply), and healthcare personnel serving aboard conventional ships comprised the occupational groups exhibiting the highest hospitalization rate differentials. The results strongly suggest that nuclear ships provide a healthier, safer working and living environment than conventional ships

  4. Hydrodynamics of Ship Propellers

    DEFF Research Database (Denmark)

    Breslin, John P.; Andersen, Poul

    of an intermittently cavitating propeller in a wake and the pressures and forces it exerts on the shaft and on the ship hull is examined. A final chapter discusses the optimization of efficiency of compound propulsors. The authors have taken care to clearly describe physical concepts and mathematical steps. Appendices...

  5. SHIPPING OF RADIOACTIVE ITEMS

    CERN Multimedia

    TIS/RP Group

    2001-01-01

    The TIS-RP group informs users that shipping of small radioactive items is normally guaranteed within 24 hours from the time the material is handed in at the TIS-RP service. This time is imposed by the necessary procedures (identification of the radionuclides, determination of dose rate and massive objects require a longer procedure and will therefore take longer.

  6. Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas

    avocados on their journey from the trees in Africa, to the retail shelves in Europe, revealing the plethora of organizations, activities and documents involved. The implication being that containerized shipping becomes inefficiently; costly, unreliably, and risky. These are posited as the major impediments...

  7. Mechanics of Ship Grounding

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1996-01-01

    In these notes first a simplified mathematical model is presented for analysis of ship hull loading due to grounding on relatively hard and plane sand, clay or rock sea bottoms. In a second section a more rational calculation model is described for the sea bed soil reaction forces on the sea bott...

  8. Classification of Ship Routing and Scheduling Problems in Liner Shipping

    DEFF Research Database (Denmark)

    Kjeldsen, Karina Hjortshøj

    2011-01-01

    This article provides a classification scheme for ship routing and scheduling problems in liner shipping in line with the current and future operational conditions of the liner shipping industry. Based on the classification, the literature is divided into groups whose main characteristics...... are described. The literature within each group is reviewed, much of it for the first time....

  9. Wallops Ship Surveillance System

    Science.gov (United States)

    Smith, Donna C.

    2011-01-01

    Approved as a Wallops control center backup system, the Wallops Ship Surveillance Software is a day-of-launch risk analysis tool for spaceport activities. The system calculates impact probabilities and displays ship locations relative to boundary lines. It enables rapid analysis of possible flight paths to preclude the need to cancel launches and allow execution of launches in a timely manner. Its design is based on low-cost, large-customer- base elements including personal computers, the Windows operating system, C/C++ object-oriented software, and network interfaces. In conformance with the NASA software safety standard, the system is designed to ensure that it does not falsely report a safe-for-launch condition. To improve the current ship surveillance method, the system is designed to prevent delay of launch under a safe-for-launch condition. A single workstation is designated the controller of the official ship information and the official risk analysis. Copies of this information are shared with other networked workstations. The program design is divided into five subsystems areas: 1. Communication Link -- threads that control the networking of workstations; 2. Contact List -- a thread that controls a list of protected item (ocean vessel) information; 3. Hazard List -- threads that control a list of hazardous item (debris) information and associated risk calculation information; 4. Display -- threads that control operator inputs and screen display outputs; and 5. Archive -- a thread that controls archive file read and write access. Currently, most of the hazard list thread and parts of other threads are being reused as part of a new ship surveillance system, under the SureTrak project.

  10. Added masses of ship structures

    CERN Document Server

    Korotkin, Alexandr I

    2008-01-01

    This essentially self-contained reference book contains data on added masses of ships and various ship and marine engineering structures. Theoretical and experimental methods for determining added masses of these objects are described.

  11. Ship Observations - VOS and Navy

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Combination of Voluntary Observing Ship (VOS) and US Navy Ship weather observations. Obs generally taken 2-4 times daily at 00, 06, 12, and 18z.

  12. Trends of shipping markets development

    Directory of Open Access Journals (Sweden)

    Tomasz Nowosielski

    2012-06-01

    Full Text Available Shipping markets are dependent on international trade transactions that generate transport needs. These needs can dynamically change depending on global natural resources and commodity markets situation. The changes affecting shipping markets can also be caused by changes to the existing cargo flows and by establishing new ones in different geographies. It is anticipated that in the future shipping markets will change, visible by a decline in shipping in North America and Europe and an increase in Asia.

  13. Automatic detection of ship tracks in ATSR-2 satellite imagery

    Directory of Open Access Journals (Sweden)

    E. Campmany

    2009-03-01

    Full Text Available Ships modify cloud microphysics by adding cloud condensation nuclei (CCN to a developing or existing cloud. These create lines of larger reflectance in cloud fields that are observed in satellite imagery. An algorithm has been developed to automate the detection of ship tracks in Along Track Scanning Radiometer 2 (ATSR-2 imagery. The scheme has been integrated into the Global Retrieval of ATSR Cloud Parameters and Evaluation (GRAPE processing chain. The algorithm firstly identifies intensity ridgelets in clouds which have the potential to be part of a ship track. This identification is done by comparing each pixel with its surrounding ones. If the intensity of three adjacent pixels is greater than the intensity of their neighbours, then it is classified as a ridgelet. These ridgelets are then connected together, according to a set of connectivity rules, to form tracks which are classed as ship tracks if they are long enough. The algorithm has been applied to two years of ATSR-2 data. Ship tracks are most frequently seen off the west coast of California, and the Atlantic coast of both West Africa and South-Western Europe. The global distribution of ship tracks shows strong seasonality, little inter-annual variability and a similar spatial pattern to the distribution of ship emissions.

  14. Ship and Shoot

    Science.gov (United States)

    Woods, Ron

    2012-01-01

    Ron Woods shared incredibly valuable insights gained during his 28 years at the Kennedy Space Center (KSC) packaging Flight Crew Equipment for shuttle and ISS missions. In particular, Woods shared anecdotes and photos from various processing events. The moral of these stories and the main focus of this discussion were the additional processing efforts and effects related to a "ship-and-shoot" philosophy toward flight hardware.

  15. Global Shipping Game

    Science.gov (United States)

    2011-01-28

    CDR Ed Suraci, and Mr. Leif Bergey . Cell Support: Each cell had an assigned data collection support assistant. These personnel assisted the players...Mr. Leif Bergey (Control Cell). Ethnographers (Environmental Recorders): Employed a variety of quasi-anthropological, ethnographic techniques to...for this project was Mr. Leif Bergey . Global Shipping Game Report 20 7 / 14 7 / 5 19 / 8 3 / 10 III. ANALYSIS

  16. SHIPPING OF RADIOACTIVE ITEMS

    CERN Document Server

    TIS/RP Group

    2001-01-01

    The TIS-RP group informs users that shipping of small radioactive items is normally guaranteed within 24 hours from the time the material is handed in at the TIS-RP service. This time is imposed by the necessary procedures (identification of the radionuclides, determination of dose rate, preparation of the package and related paperwork). Large and massive objects require a longer procedure and will therefore take longer.

  17. Ship Model Testing

    Science.gov (United States)

    2016-01-15

    zero degrees angle of attack than the conventional foil at eight degrees angle of attack . This increase in lift is believed to be limited to low...Bureau of Shipping (ABS) supported this effort through the purchase of the 60 specimens used in this thesis. Metal Shark boats also provided aluminum...strength of welded aluminum panels. Metal Shark Boats, again, provided the necessary test panels for this effort. The optical extensometer was not

  18. SSI Variations in the visible as observed with SOLAR/SOLSPEC during cycle 24 - Comparison with SORCE/SIM.

    Science.gov (United States)

    Irbah, A.; Damé, L.; Meftah, M.; Bekki, S.; Bolsée, D.

    2017-12-01

    The solar spectral irradiance (SSI) and its temporal variations are of prime importance to apprehend the physics of the Sun and to understand its effects on Earth climate through changes of atmospheric properties. Ground based measurements of SSI are indeed affected by the Earth atmosphere and space observations are therefore required to perform adequate observations. Only a few long series of SSI space measurements were obtained these last decades. The SOLSPEC instrument of the SOLAR payload on the International Space Station (ISS) has recorded one of them from April 2008 to February 2017 covering almost the whole solar cycle 24. The instrument is a spectro-radiometer recording data of the Sun from 166 to 3088 nm. Operated from the ISS in a harsh environment it needed appropriate processing methods to extract significant scientific results from noise and instrumental effects. We present the methods used to process the data to evidence visible SSI variations during cycle 24. We discuss the results obtained showing SSI variations in phase with solar activity. We compare them with SORCE/SIM measurements.

  19. The role of the cerebellum in auditory processing using the SSI test A participação do cerebelo no processamento auditivo com o uso do teste SSI

    Directory of Open Access Journals (Sweden)

    Patricia Maria Sens

    2011-10-01

    Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte

  20. Analysis of a ship-to-ship collision

    International Nuclear Information System (INIS)

    Porter, V.L.; Ammerman, D.J.

    1996-01-01

    Sandia National Laboratories is involved in a safety assessment for the shipment of radioactive material by sea. One part of this study is investigation of the consequences of ship-to-ship collisions. This paper describes two sets of finite element analyses performed to assess the structural response of a small freighter and the loading imparted to radioactive material (RAM) packages during several postulated collision scenarios with another ship. The first series of analyses was performed to evaluate the amount of penetration of the freighter hull by a striking ship of various masses and initial velocities. Although these analyses included a representation of a single RAM package, the package was not impacted during the collision so forces on the package could not be computed. Therefore, a second series of analyses incorporating a representation of a row of seven packages was performed to ensure direct package impact by the striking ship. Average forces on a package were evaluated for several initial velocities and masses of the striking ship. In addition to. providing insight to ship and package response during a few postulated ship collisions scenarios, these analyses will be used to benchmark simpler ship collision models used in probabilistic risk assessment analyses

  1. Ship Roll Motion Control

    DEFF Research Database (Denmark)

    Perez, Tristan; Blanke, Mogens

    2010-01-01

    The technical feasibility of roll motion control devices has been amply demonstrated for over 100 years. Performance, however, can still fall short of expectations because of deciencies in control system designs, which have proven to be far from trivial due to fundamental performance limitations....... This tutorial paper presents an account of the development of various ship roll motion control systems and the challenges associated with their design. The paper discusses how to assess performance, the applicability of dierent models, and control methods that have been applied in the past....

  2. Operational options for green ships

    Science.gov (United States)

    Sherbaz, Salma; Duan, Wenyang

    2012-09-01

    Environmental issues and rising fuel prices necessitate better energy-efficiency in all sectors. The shipping industry is one of the major stakeholders, responsible for 3% of global CO2 emissions, 14%-15% of global NO X emissions, and 16% of global SO X emissions. In addition, continuously rising fuel prices are also an incentive to focus on new ways for better energy-effectiveness. The green ship concept requires exploring and implementing technology on ships to increase energy-efficiency and reduce emissions. Ship operation is an important topic with large potential to increase cost-and-energy-effectiveness. This paper provided a comprehensive review of basic concepts, principles, and potential of operational options for green ships. The key challenges pertaining to ship crew i.e. academic qualifications prior to induction, in-service training and motivation were discussed. The author also deliberated on remedies to these challenges.

  3. Nonlinear Time Domain Seismic Soil-Structure Interaction (SSI) Deep Soil Site Methodology Development

    International Nuclear Information System (INIS)

    Spears, Robert Edward; Coleman, Justin Leigh

    2015-01-01

    Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This

  4. Ship Creek bioassessment investigations

    Energy Technology Data Exchange (ETDEWEB)

    Cushing, C.E.; Mueller, R.P.; Murphy, M.T.

    1995-06-01

    Pacific Northwest Laboratory (PNL) was asked by Elmendorf Air Force Base (EAFB) personnel to conduct a series of collections of macroinvertebrates and sediments from Ship Creek to (1) establish baseline data on these populations for reference in evaluating possible impacts from Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) activities at two operable units, (2) compare current population indices with those found by previous investigations in Ship Creek, and (3) determine baseline levels of concentrations of any contaminants in the sediments associated with the macroinvertebrates. A specific suite of indices established by the US Environmental Protection Agency (EPA) was requested for the macroinvertebrate analyses; these follow the Rapid Bioassessment Protocol developed by Plafkin et al. (1989) and will be described. Sediment sample analyses included a Microtox bioassay and chemical analysis for contaminants of concern. These analyses included, volatile organic compounds, total gasoline and diesel hydrocarbons (EPA method 8015, CA modified), total organic carbon, and an inductive-coupled plasma/mass spectrometry (ICP/MS) metals scan. Appendix A reports on the sediment analyses. The Work Plan is attached as Appendix B.

  5. Machinery Options for Green Ship

    Directory of Open Access Journals (Sweden)

    Salma Sherbaz

    2015-10-01

    Full Text Available Shipping is critical to global economy being means of transportation for 90 % of world trade goods. Shipping continues to remain the most environmental friendly transportation option compared to other available means due to lowest gCO2/ton.km emissions. It can however not be overlooked that shipping is responsible for 3 % of global CO2 emissions, 14-15 % of global NOX emissions and 16 % of global SOX emissions. International Maritime Organization (IMO is committed to reducing shipping emissions through policy and regulatory measures. Marine Pollution (MARPOL regulations have been increasingly demanding to tackle aggravating environmental concerns. IMO has been introducing measures for better energy-effectiveness (i.e. SEEMP in addition to better environmental performance (i.e. EEDI. Green ship concepts require exploring and implementing technologies and practices on ships to reduce emissions and increase energy-efficiency. Ship machinery is an important area with large potential to reduce emissions and increase cost-and-energy-effectiveness. This paper provides a comprehensive review of the machinery options for green ship. The author will discuss basic concepts, principles and potential of machinery options for green ship in detail.

  6. ERDC Ship/Tow Simulator

    Data.gov (United States)

    Federal Laboratory Consortium — Performing Advanced Hydrodynamic ModelingEngineers and ship pilots can now overcome the challenges of evaluating navigation channel designs, modifications and safety...

  7. Present state of Japan Nuclear Ship Development Agency

    International Nuclear Information System (INIS)

    Takada, Yoshio

    1981-01-01

    The Japan Nuclear Ship Development Agency held the annual report meeting on April 8, 1981. The main contents were the plan of research and development of nuclear ships hereafter, the present state of the repair works for the nuclear ship ''Mutsu'', the progress of the selection of the new home port and others. In the last year, the function of research was given to the Agency by the revision of the related law. The full-scale repair works for Mutsu were started in August, 1980, and various equipments and shields in the containment vessel and the upper shields of the containment vessel have been removed. Subsequently, new shields are being installed. According to the report by the committee of nuclear ship research and development, the development of Mutsu, which is valuable as the experimental ship, is continued. Moreover, it is proposed to do the research and development of an improved marine nuclear plant for the purposes of securing the economic efficiency, the proving of the reliability of nuclear merchant ships, and the establishment of safety. As the home port for Mutsu, the new port will be constructed on the open sea side in Aomori Prefecture, and as a candidate, Sekine beach in Mutsu City was named. Till the completion of the new home port, Mutsu will be berthed in Ominato home port. The conditions for entering and berthing in Ominato port will be decided later. (Kako, I.)

  8. 46 CFR 154.1820 - Shipping document.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Shipping document. 154.1820 Section 154.1820 Shipping... FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Operations § 154.1820 Shipping document. No person may operate a vessel without carrying a shipping document in the wheelhouse that lists for each...

  9. Identification and quantification of shipping emissions in Bohai Rim, China

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Fan [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Chen, Yingjun, E-mail: yjchen@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Tian, Chongguo, E-mail: cgtian@yic.ac.cn [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); Wang, Xiaoping [University of Chinese Academy of Sciences, Beijing 100049 (China); State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Sciences, Guangzhou, Guangdong 510640 (China); Huang, Guopei; Fang, Yin; Zong, Zheng [Key Laboratory of Coastal Zone Environmental Processes and Ecological Remediation, Yantai Institute of Coastal Zone Research, Chinese Academy of Sciences, Yantai, Shandong 264003 (China); University of Chinese Academy of Sciences, Beijing 100049 (China)

    2014-11-01

    Rapid development of port and shipbuilding industry in China has badly affected the ambient air quality of coastal zone due to shipping emissions. A total of 60 ambient air samples were collected from background site of Tuoji Island in Bohai Sea strait. The air samples were analyzed for PM{sub 2.5}, organic carbon (OC), element carbon (EC), inorganic elements, and water-soluble ions. The maximum concentration of PM{sub 2.5} was observed during spring (73.6 μg·m{sup −3}) compared to winter (39.0 μg·m{sup −3}) with mean of 54.6 μg·m{sup −3}. Back trajectory air mass analysis together with temporal distribution of vanadium (V) showed that V could be the typical tracer of shipping emissions at Tuoji Island. Furthermore, the ratios of vanadium to nickel (V/Ni), vanadium to lead (V/Pb) and vanadium to zinc (V/Zn) also suggest shipping emissions at Tuoji Island. The annual average primary PM{sub 2.5} estimate of shipping emissions was 0.65 μg·m{sup −3} at Tuoji Island, accounting for 2.94% of the total primary PM{sub 2.5}, with a maximum of 3.16% in summer and a minimum of 2.39% in autumn. - Highlights: • Tracers of shipping emissions in coastal zone of northern China were identified. • Contributions of shipping emissions on primary PM{sub 2.5} were estimated. • Shipping emissions accounted for 2.94% of primary PM{sub 2.5} apart from fishing boats. • Impact of shipping emissions on coastal zone increased rapidly in recent years.

  10. MERCHANT MARINE SHIP REACTOR

    Science.gov (United States)

    Mumm, J.F.; North, D.C. Jr.; Rock, H.R.; Geston, D.K.

    1961-05-01

    A nuclear reactor is described for use in a merchant marine ship. The reactor is of pressurized light water cooled and moderated design in which three passes of the water through the core in successive regions of low, intermediate, and high heat generation and downflow in a fuel region are made. The foregoing design makes a compact reactor construction with extended core life. The core has an egg-crate lattice containing the fuel elements confined between a lower flow baffle and upper grid plate, with the latter serving also as part of a turn- around manifold from which the entire coolant is distributed into the outer fuel elements for the second pass through the core. The inner fuel elements are cooled in the third pass.

  11. Ship Roll Damping Control

    DEFF Research Database (Denmark)

    Perez, Tristan; Blanke, Mogens

    2012-01-01

    The technical feasibility of roll motion control devices has been amply demonstrated for over 100 years. Performance, however, can still fall short of expectations because of difficulties associated with control system designs, which have proven to be far from trivial due to fundamental performance...... limitations and large variations of the spectral characteristics of wave-induced roll motion. This tutorial paper presents an account of the development of various ship roll motion control systems together with the challenges associated with their design. It discusses the assessment of performance...... and the applicability of different mathematical models, and it surveys the control methods that have been implemented and validated with full scale experiments. The paper also presents an outlook on what are believed to be potential areas of research within this topic....

  12. Resistance to Dialogic Discourse in SSI Teaching: The Effects of an Argumentation-Based Workshop, Teaching Practicum, and Induction on a Preservice Science Teacher

    Science.gov (United States)

    Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan

    2017-01-01

    Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…

  13. Ship exhaust gas plume cooling

    NARCIS (Netherlands)

    Schleijpen, H.M.A.; Neele, P.P.

    2004-01-01

    The exhaust gas plume is an important and sometimes dominating contributor to the infrared signature of ships. Suppression of the infrared ship signatures has been studied by TNO for the Royal Netherlands Navy over considerable time. This study deals with the suppression effects, which can be

  14. NATO Standards for Virtual Ships

    NARCIS (Netherlands)

    Kraker, J.K. de; Reading, R.

    2005-01-01

    The NATO Naval Armaments Group Sub-Group 61 on Virtual Ships has been chartered to establish NATO standards for modelling and simulation applied to ship acquisition. Its objective is to enable multi-national simulation re-use and interoperability, as well as simulation composability. Technical

  15. NATO Standards for Virtual Ships

    NARCIS (Netherlands)

    Kraker, J.K. de; Duncan, J.; Budde, E.W.; Reading, R.

    2005-01-01

    The NATO Naval Armaments Group Sub-Group 61 on Virtual Ships has been chartered to establish NATO standards for modeling and simulation applied to ship acquisition. Its objective is to enable multi-national simulation re-use and interoperability, as well as simulation composability. Technical

  16. Navy Hospital ships in history

    Directory of Open Access Journals (Sweden)

    Sougat Ray

    2017-01-01

    Full Text Available Hospital ships are operated by the Naval forces in or near war zones to provide medical assistance to the wounded personnel of all nationalities and not be used for any military purpose. Hospital ships possibly existed in ancient times and the Athenian Navy had a ship named Therapia. However, it was only during the 17th century that it became a common practice for the naval squadrons to be accompanied by large ships with the facilities of carrying the wounded after each engagement. In 1860, the steamships HMS Melbourne and HMS Mauritius were equipped with genuine medical facilities. They were manned by the Medical Staff Corps and provided services to the British expedition to China. During the World War I and World War II, passenger ships were converted for use as hospital ships and were started to be used on a massive scale. RMS Aquitania and HMHS Britannic were two famous examples of hospital ships used extensively. Modern US hospital ships USNS Mercy and USNS Comfort are operated by Military Sealift Command of the US Navy. Their primary mission is to provide emergency on-site care for US combatant forces deployed in war or other operations.

  17. Identification of Dynamically Positioned Ships

    Directory of Open Access Journals (Sweden)

    Thor I. Fossen

    1996-04-01

    Full Text Available Todays model-based dynamic positioning (DP systems require that the ship and thruster dynamics are known with some accuracy in order to use linear quadratic optical control theory. However, it is difficult to identify the mathematical model of a dynamically posititmed (DP ship since the ship is not persistently excited under DP. In addition the ship parameter estimation problem is nonlinear and multivariable with only position and thruster state measurements available for parameter estimation. The process and measurement noise must also be modeled in order to avoid parameter drift due to environmental disturbances and sensor failure. This article discusses an off-line parallel extended Kalman filter (EKF algorithm utilizing two measurement series in parallel to estimate the parameters in the DP ship model. Full-scale experiments with a supply vessel are used to demonstrate the convergence and robustness of the proposed parameter estimator.

  18. Occupational accidents aboard merchant ships

    DEFF Research Database (Denmark)

    Hansen, H.L.; Nielsen, D.; Frydenberg, Morten

    2002-01-01

    aboard. Relative risks for notified accidents and accidents causing permanent disability of 5% or more were calculated in a multivariate analysis including ship type, occupation, age, time on board, change of ship since last employment period, and nationality. Foreigners had a considerably lower recorded...... identified during a total of 31 140 years at sea. Among these, 209 accidents resulted in permanent disability of 5% or more, and 27 were fatal. The mean risk of having an occupational accident was 6.4/100 years at sea and the risk of an accident causing a permanent disability of 5% or more was 0.67/100 years...... rate of accidents than Danish citizens. Age was a major risk factor for accidents causing permanent disability. Change of ship and the first period aboard a particular ship were identified as risk factors. Walking from one place to another aboard the ship caused serious accidents. The most serious...

  19. Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC

    Energy Technology Data Exchange (ETDEWEB)

    Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)

    2000-07-01

    The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)

  20. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    International Nuclear Information System (INIS)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches

  1. Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97

    Energy Technology Data Exchange (ETDEWEB)

    Hora, Stephen

    2002-09-01

    The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.

  2. Framing student dialogue and argumentation: Content knowledge development and procedural knowing in SSI inquiry group work

    Directory of Open Access Journals (Sweden)

    Anne Kristine Byhring

    2014-10-01

    Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.

  3. The final Galileo SSI observations of Io: Orbits G28-I33

    Science.gov (United States)

    Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.

    2004-01-01

    We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.

  4. Incorporating higher order WINKLER springs with 3-D finite element model of a reactor building for seismic SSI analysis

    International Nuclear Information System (INIS)

    Ermutlu, H.E.

    1993-01-01

    In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained

  5. 20 CFR 416.1835 - Information we need about separation or end of marriage after you become eligible for SSI.

    Science.gov (United States)

    2010-04-01

    ... of marriage after you become eligible for SSI. 416.1835 Section 416.1835 Employees' Benefits SOCIAL... Considered Your Spouse § 416.1835 Information we need about separation or end of marriage after you become...) Evidence of end of marriage—(1) Death. We will accept your statement that your husband or wife died unless...

  6. TOTAL annual report 2003

    International Nuclear Information System (INIS)

    2004-01-01

    This 2003 annual report of the Group Total provides economical results and information of the society on the following topics: keys data, the corporate governance (Directors charter, board of directors, audit committee, nomination and remuneration committee, internal control procedures, compensation of directors and executive officers), the corporate social responsibility (environmental stewardship, the future of energy management, the safety enhancement, the human resources, ethics and local development), the investor relations, the management report, the upstream exploration and production, the downstream refining, marketing, trading and shipping, the chemicals and financial and legal information. (A.L.B.)

  7. Bio-indications of sunken ships and ship wrecks

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.

    An evaluation of bottom fauna of ship-wreck sites in estuarine and coastal waters of Goa, India, revealed an exceptionally high biotic enrichment. In terms of number of species, faunal dispersion, faunal diversity, biomass and productivity, in space...

  8. Single liner shipping service design

    DEFF Research Database (Denmark)

    Plum, Christian Edinger Munk; Pisinger, David; Salazar-González, Juan-José

    2014-01-01

    The design of container shipping networks is an important logistics problem, involving assets and operational costs measured in billions of dollars. To guide the optimal deployment of the ships, a single vessel round trip is considered by minimizing operational costs and flowing the best paying...... demand under commercially driven constraints. This paper introduces the Single Liner Shipping Service Design Problem. Arc-flow and path-flow models are presented using state-of-the-art elements from the wide literature on pickup and delivery problems. A Branch-and-Cut-and-Price algorithm is proposed...

  9. Neutrino physics with SHIP

    CERN Document Server

    van Herwijnen, Eric

    2016-01-01

    SHIP is a new general purpose fixed target facility, whose Technical Proposal has been recently reviewed by the CERN SPS Committee. It recommended that the experiment proceed further to a Comprehensive Design phase. In its initial phase, the 400 GeV proton beam extracted from the SPS will be dumped on a heavy target with the aim of integrating 2×1020 POT (Protons On Target) in 5 years. A dedicated detector, based on a long vacuum tank followed by a spectrometer and particle identification detectors, will allow probing a variety of models with light long-lived exotic particles and masses below O(10) GeV/c 2 . The main focus will be the physics of the so-called Hidden Portals. The sensitivity to Heavy Neutrinos will allow to probe for the first time the mass range between the kaon and the charm meson mass, and a range of couplings for which Baryogenesis and active neutrino masses could also be explained. Another dedicated detector will allow the study of neutrino cross-sections and angular distributions. ντ ...

  10. Ship Repair Workflow Cost Model

    National Research Council Canada - National Science Library

    McDevitt, Mike

    2003-01-01

    The effects of intermittent work patterns and funding on the costs of ship repair and maintenance were modeled for the San Diego region in 2002 for Supervisor of Shipbuilding and Repair (SUPSHIP) San Diego...

  11. Potential risks of nuclear ships

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1994-07-01

    This report represents an attempt to evaluate the potential risks of nuclear ships. Firstly reasons are given why nuclear ship accidents will not lead to accidents of the magnitude of the Chernobyl accident. This is due to much lower content of radioactive material and to different reactor designs. Next a review is given of the types of accidents which have actually occurred. Of these the reactor accidents which may lead to serious consequences for the crew and the environment are considered further. These are reactivity accidents and loss of coolant accidents. In addition the long term risks of sunken nuclear ships and sea disposed reactor compartments etc. are also discussed. Based on available accident data an attempt is made to estimate the probability of serious nuclear ship accidents. (au)

  12. Travelers' Health: Cruise Ship Travel

    Science.gov (United States)

    ... Travel Chapter 6 - Death during Travel Cruise Ship Travel Joanna J. Regan, Kara Tardivel, Susan A. Lippold, ... Insurance, & Medical Evacuation Insurance ). Box 6-01. Cruise travel health precautions ADVICE FOR CLINICIANS GIVING PRETRAVEL CRUISE ...

  13. The Surface Warfare Test Ship

    Science.gov (United States)

    2000-01-26

    reactivated, resulting in algae in the tanks and tank seepage. This has led to degraded fuel quality and fuel leakage into ship’s storerooms. The inherent...The cosmetic bulkhead is smooth like line 1; only 1 % of the reflected power is reflected along the sea surface. 4. Angled Bulkhead around Fantail... algae present and require continuous treatment to prevent fouling of the main engines and generators. The ship s tank system was not properly

  14. TMI-2 spent fuel shipping

    International Nuclear Information System (INIS)

    Quinn, G.J.; Burton, H.M.

    1985-01-01

    TMI-2 failed fuel will be shipped to the Idaho National Engineering Laboratory for use in the DOE Core Examination Program. The fuel debris will be loaded into three types of canisters during defueling and dry loaded into a spent fuel shipping cask. The cask design accommodates seven canisters per cask and has two separate containment vessels with ''leaktight'' seals. Shipments are expectd to begin in early 1986

  15. Reduction in driveline infection rates: Results from the HeartMate II Multicenter Driveline Silicone Skin Interface (SSI) Registry.

    Science.gov (United States)

    Dean, David; Kallel, Faouzi; Ewald, Gregory A; Tatooles, Antony; Sheridan, Brett C; Brewer, Robert J; Caldeira, Christian; Farrar, David J; Akhter, Shahab A

    2015-06-01

    During left ventricular assist device implantation, a surgical tunneling technique to keep the entire driveline (DL) velour portion in the subcutaneous tunnel, resulting in a silicone-skin interface (SSI) at the exit site, has been adopted by many centers. To assess long-term freedom from DL infection associated with this technique, a multicenter SSI registry was initiated. It was hypothesized that the modified tunneling technique is associated with at least 50% reduction in DL infection at 1 year post-implant compared with the velour-to-skin method used in the HeartMate II (HMII) Destination Therapy (DT) trial. SSI is a retrospective and prospective registry of patients who have received the HMII device. Results are reported from the retrospective cohort, which consists of 200 patients who were implanted during the period 2009-2012 with the SSI tunneling method and on HMII support for at least 10 months at the time of enrollment. The prevalence and incidence of DL infection after left ventricular assist device implantation in the SSI retrospective cohort were determined and compared with a control group of 201 patients also on HMII support for at least 10 months from the HMII DT clinical trial who were implanted during the period 2007-2009 using the traditional method in which a small section of the velour portion of the DL was externalized. The 1-year and 2-year prevalence rates of DL infection were 9% and 19% in the SSI patient group compared with 23% and 35% in the control group (hazard ratio 0.49, 95% confidence interval 0.33-0.73, p multivariate analysis, age and DL exit side were the only independent variables associated with DL infection. Effects of management changes over the eras were not studied and could have contributed to the findings. These results suggest that leaving the entire DL velour portion below the skin is associated with 50% reduction in DL infection compared with results from the HMII DT trial. Copyright © 2015 International Society for

  16. SKI's and SSI's review of SKB's safety report SR-Can

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Stroemberg, Bo

    2008-03-01

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality

  17. Annual report 1977

    International Nuclear Information System (INIS)

    1978-01-01

    The GKSS (Society for the Utilization of Nuclear Energy in Shipbuilding and Nautics) gives in this annual report a comprehensive survey of the research and development efforts carried out and a survey on the organisation and its sociological position. More detailed and generally explicable presentations of selected spheres of research deal this year with solid combustible neutron poisons, water desalination systems, pollution at the Elbe-mouth, trace analysis with x-ray fluor essence, heat conduction in water and under-water systems. The research and development programme is, in comparison with previous years better understandable. The range of tasks, 'utilization of nuclear energy', especially covers projects on the field of reactor safety research which were comprised in one project and fully integrated in the reactor safety programme of the Fed. Ministry for Research and Technology. Furthermore, nuclear energy ship development and works concerning working material technology are being carried out, to a smaller extent. The project of a nuclear container ship which run over a period of 5 years, was finished in 1977. Profitability calculations show that nuclear trade ships can be used in a profitable way, when the oil price has increased three-fold. This might be the case in about 15-20 years. Further plans of the GKSS on the field of nuclear energy ship development take into account this result. The range of tasks 'utilization of the sea and the shores' was comprised in a frame programme and divided in the research, fields of environment technique, water desalination, resources, and sea technique. These works are, beside reactor safety research, the main range of works of the GKSS. (orig./HK) [de

  18. PrimeShip-ASSAS: Advanced Ship Structural Analysis and Validation System

    OpenAIRE

    Yasuharu, Tsutsui; Takuya, Yoneya; Toshiro, Koiwa; Toshiro, Arima; Shin-ichi, Yamashita; Abdul M., Rahim; Technical Investigation and Information Department; Technical Investigation and Information Department; Technical Investigation and Information Department; Research Institute; Technical Investigation and Information Department; Technical Investigation and Information Department

    1996-01-01

    The Society has been establishing a total assessment system for ship hull structures with the aim of realizing consistent hull structural assessment over the life cycle of ships. It comprises a comprehensive computer software system intended to support advanced ship structural design and assessment. This system called PrimeShip-ASSAS, the Advanced Ship Structural Analysis and Validation System, is outlined in this paper.

  19. Análise da versão espanhola do Sport Satisfaction Instrument (SSI adaptado à Educação Física Analysis of the Spanish version of the Sport Satisfaction Instrument (SSI adapted to Physical Education

    Directory of Open Access Journals (Sweden)

    Antonio Granero-Gallegos

    2013-03-01

    Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.

  20. SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results

    Directory of Open Access Journals (Sweden)

    Francesca Ceroni

    2014-11-01

    Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.

  1. The systemic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho's report for project RISCOM

    International Nuclear Information System (INIS)

    Espejo, R.; Gill, A.

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions

  2. Simplified Analysis Tool for Ship-Ship Collision

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Pedersen, Preben Terndrup

    2007-01-01

    The purpose of this paper is to develop a simplified ship collision analysis tool in order to rapidly estimate the structural damage and energy absorption of both striking and struck ships as well as prediction of rupture of cargo oil tanks of struck tankers. The present tool calculates external...... to the collision scenario thatwhere a VLCC in ballast condition collides perpendicularly with the mid part of another D/H VLCC in fully loaded condition. The results obtained from the present tool are compared with those obtained by large scale FEA, and fairy good agreements are achieved. The applicability...

  3. Effect of Buffer Bow Structure in Ship-Ship Collision

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup

    2008-01-01

    A disastrous oil spill from a struck oil tanker has become one of the major problems in view of conservation of maritime environment. So far double hulls (D/H) have been introduced to reduce the consequences of collision and grounding events In order to further reduce the oil spill from struck oil...... structure in ship-ship collisions as compared with that of standard bulbous bows. This is demonstrated by conducting a series of large-scale finite element analyses. The finite element analyses are conducted with the general-purpose nonlinear structural code “LS-DYNA”. The applied scenario is one where...

  4. Accidents on ships in the Danish International Ship register

    DEFF Research Database (Denmark)

    Ádám, Balázs; Rasmussen, Hanna Barbara

    to report accidents causing at least one day off work beyond the day of accident but the first source contains several accidents not fulfilling this criterion, too. Radio Medical is an independent service where all Danish ships may seek medical advice. The data sets were merged by identification number...... of our study is to describe trend of accidents and their contributing factors, with special focus on nationality, occurring in ships under Danish flag in the period 2010-2012. The study used two independent data sources, the Danish Maritime Authority and the Danish Radio Medical. It is mandatory...

  5. SOCIOSCIENTIFIC ISSUES (SSI IN REACTION RATES TOPIC AND ITS EFFECT ON THE CRITICAL THINKING SKILLS OF HIGH SCHOOL STUDENTS

    Directory of Open Access Journals (Sweden)

    Y. N. Pratiwi

    2016-10-01

    Full Text Available The aim of this research was to investigate the difference in students’ critical thinking which learnt cooperatively using different learning context. Quasy experimental postest only control group design was chosen as experimental design using two equivalent classes as the sample. The first class (15 MIA 5, n = 30 was taught using socioscientific issues (SSI as the learning context and the second one (15 MIA 6, n = 30 was not. The research instrument was a test consisted of 16 items of multiple choice questionsdeveloped based on Ennis’ critical thinking indicators. This instrument have been validated and its reliability approved with r = 0,765. Students’ post-test scores were analyzed using t-test with SPSS 16 for Windows. The result showed that statistically students’ critical thinking skills betweentwo classes was significanly different (Asym. Sig = 0,037. Students who taught using SSI have higher score (73,96 than the one wasn’t (66,04. Result shows that using socioscientific issues (SSI as learning context has significant effect on high school students’ critical thinking skills.

  6. EX1001 Ship Shakedown (EX1001, EM302) on NOAA Ship Okeanos Explorer in Hawaiian Islands

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The ship has been alongside for repairs and leave since November, 2009. The ship shakedown cruise is scheduled to provide an opportunity for the ship to get underway...

  7. The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions

    Science.gov (United States)

    Li, Q.

    2016-12-01

    The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study

  8. On Grounding of Fast Ships

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup; Pedersen, Preben Terndrup

    1997-01-01

    The paper deals with analysis of grounding of high-speed crafts. It is the purpose to present a comprehensive mathematical model for calculation of the overall dynamic ship response during grounding. This procedure is applied to derive the motions, the time varying sectional forces and the local...... loads during grounding on plane, sloping, sandy bottoms for six different designs of fast monohull ships made from steel, aluminium or GRP sandwich materials. The results show that the effect of the hull flexibility is to reduce the overall dynamic sectional loads on the hull girder. The considered...... numerical examples also indicate that, even with impact speeds of 40 knots against a 1:10 sloping bottom, the global strength of the hull girder is not exceeded by the grounding induced loads.For the local deformation of high-speed ship hulls at the point of contact with the ground, the paper presents...

  9. Ships - inspiring objects in architecture

    Science.gov (United States)

    Marczak, Elzbieta

    2017-10-01

    Sea-going vessels have for centuries fascinated people, not only those who happen to work at sea, but first and foremost, those who have never set foot aboard a ship. The environment in which ships operate is reminiscent of freedom and countless adventures, but also of hard and interesting maritime working life. The famous words of Pompey: “Navigare necesseest, vivere non estnecesse” (sailing is necessary, living - is not necessary), which he pronounced on a stormy sea voyage, arouse curiosity and excitement, inviting one to test the truth of this saying personally. It is often the case, however, that sea-faring remains within the realm of dreams, while the fascination with ships demonstrates itself through a transposition of naval features onto land constructions. In such cases, ship-inspired motifs bring alive dreams and yearnings as well as reflect tastes. Tourism is one of the indicators of people’s standard of living and a measure of a society’s civilisation. Maritime tourism has been developing rapidly in recent decades. A sea cruise offers an insight into life at sea. Still, most people derive their knowledge of passenger vessels and their furnishings from the mass media. Passenger vessels, also known as “floating cities,” are described as majestic and grand, while their on-board facilities as luxurious, comfortable, exclusive and inaccessible to common people on land. Freight vessels, on the other hand, are described as enormous objects which dwarf the human being into insignificance. This article presents the results of research intended to answer the following questions: what makes ships a source of inspiration for land architecture? To what extent and by what means do architects draw on ships in their design work? In what places can we find structures inspired by ships? What ships inspire architects? This article presents examples of buildings, whose design was inspired by the architecture and structural details of sea vessels. An analysis of

  10. Quality management in shipping companies

    Directory of Open Access Journals (Sweden)

    Đergović Dragana M.

    2017-01-01

    Full Text Available As international business becomes more competitive, companies are finding that they need to work more effectively to stay in business. Quality assurance has become very important to the majority of production and service companies with international activity. Shipping companies were also required to implement a quality management system. The huge importance of safety in maritime transport operations resulted in the International Safety Management Code (ISM Code by the International Maritime Organization. The general management system principles embodied by the maritime ISM Code and generics ISO standards, have enabled their complementary application in establishing a quality management system in shipping companies, within a safety management system as its subset.

  11. Wind Forces on Container Ships

    DEFF Research Database (Denmark)

    Andersen, Ingrid Marie Vincent

    2012-01-01

    An investigation of the wind forces acting on a 9,000+ TEU container ship has been carried out through a series of wind tunnel tests. It was investigated how the wind forces depend on the container configuration on the deck using a 1:450 scale model and a series of appropriate container...... are presented as nondimensional coefficients. It is concluded, that the measured forces and moment depend on the container configuration on deck, and the results may provide a general idea of how the magnitude of the wind forces is affected by a given container stacking configuration on a similar container ship....

  12. Mining the chemical quarry with joint chemical probes: an application of latent semantic structure indexing (LaSSI) and TOPOSIM (Dice) to chemical database mining.

    Science.gov (United States)

    Singh, S B; Sheridan, R P; Fluder, E M; Hull, R D

    2001-05-10

    In this study we use a novel similarity search technique called latent semantic structure indexing (LaSSI) with joint chemical probes as queries to mine the MDL drug data report database. LaSSI is based on latent semantic indexing developed for searching textual databases. We use atom pair and topological torsion descriptors in our calculations. The results obtained with LaSSI are compared with another in-house similarity search technique TOPOSIM. The results from the similarity searches using joint chemical probes are significantly better than searches using single chemical probes for both LaSSI and TOPOSIM. The selected molecules are closely related in activity to their queries and are ranked among the top 300 scoring molecules of the 82 860 entries in the database. Our implementation of LaSSI is very fast and efficient in finding active compounds. The results also show that LaSSI consistently retrieves more diverse chemical structures representative of the joint chemical probes in comparison to TOPOSIM. The use of multimolecule topological probes to identify compounds complements the use of searching databases with 3D pharmacophore hypotheses.

  13. A soluble starch synthase I gene, IbSSI, alters the content, composition, granule size and structure of starch in transgenic sweet potato.

    Science.gov (United States)

    Wang, Yannan; Li, Yan; Zhang, Huan; Zhai, Hong; Liu, Qingchang; He, Shaozhen

    2017-05-24

    Soluble starch synthase I (SSI) is a key enzyme in the biosynthesis of plant amylopectin. In this study, the gene named IbSSI, was cloned from sweet potato, an important starch crop. A high expression level of IbSSI was detected in the leaves and storage roots of the sweet potato. Its overexpression significantly increased the content and granule size of starch and the proportion of amylopectin by up-regulating starch biosynthetic genes in the transgenic plants compared with wild-type plants (WT) and RNA interference plants. The frequency of chains with degree of polymerization (DP) 5-8 decreased in the amylopectin fraction of starch, whereas the proportion of chains with DP 9-25 increased in the IbSSI-overexpressing plants compared with WT plants. Further analysis demonstrated that IbSSI was responsible for the synthesis of chains with DP ranging from 9 to 17, which represents a different chain length spectrum in vivo from its counterparts in rice and wheat. These findings suggest that the IbSSI gene plays important roles in determining the content, composition, granule size and structure of starch in sweet potato. This gene may be utilized to improve the content and quality of starch in sweet potato and other plants.

  14. On the Global Ship Hull Bending Energy in Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Li, Y.

    2004-01-01

    During ship collisions part of the kinetic energy of the involved vessels prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can be stored in elastic...

  15. On the global ship hull bending energy in ship collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Li, Yujie

    2009-01-01

    During ship collisions part of the kinetic energy of the involved vessels immediately prior to contact is absorbed as energy dissipated by crushing of the hull structures, by friction and by elastic energy. The purpose of this report is to present an estimate of the elastic energy that can...

  16. Visualization of Ship Risk Profiles for the Shipping Industry

    NARCIS (Netherlands)

    S. Knapp (Sabine); M. van de Velden (Michel)

    2010-01-01

    textabstractThis article uses correspondence analysis to visualize risk profiles and their changes over the time period 1977 to 2008. It is based on a unique dataset which combines incident data and ship particular data. The risk profiles can help stakeholders better understand the relationship of

  17. Automated Planning for Liner Shipping Fleet Repositioning

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller; Kroer, Christian

    2012-01-01

    The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs that are a ......The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs...

  18. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    Energy Technology Data Exchange (ETDEWEB)

    Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session

  19. Expert judgements in performance assessments. Report of an SKI/SSI seminar

    International Nuclear Information System (INIS)

    Wilmot, R.D.; Galson, D.A.; Hora, S.C.

    2000-09-01

    Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to

  20. 40 CFR 262.56 - Annual reports.

    Science.gov (United States)

    2010-07-01

    ... used, the total amount of waste shipped and number of shipments pursuant to each notification; (5... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) STANDARDS APPLICABLE TO GENERATORS OF HAZARDOUS WASTE Exports of Hazardous Waste § 262.56 Annual reports. (a) Primary...

  1. Potential of Winkler type platform models for SSI problems considering flexibility of base mat

    International Nuclear Information System (INIS)

    Tyapin, Alexander

    2013-01-01

    Highlights: • Base mat's flexibility affects different seismic response parameters in different ways. • The most sensitive are the internal seismic response forces in the base mat itself. • Vertical response accelerations in the centers of the rooms are sensitive too. • Shaped Winkler model generally gives better results than the conventional flat one. • Even shaped Winkler model cannot reproduce the response in two sensitive formats. -- Abstract: Linear soil-structure interaction (SSI) analysis seems to be well understood nowadays and can be performed, for example, by convenient combined asymptotic method (CAM). However, CAM is asymptotically accurate for rigid base mats only – this is a limitation. So, the additional research is needed to find out (a) what is the impact of the base mat's flexibility to the seismic response; (b) how can one account for this impact using the conventional tools. In the first part of the paper a sample “wave” solution is obtained in the frequency domain using SASSI2000 code, without CAM at all. Different formats of the seismic response (e.g., in-structure response spectra, soil-structure interaction forces, in-structure internal forces) have proved to have different sensitivity to the base mat's flexibility. In the second part of the paper this wave solution is a benchmark for the different “platform” models with “soil” springs and dashpots distributed over the base mat (this is a broad definition of Winkler type model). Different shapes of distribution, starting from the conventional Winkler's flat shape and up to the “optimal” shape, are compared to each other in the second part of the paper. It is shown that even the most advanced “shaped” models of the Winkler type are limited in their ability to reproduce seismic response in the most sensitive format – the internal forces in the mat. This is the result of (a) local nature of Winkler's model, and (b) frequency independence of its’ parameters

  2. Real-Time Simulation of Ship-Structure and Ship-Ship Interaction

    DEFF Research Database (Denmark)

    Lindberg, Ole; Glimberg, Stefan Lemvig; Bingham, Harry B.

    2013-01-01

    condition and higher-order accurate numerical approximations. The equations presented facilitate both Neumann-Kelvin and double-body linearizations. The body boundary condition on the ship hull is approximated by a static and dynamic moving pressure distribution. The pressure distribution method is used......, because it is simple, easy to implement and computationally efficient. Multiple many-core graphical processing units (GPUs) are used for parallel execution and the model is implemented using a combination of C/C++, CUDA and MPI. Two ship hydrodynamic cases are presented: Kriso Container Carrier at steady...

  3. Rudder roll stabilization for ships

    NARCIS (Netherlands)

    van Amerongen, J.; van der Klugt, P.G.M.; van Nauta lemke, H.R.

    1990-01-01

    This paper describes the design of an autopilot for rudder roll stabilization for ships. This autopilot uses the rudder not only for course keeping but also for reduction of the roll. The system has a series of properties which make the controller design far from straightforward: the process has

  4. Designing Indonesian Liner Shipping Network

    Directory of Open Access Journals (Sweden)

    Armand Omar Moeis

    2017-06-01

    Full Text Available As the largest archipelago nation in the world, Indonesia’s logistics system has not shown excellence according to the parameters of logistics performance index and based on logistics costs percentages from overall GDP. This is due to the imbalances of trading on the western and eastern regions in Indonesia, which impacts the transportation systems costs to and from the eastern regions. Therefore, it is imperative to improve the competitiveness of Indonesian maritime logistics through maritime logistics network design. This research will focus on three levels of decision making in logistics network design, which include type of ships in the strategic level, shipping routes in the tactical level, and container allocation in the operational level with implementing butterfly routes in Indonesia’s logistics networking problems. Furthermore, this research will analyze the impact of Pendulum Nusantara and Sea Toll routes against the company profits and percentages of containers shipped. This research will also foresee how demand uncertainties and multi-period planning should affect decision making in designing the Indonesian Liner Shipping Network.

  5. Legal risk management in shipping

    DEFF Research Database (Denmark)

    Siig, Kristina

    The book discusses the most typical legal challenges met in the chartering, broker, agent or port management part of the shipping industry. It discusses these issues in both English and Scandinavian law and gives indications on how to best ensure your legal risk management in these parts...

  6. LNG demand, shipping will expand through 2010

    International Nuclear Information System (INIS)

    True, W.R.

    1998-01-01

    The 1990s, especially the middle years, have witnessed a dramatic turnaround in the growth of liquefied-natural-gas demand which has tracked equally strong natural-gas demand growth. This trend was underscored late last year by several annual studies of world LNG demand and shipping. As 1998 began, however, economic turmoil in Asian financial markets has clouded near-term prospects for LNG in particular and all energy in general. But the extent of damage to energy markets is so far unclear. A study by US-based Institute of Gas Technology, Des Plaines, IL, reveals that LNG imports worldwide have climbed nearly 8%/year since 1980 and account for 25% of all natural gas traded internationally. In the mid-1970s, the share was only 5%. In 1996, the most recent year for which complete data are available, world LNG trade rose 7.7% to a record 92 billion cu m, outpacing the overall consumption for natural gas which increased 4.7% in 1996. By 2015, says the IGT study, natural-gas use would surpass coal as the world''s second most widely used fuel, after petroleum. Much of this growth will occur in the developing countries of Asia where gas use, before the current economic crisis began, was projected to grow 8%/year through 2015. Similar trends are reflected in another study of LNG trade released at year end 1997, this from Ocean Shipping Consultants Ltd., Surrey, U.K. The study was done too early, however, to consider the effects of the financial problems roiling Asia

  7. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64); SSI:s granskning av SKB:s storregionala grundvattenmodellering foer oestra Smaaland (SKB Rapport 06-64)

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjorrn

    2007-09-15

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.

  8. New Zealand code for nuclear powered shipping

    International Nuclear Information System (INIS)

    1976-06-01

    This report recommends guidelines for the safety precautions and procedures to be implemented when New Zealand ports and approaches are used by nuclear powered merchant ships and nuclear powered naval ships

  9. Logistical Analysis of the Littoral Combat Ship

    National Research Council Canada - National Science Library

    Rudko, David

    2003-01-01

    The purpose of the Littoral Combat Ship (LCS) is to provide the Navy with an affordable, small, multi-mission ship capable of independent, interdependent, and integrated operations inside the littorals...

  10. Added masses of ship structures (russian)

    CERN Document Server

    Korotkin, Alexandr I

    2008-01-01

    This essentially self-contained reference book contains data on added masses of ships and various ship and marine engineering structures. Theoretical and experimental methods for determining added masses of these objects are described.

  11. A merchant ship size optimization model

    OpenAIRE

    Choi, Ki-Chul

    1983-01-01

    Approved for public release; distribution in unlimited. This paper analyzes how a shipowner or charterer may determine the specification of optimal ship size for a given route with respect to certain market requirements . The theory of optimal ship size, a methodology for estimating scale economics, and the various factors affecting ship size are examined using a typical conventional cargo ship and bulk cargo carriers based on shipowners ' cost data. http://archi...

  12. Analysis of ship deformation under sailing

    OpenAIRE

    Xiuwen, Shan; Lixiang, Sun; Yi, Pu; Chuncheng, Xu

    2018-01-01

    With the help of the three-dimensional potential flow theory and the hydrodynamic analysis of the loaded ship, the wave pressure distribution and the design wave parameters of the ship under loading conditions have been analyzed. Using the method of AQWA and ANSYS co-simulation, the stress level, stress distribution and deformation of the whole ship under loading conditions are obtained. The numerical analysis results can provide an effective basis for the assessment of ship navigation safety.

  13. Note from the radioprotection group's shipping service

    CERN Multimedia

    2006-01-01

    The service for the import/export of radioactive materials reminds you that shipping requests for potentially radioactive materials must be made via the EDH request form by ticking the box 'radioactive material'. All the necessary information is given on the web site: http://cern.ch/service-rp-shipping Requests not complying with the above procedure will not be taken into account. Radioactive Shipping Service http://cern.ch/service-rp-shipping Tel. 73171 Fax: 69200

  14. Annual report 1999-2000

    International Nuclear Information System (INIS)

    2000-01-01

    This annual report describes the duties and responsibilities of the Ship-source Oil Pollution (SOPF) Administrator of Canada, which includes investigating and assessing all claims filed against SOPF, and reviewing the activities of the the International Oil Pollution Compensation (IOPC) Fund in his capacity as leader of the Canadian delegation to the Assembly of IOPC Funds. The annual review also provides a summary of all active Canadian ship-source oil spill claims. A variety of issues and challenges facing SOPF are highlighted. Among these are the Arctic Response Strategy of the Canadian Coast Guard; port reception facilities for oily waste; illegal discharge of oily waste at sea; oil spill response regime changes; limitations of ship-owners' liability; and changes in IOPC regime and its impact on SOPF. Various visits to Canadian response organizations, and attendance by the SOPF Administrator during the year at seminars on oil spills, freshwater spills, and natural resource damage assessment are reviewed. There is also a review of SOPF financial obligations to the IOPC Fund, and a summary of expenditures incurred. Appendices contain extended summaries of the International Compensation regime, brief summaries of the meetings of the 1971 and the 1992 IOPC Fund Executive Committee and Assembly sessions, changes introduced by the 1992 protocols, and lists of contracting states to the 1992 and the 1969/1971 protocols. 6 appendices

  15. 19 CFR 4.69 - Shipping articles.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Shipping articles. 4.69 Section 4.69 Customs... VESSELS IN FOREIGN AND DOMESTIC TRADES Foreign Clearances § 4.69 Shipping articles. No vessel of the U.S... officer, of the shipping articles agreements, including any seaman's allotment agreement, required by 46 U...

  16. Underwater radiated noise from modern commercial ships.

    Science.gov (United States)

    McKenna, Megan F; Ross, Donald; Wiggins, Sean M; Hildebrand, John A

    2012-01-01

    Underwater radiated noise measurements for seven types of modern commercial ships during normal operating conditions are presented. Calibrated acoustic data (autonomous seafloor-mounted acoustic recorder were combined with ship passage information from the Automatic Identification System. This approach allowed for detailed measurements (i.e., source level, sound exposure level, and transmission range) on ships of opportunity. A key result was different acoustic levels and spectral shapes observed from different ship-types. A 54 kGT container ship had the highest broadband source level at 188 dB re 1 μPa@1m; a 26 kGT chemical tanker had the lowest at 177 dB re 1 μPa@1m. Bulk carriers had higher source levels near 100 Hz, while container ship and tanker noise was predominantly below 40 Hz. Simple models to predict source levels of modern merchant ships as a group from particular ship characteristics (e.g., length, gross tonnage, and speed) were not possible given individual ship-type differences. Furthermore, ship noise was observed to radiate asymmetrically. Stern aspect noise levels are 5 to 10 dB higher than bow aspect noise levels. Collectively, these results emphasize the importance of including modern ship-types in quantifying shipping noise for predictive models of global, regional, and local marine environments. © 2012 Acoustical Society of America.

  17. Improving the competitiveness of green ship recycling

    NARCIS (Netherlands)

    Jain, K.P.

    2017-01-01

    The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and

  18. Cruise ship seakeeping and passenger comfort

    NARCIS (Netherlands)

    Dallinga, R.P.; Bos, J.E.

    2010-01-01

    In the last decade the design and construction of a substantial volume of large cruise ships has stimulated the evolution of cruise ship design. The MARIN and TNO involvement in these developments, and in particular the increase in size, have lead to new insights in how the ship design governs

  19. Stopping of Ships Equipped with Azipods

    Directory of Open Access Journals (Sweden)

    Jacek Nowicki

    2014-09-01

    Full Text Available The paper contains a description of different possibilities of stopping a large ship equipped with azipods. The model tests were carried out to compare the effectiveness of stopping the ship using the different methods. The ship model used in stopping tests reproduces a large LNG carrier of capacity ~150 000 m3

  20. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...

  1. 27 CFR 44.187 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44... Shipping containers. Each shipping case, crate, or other container in which tobacco products, or cigarette... same containers in which they were received from the factory. (72 Stat. 1418, as amended; 26 U.S.C...

  2. The Museum-ship "Abdon Calderon"

    Directory of Open Access Journals (Sweden)

    Nicholas W. Mitiukov

    2015-03-01

    Full Text Available The paper deals the reconstruction of the career of the Ecuadorian tug "Abdon Calderon," which is now a museum-ship. It is shown that the ship had a significant impact on the naval history of Ecuador. But the role of the ship in the battle in the strait Jambeli in 1941 clearly exaggerated.

  3. Designing Adaptable Ships: Modularity and Flexibility in Future Ship Designs

    Science.gov (United States)

    2016-01-01

    installed on new-construction DDG102AF. MwS provides digital wind speed and direction information, including crosswind and headwind, that supports...rather than incur the heavy cost of maintaining their missile launching systems. These initial Ticonderoga-class cruisers were equipped with twin ...D.1—Continued 126 Designing Adaptable Ships Requirement System Execution Impact 70403 Digital Fuel Justification: If the alteration is not

  4. GKSS annual report 1980

    International Nuclear Information System (INIS)

    1981-01-01

    This annual report of the GKSS-Research Centre Geesthacht GmbH contains a survey of the research- and development work done in the year of the report and a survey on the organisation and situation of the society. The R and D programme can be divided in two parts: utilization of nuclear energy; utilization of the sea and the coasts. The first part concerns tasks on the sector of reactor safety compiled to a project which is fully integrated into the programme Reactor Safety of the Federal Ministy for Research and Technology. Development of nuclear-energy propelled vessels is continued to a smaller extent than before. The NS OTTO HAHN stopped operations in 1979. In 1980 a waste-disposed concept for the nuclear waste was developed, on the basis of which the GKSS received permission to put the ship out of service. (orig./RW) [de

  5. Potential of Winkler type platform models for SSI problems considering flexibility of base mat

    Energy Technology Data Exchange (ETDEWEB)

    Tyapin, Alexander, E-mail: Atyapin@bvcp.ru

    2013-10-15

    Highlights: • Base mat's flexibility affects different seismic response parameters in different ways. • The most sensitive are the internal seismic response forces in the base mat itself. • Vertical response accelerations in the centers of the rooms are sensitive too. • Shaped Winkler model generally gives better results than the conventional flat one. • Even shaped Winkler model cannot reproduce the response in two sensitive formats. -- Abstract: Linear soil-structure interaction (SSI) analysis seems to be well understood nowadays and can be performed, for example, by convenient combined asymptotic method (CAM). However, CAM is asymptotically accurate for rigid base mats only – this is a limitation. So, the additional research is needed to find out (a) what is the impact of the base mat's flexibility to the seismic response; (b) how can one account for this impact using the conventional tools. In the first part of the paper a sample “wave” solution is obtained in the frequency domain using SASSI2000 code, without CAM at all. Different formats of the seismic response (e.g., in-structure response spectra, soil-structure interaction forces, in-structure internal forces) have proved to have different sensitivity to the base mat's flexibility. In the second part of the paper this wave solution is a benchmark for the different “platform” models with “soil” springs and dashpots distributed over the base mat (this is a broad definition of Winkler type model). Different shapes of distribution, starting from the conventional Winkler's flat shape and up to the “optimal” shape, are compared to each other in the second part of the paper. It is shown that even the most advanced “shaped” models of the Winkler type are limited in their ability to reproduce seismic response in the most sensitive format – the internal forces in the mat. This is the result of (a) local nature of Winkler's model, and (b) frequency

  6. Approximate Method of Calculating Forces on Rudder During Ship Sailing on a Shipping Route

    Directory of Open Access Journals (Sweden)

    K. Zelazny

    2014-09-01

    Full Text Available Service speed of a ship in real weather conditions is a basic design parameter. Forecasting of this speed at preliminary design stage is made difficult by the lack of simple but at the same accurate models of forces acting upon a ship sailing on a preset shipping route. The article presents a model for calculating forces and moment on plane rudder, useful for forecasting of ship service speed at preliminary stages of ship design.

  7. SSI sensitivity studies and model improvements for the US NRC Seismic Safety Margins Research Program. Rev. 1

    International Nuclear Information System (INIS)

    Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.

    1984-10-01

    The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables

  8. Ship recycling and marine pollution.

    Science.gov (United States)

    Chang, Yen-Chiang; Wang, Nannan; Durak, Onur Sabri

    2010-09-01

    This paper discusses the historical background, structure and enforcement of the '2009 Hong Kong International Convention on the Safe and Environmentally Sound Recycling of Ships.' the 2009 Hong Kong Convention establishes control and enforcement instruments related to ship recycling, determining the control rights of Port States and the obligations of Flag States, Parties and recycling facilities under its jurisdiction. The Convention also controls the communication and exchange of information procedures, establishes a reporting system to be used upon the completion of recycling, and outlines an auditing system for detecting violations. The Convention, however, also contains some deficiencies. This paper concludes these deficiencies will eventually influence the final acceptance of this Convention by the international community. Copyright 2010 Elsevier Ltd. All rights reserved.

  9. Reliability Based Ship Structural Design

    DEFF Research Database (Denmark)

    Dogliani, M.; Østergaard, C.; Parmentier, G.

    1996-01-01

    This paper deals with the development of different methods that allow the reliability-based design of ship structures to be transferred from the area of research to the systematic application in current design. It summarises the achievements of a three-year collaborative research project dealing...... with developments of models of load effects and of structural collapse adopted in reliability formulations which aim at calibrating partial safety factors for ship structural design. New probabilistic models of still-water load effects are developed both for tankers and for containerships. New results are presented...... of non-linear wave induced load effects and the corresponding long-term formulations. Methods to combine linear and non-linear components of wave induced load effects have been developed and checked by alternative methods.These improved models were used for the reliability assessment of the primary hull...

  10. Human Reliability and Ship Stability

    Science.gov (United States)

    2003-07-04

    systems. Many aspects of ship operation can be viewed as a continuos process system. A partial HAZOP example is shown in Table 4 below. Function...in the first place. This may require wholesale functional reorganisation of the system. Enhance error Detection Provide improved display systems...For example, manage watch (shift) system to reduce fatigue, design interface for fatigued users. Increase Predictability Provide improved display

  11. World Ships - Architectures & Feasibility Revisited

    Science.gov (United States)

    Hein, A. M.; Pak, M.; Putz, D.; Buhler, C.; Reiss, P.

    A world ship is a concept for manned interstellar flight. It is a huge, self-contained and self-sustained interstellar vehicle. It travels at a fraction of a per cent of the speed of light and needs several centuries to reach its target star system. The well- known world ship concept by Alan Bond and Anthony Martin was intended to show its principal feasibility. However, several important issues haven't been addressed so far: the relationship between crew size and robustness of knowledge transfer, reliability, and alternative mission architectures. This paper addresses these gaps. Furthermore, it gives an update on target star system choice, and develops possible mission architectures. The derived conclusions are: a large population size leads to robust knowledge transfer and cultural adaptation. These processes can be improved by new technologies. World ship reliability depends on the availability of an automatic repair system, as in the case of the Daedalus probe. Star systems with habitable planets are probably farther away than systems with enough resources to construct space colonies. Therefore, missions to habitable planets have longer trip times and have a higher risk of mission failure. On the other hand, the risk of constructing colonies is higher than to establish an initial settlement on a habitable planet. Mission architectures with precursor probes have the potential to significantly reduce trip and colonization risk without being significantly more costly than architectures without. In summary world ships remain an interesting concept, although they require a space colony-based civilization within our own solar system before becoming feasible.

  12. The Human Element and Autonomous Ships

    Directory of Open Access Journals (Sweden)

    Sauli Ahvenjärvi

    2016-09-01

    Full Text Available The autonomous ship technology has become a “hot” topic in the discussion about more efficient, environmentally friendly and safer sea transportation solutions. The time is becoming mature for the introduction of commercially sensible solutions for unmanned and fully autonomous cargo and passenger ships. Safety will be the most interesting and important aspect in this development. The utilization of the autonomous ship technology will have many effects on the safety, both positive and negative. It has been announced that the goal is to make the safety of an unmanned ship better that the safety of a manned ship. However, it must be understood that the human element will still be present when fully unmanned ships are being used. The shore-based control of a ship contains new safety aspects and an interesting question will be the interaction of manned and unmanned ships in the same traffic area. The autonomous ship technology should therefore be taken into account on the training of seafarers. Also it should not be forgotten that every single control algorithm and rule of the internal decision making logic of the autonomously navigating ship has been designed and coded by a human software engineer. Thus the human element is present also in this point of the lifetime navigation system of the autonomous ship.

  13. Ultimate Longitudinal Strength of Composite Ship Hulls

    Science.gov (United States)

    Zhang, Xiangming; Huang, Lingkai; Zhu, Libao; Tang, Yuhang; Wang, Anwen

    2017-01-01

    A simple analytical model to estimate the longitudinal strength of ship hulls in composite materials under buckling, material failure and ultimate collapse is presented in this paper. Ship hulls are regarded as assemblies of stiffened panels which idealized as group of plate-stiffener combinations. Ultimate strain of the plate-stiffener combination is predicted under buckling or material failure with composite beam-column theory. The effects of initial imperfection of ship hull and eccentricity of load are included. Corresponding longitudinal strengths of ship hull are derived in a straightforward method. A longitudinally framed ship hull made of symmetrically stacked unidirectional plies under sagging is analyzed. The results indicate that present analytical results have a good agreement with FEM method. The initial deflection of ship hull and eccentricity of load can dramatically reduce the bending capacity of ship hull. The proposed formulations provide a simple but useful tool for the longitudinal strength estimation in practical design.

  14. SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report on large-scale groundwater flow modelling for eastern Smaaland in Sweden (SKB Report 06-64)

    International Nuclear Information System (INIS)

    Dverstorp, Bjorrn

    2007-09-01

    This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009

  15. Pengaruh Learning Cycle–5E Berkonteks SSI Terhadap Pemahaman Hakikat Sains Pada Materi Larutan Penyangga Dan Hidrolisis Garam Siswa SMA

    Directory of Open Access Journals (Sweden)

    Eris Ratnawati

    2017-03-01

    Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis   Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam

  16. Improvement in ethanol productivity of engineered E. coli strain SSY13 in defined medium via adaptive evolution.

    Science.gov (United States)

    Jilani, Syed Bilal; Venigalla, Siva Sai Krishna; Mattam, Anu Jose; Dev, Chandra; Yazdani, Syed Shams

    2017-09-01

    E. coli has the ability to ferment both C5 and C6 sugars and produce mixture of acids along with small amount of ethanol. In our previous study, we reported the construction of an ethanologenic E. coli strain by modulating flux through the endogenous pathways. In the current study, we made further changes in the strain to make the overall process industry friendly; the changes being (1) removal of plasmid, (2) use of low-cost defined medium, and (3) improvement in consumption rate of both C5 and C6 sugars. We first constructed a plasmid-free strain SSY13 and passaged it on AM1-xylose minimal medium plate for 150 days. Further passaging was done for 56 days in liquid AM1 medium containing either glucose or xylose on alternate days. We observed an increase in specific growth rate and carbon utilization rate with increase in passage numbers until 42 days for both glucose and xylose. The 42nd day passaged strain SSK42 fermented 113 g/L xylose in AM1 minimal medium and produced 51.1 g/L ethanol in 72 h at 89% of maximum theoretical yield with ethanol productivity of 1.4 g/L/h during 24-48 h of fermentation. The ethanol titer, yield and productivity were 49, 40 and 36% higher, respectively, for SSK42 as compared to unevolved SSY13 strain.

  17. Effect of Buffer Bow Structure in Ship-Ship Collision

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup

    2008-01-01

    A disastrous oil spill from a struck oil tanker has become one of the major problems in view of conservation of maritime environment. So far double hulls (D/H) have been introduced to reduce the consequences of collision and grounding events In order to further reduce the oil spill from struck oil......) and the forward velocity of the struck ship on the collapse mode of the bow of the striking vessel are investigated. Collapse modes, contact forces and energy absorption capabilities of the buffer bows are compared with those of conventional bows....

  18. SKI's and SSI's joint review of SKB's safety assessment report, SR 97. Summary

    International Nuclear Information System (INIS)

    2001-01-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) has a programme for the siting of a repository for spent nuclear fuel in Swedish bedrock. In 1996, the Swedish Government decided that SKB must perform an assessment of the repository's long-term safety before undertaking the next step of the programme which entails drilling in a minimum of two municipalities (site investigations). SKB has presented such a safety assessment in SR 97 Post-closure Safety (henceforth referred to as SR 97). SR 97 is one of the documents in the comprehensive reporting that SKB must provide when it proposes sites for investigation. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) have evaluated SR 97 in terms of its purposes which are to demonstrate a methodology for safety assessment, to show that Swedish bedrock can provide a safe repository using SKB's method, to provide a basis for specifying the factors that are important for site selection and to derive preliminary requirements on the function of the engineered barriers. The authorities have reached the following conclusions: SR 97 does not indicate any conditions that would mean that geological final disposal in accordance with SKB's method would have significant deficiencies in relation to the safety and radiation protection requirements of the authorities. SR 97 contains the elements required for a comprehensive assessment of safety and radiation protection. SKB's safety assessment methodology has improved within several important areas, such as the documentation of processes and properties that can affect repository performance and the development of models for safety assessment calculations. The methodology used in SR 97 has some deficiencies, for example, the specification of future events to be described in the safety assessment. SR 97 has not, to an adequate extent, dealt with unfavourable conditions that can affect the future safety of a repository. SKB states that the

  19. Ship Collision Avoidance by Distributed Tabu Search

    Directory of Open Access Journals (Sweden)

    Dong-Gyun Kim

    2015-03-01

    Full Text Available More than 90% of world trade is transported by sea. The size and speed of ships is rapidly increasing in order to boost economic efficiency. If ships collide, the damage and cost can be astronomical. It is very difficult for officers to ascertain routes that will avoid collisions, especially when multiple ships travel the same waters. There are several ways to prevent ship collisions, such as lookouts, radar, and VHF radio. More advanced methodologies, such as ship domain, fuzzy theory, and genetic algorithm, have been proposed. These methods work well in one-on-one situations, but are more difficult to apply in multiple-ship situations. Therefore, we proposed the Distributed Local Search Algorithm (DLSA to avoid ship collisions as a precedent study. DLSA is a distributed algorithm in which multiple ships communicate with each other within a certain area. DLSA computes collision risk based on the information received from neighboring ships. However, DLSA suffers from Quasi-Local Minimum (QLM, which prevents a ship from changing course even when a collision risk arises. In our study, we developed the Distributed Tabu Search Algorithm (DTSA. DTSA uses a tabu list to escape from QLM that also exploits a modified cost function and enlarged domain of next-intended courses to increase its efficiency. We conducted experiments to compare the performance of DLSA and DTSA. The results showed that DTSA outperformed DLSA.

  20. The role of Swedish Radiation Protection Authority in the field of public health 2008; SSI:s roll i folkhaelsoarbetet 2008 - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf

    2008-04-15

    The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures

  1. The role of Swedish Radiation Protection Authority in the field of public health; SSI:s roll i folkhaelsoarbetet - redovisning av regeringsuppdrag inom folkhaelsoomraadet

    Energy Technology Data Exchange (ETDEWEB)

    Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna

    2004-09-01

    The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.

  2. Ship collision with iceberg database

    Energy Technology Data Exchange (ETDEWEB)

    Hill, B.T. [National Research Council of Canada, St. John' s, NL (Canada). Inst. for Ocean Technology

    2006-11-15

    Approximately 20 per cent of collisions between icebergs, steam ships and motor vessels since 1850 have resulted in sinkings. The available data indicates that most sinkings were due to some kind of indirect impact rather than a head on collision. This paper presented the newly augmented Microsoft Access Database of Ship Collisions with Icebergs that includes more than 670 events over 200 years, most of which occurred on the Grand Banks. Other collisions occurred further afield in the Arctic, off Greenland and in the fjords of Alaska. The operation, search categories and data fields of the database were described along with various trends of collisions, scope of damage and environmental factors involved. Based on an estimate of the number of voyages over the Grand Banks, a probability of collision was derived from the number of cargo ship collisions over the past several years. The Microsoft Access template was provided by the Canadian Hydraulic Centre which had been developed by them for their Ice Regime Database to describe sea ice and ship interactions. This template was adapted and modified for iceberg collisions. Where possible, the data base was augmented to include information about the nature of the damage, the weather and sea state, the ice conditions, iceberg size, the vessel route and location at the time of collision, and vessel characteristics. The purpose of the database is to provide operators and regulators with an assessment of the frequency of collisions and environmental factors that played a role at the time of the collision. The database provides a basis to undertake risk analysis for vessels entering a given area and provides a better understanding of conditions under which collisions are likely to occur. It was concluded that although the trend of collisions has improved over the years with better observation and detection techniques, collisions still occur. Reduced visibility by fog, precipitation or low light conditions were found to be

  3. Japan nuclear ship sea trial

    International Nuclear Information System (INIS)

    Yamazaki, Hiroshi; Kitamura, Toshikatus; Mizushima, Toshihiko

    1992-01-01

    The sea trial of the first Japan nuclear Ship 'MUTSU' was conducted from the end of October to December in 1990. The purpose of the sea trial was to verify the nuclear propulsive performances and maneuverabilities. The present report describes the results of the sea trial. These results are classified into four items: 1. Speed test and engineering performance tests 2. Maneuvering performance tests 3. Vibration tests 4. Other tests. Acceptable performances were demonstrated, as expected in the original design. The experience of the use of the Global Positioning System (GPS), which were newly adopted for the sea trial, is also reported. (author)

  4. Analytical support management shipping company

    Directory of Open Access Journals (Sweden)

    S.V. Tarasenko

    2016-12-01

    Full Text Available The article to determine areas of improvement of the economic analysis of the shipping companies tested, allowing to identify the problems of organization and methods, which are as follows: lack of regulation of economic analysis, unregulated and methods of economic analysis, using methods such as coefficient method, absolute differences method relative differences groupings balance method, while as factor analysis and correlation are ignored. Proved that today the priority targets of management that should be subject to economic analysis are: analysis of the efficiency of the fleet; analysis of the efficiency of transport services; analysis of the cost of transport services and costs; analysis of the efficiency of resource use.

  5. TMI-2 Core Shipping Preparations

    International Nuclear Information System (INIS)

    Ball, L.J.; Barkanic, R.J.; Conaway, W.T. II; Schmoker, D. S.; Post, Roy G.

    1988-01-01

    Shipping the damaged core from the Unit 2 reactor of Three Mile Island Nuclear Power Station near Harrisburg, PA, to the Idaho National Engineering Laboratory near Idaho Falls, ID, required development and implementation of a completely new spent fuel transportation system. This paper describes of the equipment developed, the planning and activities used to implement the hard-ware-systems into the facilities, and the planning involved in making the rail shipments. It also includes a summary of recommendations resulting from this experience. (author)

  6. Automated Planning for Liner Shipping Fleet Repositioning

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller; Kroer, Christian

    2012-01-01

    The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs that are a ......The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs......-integer program (MIP) and a novel method called Temporal Optimization Planning (TOP). We evaluate the performance of each of these techniques on a dataset of real-world instances from our industrial collaborator, and show that automated planning scales to the size of problems faced by industry....

  7. Development of a nuclear ship safety philosophy

    International Nuclear Information System (INIS)

    Thompson, T.E.

    1978-01-01

    A unique safety philosophy must be recognized and accepted as an integral part of the design and operation of a nuclear ship. For the nuclear powered ship, the ultimate safety of the reactor and therefore the crew and the environment lies with the safety of the ship itself. The basis for ship safety is its ability to navigate and survive the conditions or the environment in which it may find itself. The subject of traditional ship safety is examined along with its implication for reactor protection and safety. Concepts of reactor safety are also examined. These two philosophies are combined in a manner so as to provide a sound philosophy for the safety of nuclear ships, their crews, and the environment

  8. Ship emissions and air pollution in Denmark

    DEFF Research Database (Denmark)

    Olesen, Helge Rørdam; Winther, Morten; Ellermann, Thomas

    continuously keeps track of ship positions. The inventory provides basis for model calculations of air quality in Denmark for the years 2007, 2011 and 2020. The study has focus on identifying the contribution from ships, and on assessing the effect of international regulations of ship pollution. A minor......A project has been carried out to map the contribution from ship traffic to air pollution in Denmark. A main element in the project is the establishment of a new, improved inventory of ship emissions for the waters around Denmark. The inventory makes use of the so-called AIS system, which...... component of the study concerns the contribution to local air pollution from ships at port....

  9. ASPECTS RELATED TO THE PROPULSION HYDRAFOIL SHIPS

    Directory of Open Access Journals (Sweden)

    Levent ALI

    2016-12-01

    Full Text Available In this paper, we analyze some aspects related to the propulsion of hydrofoil ships. They are very important for the success of the mission if they are military ships and for cargo security, if they are civilian transport ships, especially when navigating at high speed on their hydrofoil wings in rough sea conditions. This paper presents an original procedure for estimating the propulsion of hydrofoil ships. This procedure has enabled the development of a computer program that can predict both those types of ship propulsion regime imposed at a quasi-stationary speed and the march regime on wings. The calculation software obtained may serve to design any type of hydrofoil ship.

  10. Parametric Method For Evaluating Optimal Ship Deadweight

    Directory of Open Access Journals (Sweden)

    Michalski Jan P.

    2014-04-01

    Full Text Available The paper presents a method of choosing the optimal value of the cargo ships deadweight. The method may be useful at the stage of establishing the main owners requirements concerning the ship design parameters as well as for choosing a proper ship for a given transportation task. The deadweight is determined on the basis of a selected economic measure of the transport effectiveness of ship - the Required Freight Rate (RFR. The mathematical model of the problem is of a deterministic character and the simplifying assumptions are justified for ships operating in the liner trade. The assumptions are so selected that solution of the problem is obtained in analytical closed form. The presented method can be useful for application in the pre-investment ships designing parameters simulation or transportation task studies.

  11. On Impact Mechanics in Ship Collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship-ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived...... mathematical models include friction at the contact point so that situation where the collision results in a sliding motion is included. Results obtained by application of the present procedure are compared with results obtained by time simulations and good agreement has been achieved. In addition, a number...... of illustrative examples are presented. The procedure presented in the paper is well suited for inclusion in a probabilistic calculation model for damage of ship structures due to collisions....

  12. The Human Element and Autonomous Ships

    OpenAIRE

    Sauli Ahvenjärvi

    2016-01-01

    The autonomous ship technology has become a “hot” topic in the discussion about more efficient, environmentally friendly and safer sea transportation solutions. The time is becoming mature for the introduction of commercially sensible solutions for unmanned and fully autonomous cargo and passenger ships. Safety will be the most interesting and important aspect in this development. The utilization of the autonomous ship technology will have many effects on the safety, both positive and negativ...

  13. Applications of Probabilistic Interpolation to Ship Tracking

    Science.gov (United States)

    2014-06-01

    this problem in issues from oil-spill investigation to maritime security and fisheries management. It outlines a general Bayesian approach to the...Introduction This paper is concerned with reconstructing past events involving ships, events around which the ships were employing self-reporting...systems. The motivation behind such reconstruction is typically forensic. In the classic scenario, one of the ships may have done something suspicious

  14. Ship to Shore Connector Amphibious Craft (SSC)

    Science.gov (United States)

    2015-12-01

    Selected Acquisition Report (SAR) RCS: DD-A&T(Q&A)823-303 Ship to Shore Connector Amphibious Craft (SSC) As of FY 2017 President’s Budget Defense...28, 2015 Program Information Program Name Ship to Shore Connector Amphibious Craft (SSC) DoD Component Navy Responsible Office References SAR...5 Mission and Description Ship to Shore Connector (SSC) is the Landing Craft , Air Cushion (LCAC) replacement. It is an Air Cushion Vehicle with the

  15. Design of Crashworthy Ship Strucures

    DEFF Research Database (Denmark)

    Toernqvist, Rikard

    2003-01-01

    The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration of the str......The main purpose of the project has been to develop a rational procedure for designing new crashworthy side structures for those ship types where it could be expected that a substantial improvement of the crashworthiness and the related safety could be achieved by careful consideration...... of the structural design. For a tanker vessel or other vessels carrying hazardous cargo, damage is not acceptable if it results in cargo outflow with disastrous consequences to the environment. Likewise, the foundering of a passenger vessel can be disastrous with loss of many human lives. A major challenge...... a structure is subjected to biaxial loading. The main aspect of this thesis has therefore been to study the fracture criteria available in the literature and to validate them against various experiments with varying stress and strain states....

  16. Note from the radioprotection group's shipping service

    CERN Multimedia

    2006-01-01

    Le service SHIPPING du groupe de radioprotection souhaite vous rappeler qu'avant toute expédition de matériel susceptible d'être radioactif, une demande de transport doit être établie par EDH en cochant la case appropriée (danger radioactif). Merci de bien vouloir prendre note des informations figurant dans le site Web: http://cern.ch/service-rp-shipping Toute demande non conforme ne sera pas prise en compte. Radioactive Shipping Service http://cern.ch/service-rp-shippingTél: 73171Fax: 69200

  17. Shipping/Receiving and Quality Control

    Data.gov (United States)

    Federal Laboratory Consortium — Shipping receiving, quality control, large and precise inspection and CMM machines. Coordinate Measuring Machines, including "scanning" probes, optical comparators,...

  18. Potential of biofuels for shipping. Final Report

    Energy Technology Data Exchange (ETDEWEB)

    Florentinus, A.; Hamelinck, C.; Van den Bos, A.; Winkel, R.; Cuijpers, M. [Ecofys Netherlands, Utrecht (Netherlands)

    2012-01-15

    Biofuels could be one of the options to realize a lower carbon intensity in the propulsion of ships and also possibly reduce the effect of ship emissions on local air quality. Therefore, EMSA, the European Maritime Safety Agency, is evaluating if and how biofuels could be used in the shipping sector as an alternative fuel. To determine the potential of biofuels for ships, a clearer picture is needed on technical and organizational limitations of biofuels in ships, both on board of the ship as in the fuel supply chain to the ship. Economic and sustainability analysis of biofuels should be included in this picture, as well as an overview on current and potential policy measures to stimulate the use of biofuels in shipping. Ecofys has determined the potential of biofuels, based on analysis of collected data through literature review, own expertise and experiences, direct communication with EMSA, research publications, market developments based on press and other media, and consultations with relevant stakeholders in the shipping market.

  19. International Standardization in the Design of "Shore to Ship" - Power Supply Systems of Ships in Port

    Science.gov (United States)

    Tarnapowicz, Dariusz; German-Galkin, Sergiej

    2018-03-01

    The decisive source of air pollution emissions in ports is the berthed ships. This is primarily caused by the work of ship's autonomous generator sets. One way of reducing the air pollution emissions in ports is the supply of ships from electricity inland system. The main problem connected with the power connection of ships to the inland network is caused by different values of levels and frequencies of voltages in these networks (in various countries) in relation to different values of levels and frequencies of voltages present in the ship's network. It is also important that the source power can range from a few hundred kW up to several MW. In order to realize a universal „Shore to Ship" system that allows the connection of ships to the electricity inland network, the international standardization is necessary. This article presents the current recommendations, standards and regulations for the design of „Shore to Ship" systems.

  20. Navy Ships: Turning Over Auxiliary Ship Operations to the Military Sealift Command Could Save Millions

    National Research Council Canada - National Science Library

    1997-01-01

    .... One additional multiproduct ship of a new class is currently under construction. The Navy has delegated operational control of 27 of these ships to MSC, the military's single manager for sealift, to better...

  1. Ship Technology Workshop Materials from Collaboration with Mexico to Reduce Emissions from Ships

    Science.gov (United States)

    On September 26, 2012, a ship technology seminar was held to provide Mexican stakeholders with information about some of the ship technologies needed to meet the requirements of MARPOL Annex VI and an ECA.

  2. Ship emissions and the use of current air cleaning technology: contributions to air pollution and acidification in the Baltic Sea

    Science.gov (United States)

    Claremar, Björn; Haglund, Karin; Rutgersson, Anna

    2017-10-01

    The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km × 50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for the marine environment are largely unknown

  3. Behavioral and Physiological Response of Baleen Whales to Ships and Ship Noise

    Science.gov (United States)

    2015-09-30

    DISTRIBUTION STATEMENT A. Approved for public release; distribution is unlimited. Behavioral and physiological response of baleen whales to...and physiological response of baleen whales to ships and ship noise off California using a combination of opportunistic and controlled research. Ship...Our objectives include: 1. Determine behavioral response (avoidance and changes in dive behavior) of blue whales and other large mystecetes to

  4. Achieving Energy Efficient Ship Operations Under Third Party Management

    DEFF Research Database (Denmark)

    Taudal Poulsen, René; Sornn-Friese, Henrik

    2015-01-01

    of time to produce and provide reliable energy efficiency information cause energy efficiency gaps. The paper brings together the energy efficiency and ship management literatures, demonstrating how ship management models influence energy efficiency in ship operations. Achieving energy efficiency in ship...... operations is particularly challenging under third party ship management. Finally, the paper discusses management implications for shipping companies, which outsource ship management to third parties.......Profitable energy saving measures are often not fully implemented in shipping, causing energy efficiency gaps. The paper identifies energy efficiency gaps in ship operations, and explores their causes. Lack of information on energy efficiency, lack of energy training at sea and onshore and lack...

  5. LCA-ship. Design tool for energy efficient ships. A Life Cycle Analysis Program for Ships. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Jiven, Karl; Sjoebris, Anders [MariTerm AB, Goeteborg (Sweden); Nilsson, Maria [Lund Univ. (Sweden). Stiftelsen TEM; Ellis, Joanne; Traegaardh, Peter; Nordstroem, Malin [SSPA Sweden AB, Goeteborg (Sweden)

    2004-05-01

    In order to make it easier to include aspects during ship design that will improve environmental performance, general methods for life cycle calculations and a prototype tool for LCA calculations of ships and marine transportation have been developed. The base of the life cycle analyses is a comprehensive set of life cycle data that was collected for the materials and consumables used in ship construction and vessel operations. The computer tool developed makes it possible to quickly and simply specify (and calculate) the use of consumables over the vessel's life time cycle. Special effort has been made to allow the tool to be used for different types of vessels and sea transport. The main result from the project is the computer tool LCA ship, which incorporates collected and developed life cycle data for some of the most important materials and consumables used in ships and their operation. The computer application also contains a module for propulsion power calculations and a module for defining and optimising the energy system onboard the vessel. The tool itself is described in more detail in the Computer application manual. The input to the application should, as much as possible, be the kind of information that is normally found in a shipping company concerning vessel data and vessel movements. It all starts with defining the ship to be analysed and continues with defining how the ship is used over the lifetime. The tool contains compiled and processed background information about specific materials and processes (LCA data) connected to shipping operations. The LCA data is included in the tool in a processed form. LCA data for steel will for example include the environmental load from the steel production, the process to build the steel structure of the ship, the scrapping and the recycling phase. To be able to calculate the environmental load from the use of steel the total amount of steel used over the life cycle of the ship is also needed. The

  6. The association between Bacillus Calmette-Guérin vaccination (1331 SSI) skin reaction and subsequent scar development in infants

    DEFF Research Database (Denmark)

    Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica

    2017-01-01

    of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...... or absence of a BCG scar and the size the scar was measured at 13 months of age. RESULTS: Of 492 infants included, 87% had a wheal after vaccination, 11% had a bulge, and 2% had no reaction. The mean wheal size was 3.8 mm (95% confidence interval 3.7-3.9). Overall, 95% (442/466, 26 lost to follow-up) of BCG...

  7. 46 CFR 173.051 - Public nautical school ships.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school ships. 173.051 Section 173.051 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SUBDIVISION AND STABILITY SPECIAL RULES PERTAINING TO VESSEL USE School Ships § 173.051 Public nautical school ships. Each public nautical school...

  8. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    International Nuclear Information System (INIS)

    2008-03-01

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  9. Competitive Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad

    shipping company earnings.The operation of the route net constitute the majority of the total costs, so it is essential to achieve a good capacity utilization in a route plan with travel times that satisfy customer requirements. Most academic articles dealing with the design of container networks neither...... take the container transportation times that can be realized in the network nor the number of transshipments into consideration. This is mainly because the optimization problem is based on other transportation networks where these constraints are not decisive to the quality of the network. Furthermore...... network. The result is prototypes of decision support tools to make incremental changes to a network e.g. by adding/deleting ports from routes or change speed between two ports in order to examine how it changes the total earnings taking into account the network’s competitiveness and quality...

  10. Optimizing Liner Shipping Fleet Repositioning Plans

    DEFF Research Database (Denmark)

    Tierney, Kevin

    With the incredible growth of containerization over the past half century, shipping lines and ports are facing increasing challenges in ensuring that containers arrive at their destinations on time and on budget. This dissertation addresses several critical problems to the operations of shipping ...

  11. 29 CFR 1915.162 - Ship's boilers.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's boilers. 1915.162 Section 1915.162 Labor Regulations... Ship's boilers. (a) Before work is performed in the fire, steam, or water spaces of a boiler where... dead boiler with the live system or systems shall be secured, blanked, and tagged indicating that...

  12. A Survey on the Ship Loading Problem

    DEFF Research Database (Denmark)

    Iris, Cagatay; Pacino, Dario

    2015-01-01

    on externalities. One of those is the ship loading process. Based on the stowage plan received by liner shippers, terminal operators plan the execution of load and discharge operations. In this paper we present a literature review for the Ship Loading Problem, where stowage and loading sequencing and scheduling...

  13. The mechanics of ship impacts against bridges

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    a glancing blow between the ship and the bridge structure. This model is based on rigid body mechanics and well suited for inclusion in a probabilistic analysis procedure. Finally, some empirical expressions are presented which relate the energy absorbed by crushing of ship structures to the maximum impact...

  14. Infrared ship signature analysis and optimisation

    NARCIS (Netherlands)

    Neele, F.P.

    2005-01-01

    The last decade has seen an increase in the awareness of the infrared signature of naval ships. New ship designs show that infrared signature reduction measures are being incorporated, such as exhaust gas cooling systems, relocation of the exhausts and surface cooling systems. Hull and

  15. Detecting potential ship objects from satellite pictures

    International Nuclear Information System (INIS)

    Luo, B.; Yang, C.C.; Chang, S.K.; Yang, M.C.K.

    1984-01-01

    Heuristic techniques are presented to detect potential ship objects from satellite pictures. These techniques utilize some noise structures of the pixel gray levels, and certain inherent features of a ship in a satellite picture. The scheme has been implemented and successfully tested on SEASAT satellite pictures. A general approach for database-oriented object detection is also suggested

  16. Automatic temperature control method of shipping can

    International Nuclear Information System (INIS)

    Nishikawa, Kaoru.

    1992-01-01

    The present invention provides a method of rapidly and accurately controlling the temperature of a shipping can, which is used upon shipping inspection for a nuclear fuel assembly. That is, a measured temperature value of the shipping can is converted to a gas pressure setting value in a jacket of the shipping can by conducting a predetermined logic calculation by using a fuzzy logic. A gas pressure control section compares the pressure setting value of a fuzzy estimation section and the measured value of the gas pressure in the jacket of the shipping can, and conducts air supply or exhaustion of the jacket gas so as to adjust the measured value with the setting value. These fuzzy estimation section and gas pressure control section control the gas pressure in the jacket of the shipping can to control the water level in the jacket. As a result, the temperature of the shipping can is controlled. With such procedures, since the water level in the jacket can be controlled directly and finely, temperature of the shipping can is automatically controlled rapidly and accurately compared with a conventional case. (I.S.)

  17. India's ship recycling trade-off

    NARCIS (Netherlands)

    Worrell, E.; Athanasopoulou, V.

    2014-01-01

    The special nature of India's steel industry lends particular importance to ship recycling as a source of scrap. Ship recycling in upgraded 'green' facilities can substitute other 'dirty' ironmaking processes, resulting in energy savings and air pollutant emission reductions for the Indian steel

  18. Impact analysis of shipping casks

    International Nuclear Information System (INIS)

    Pfeiffer, P.A.; Kennedy, J.M.

    1989-01-01

    Shipping casks are being used in the United States Department of Energy to transport irradiated experiments, reactor fuel, radioactive waste, etc. One of the critical requirements in shipping cask analysis is the necessity to withstand severe impact environments. It is still conventional to develop the design and to verify the design requirements by hand calculations. Full three dimensional computations of impact scenarios have been performed but they are too expensive and time consuming for design purposes. Typically, on the order of more than an hour of CRAY time is required for a detailed, three dimensional analysis. The paper describes how simpler two- and three-dimensional models can be used to provide an intermediate level of detail between full three dimensional finite element calculations and hand calculations. The regulation that is examined here is: 10 CFR-71.73 hypothetical accident conditions, free drop. Free drop for an accident condition of a Class I package (approximate weight of 22,000 lb) is defined as a 30 foot drop onto a flat, essentially unyielding, horizontal surface, striking the surface in a position for which maximum damage is expected. Three free drop scenarios are analyzed to assess the integrity of the cask when subjected to large bending and axial stresses. These three drop scenarios are: (1) a thirty foot axial drop on either end, (2) a thirty foot oblique angle drop with the cask having several different orientations from the vertical with impact on the top end cask corner, and (3) a thirty foot side drop with simultaneous impact on the strength of the various components that comprise the cask. The predicted levels of deformation and stresses in the cask will be used to assess the potential damage level. 5 refs., 5 figs., 1 tab

  19. On impact mechanics in ship collisions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    The purpose of this paper is to present analytical, closed-form expressions for the energy released for crushing and the impact impulse during ship collisions. Ship–ship collisions, ship collisions with rigid walls and ship collisions with flexible offshore structures are considered. The derived...... mathematical models include friction at the contact point so that situation where the collision results in a sliding motion is included. Results obtained by application of the present procedure are compared with results obtained by time simulations and good agreement has been achieved. In addition, a number...... of illustrative examples are presented. The procedure presented in the paper is well suited for inclusion in a probabilistic calculation model for damage of ship structures due to collisions....

  20. Ships as salient objects in synthetic aperture radar imaginary

    CSIR Research Space (South Africa)

    Schwegmann, Colin P

    2016-07-01

    Full Text Available perspective on ships in Synthetic Aperture Radar imagery by viewing them as visually salient objects. The paper introduces common methods of ship object extraction and demonstrates how salient object mapping can improve the accuracy of extracted ships...

  1. MASTER OF THE SHIP, MANAGER AND INSTRUCTOR

    Directory of Open Access Journals (Sweden)

    Florin IORDANOAIA

    2010-01-01

    Full Text Available The master of the ship is the person on the board who has the qualification and the necessary certificate of competency for running a maritime transport ship. He is the one who takes the ship into administration from the ship-owner, he is the only leader, the legal and direct chief of the entire crew, being invested with authority upon all the members of the crew. The master fulfils the attributes and displays his activity according to the legal laws of his flag, of the marine regulations and of the international conventions. In all the relationships which he establishes with physical or juridical people, the master represents the ship-owner, in a double condition, as an officer and as a commercial manager. In this paper, it is analysed the situation of the ship masters, the relationships which these masters have with the crew and the problems which appear during their voyage. At the end of the paper there are proposed measures to increase the quality of the training of the ship masters, to solve the situations connected with the members of the crew.

  2. Arctic shipping emissions inventories and future scenarios

    Directory of Open Access Journals (Sweden)

    J. J. Corbett

    2010-10-01

    Full Text Available This paper presents 5 km×5 km Arctic emissions inventories of important greenhouse gases, black carbon and other pollutants under existing and future (2050 scenarios that account for growth of shipping in the region, potential diversion traffic through emerging routes, and possible emissions control measures. These high-resolution, geospatial emissions inventories for shipping can be used to evaluate Arctic climate sensitivity to black carbon (a short-lived climate forcing pollutant especially effective in accelerating the melting of ice and snow, aerosols, and gaseous emissions including carbon dioxide. We quantify ship emissions scenarios which are expected to increase as declining sea ice coverage due to climate change allows for increased shipping activity in the Arctic. A first-order calculation of global warming potential due to 2030 emissions in the high-growth scenario suggests that short-lived forcing of ~4.5 gigagrams of black carbon from Arctic shipping may increase global warming potential due to Arctic ships' CO2 emissions (~42 000 gigagrams by some 17% to 78%. The paper also presents maximum feasible reduction scenarios for black carbon in particular. These emissions reduction scenarios will enable scientists and policymakers to evaluate the efficacy and benefits of technological controls for black carbon, and other pollutants from ships.

  3. SKB annual report 1992

    International Nuclear Information System (INIS)

    1993-05-01

    This is the annual report on the activities of the Swedish Nuclear Fuel and Waste Management Co, SKB. It contains in part 1 an overview of SKB activities in different fields. Part 2 gives a description of the research and development work on nuclear waste disposal performed during 1992. Lectures and publications during 1992 as well as reports issued in the SKB technical report series are listed in part 4. Part 5 contains the summaries of all technical reports issued during 1992. SKB is the owner of CLAB, the Central Facility for Interim Storage of Spent Nuclear Fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and to the end of 1992 in total 1684 tonnes of spent fuel (measured as uranium) has been received. Transportation from the nuclear site to CLAB is made by a special ship, M/S Sigyn. At Forsmark the final repository for Radioactive Waste -SFR- was taken in operation in April 1988. At the end of 1992 a total of 11000 m 3 of waste have been deposited in SFR. The total cost for R and D during 1992 was 192.3 MSEK of which 24.8 MSEK came from participants outside Sweden. Some of the main areas for SKB research are: groundwater movements, bedrock stability, groundwater chemistry and nuclide migration, method and instruments for in situ characterization of crystalline bedrock, characterization and leaching of spent nuclear fuel, properties of bentonite for buffer, backfilling and sealing, radionuclide transport in biosphere and dose evaluations, development of performance and safety assessment methodology and assessment models, construction of an underground research laboratory. Cost calculations for the total nuclear waste management system, including decommissioning of all reactors, are updated annually. The total cost is estimated to 55 billion SEK

  4. Improving the competitiveness of green ship recycling

    OpenAIRE

    Jain, K.P.

    2017-01-01

    The end of life of a ship is determined by its owner on the basis of various commercial and technical factors. Once decided to scrap a ship, almost all end-of-life (EOL) ships are sold to recycling yards for dismantling; except for a few which are converted into museums, hotels, storage, and artificial reefs. As the decision is a commercial one, the selection of a yard is predominantly based on the offer price, which depends on the location of the yard and the recycling process employed.Among...

  5. The nutrient load from food waste generated onboard ships in the Baltic Sea.

    Science.gov (United States)

    Wilewska-Bien, Magda; Granhag, Lena; Andersson, Karin

    2016-04-15

    The combination of the sensitive characteristics of the Baltic Sea and the intense maritime traffic makes the marine environment vulnerable to anthropogenic influences. The theoretical scenario calculated in this study shows that the annually generated food waste onboard ships in traffic in the Baltic Sea contains about 182tonnes of nitrogen and 34tonnes of phosphorus. Today, all food waste generated onboard can be legally discharged into the marine environment at a distance of 12NM from the nearest land. The annual load of nitrogen contained in the food waste corresponds to 52% of load of nitrogen from the ship-generated sewage. Future regulations for sewage discharge in the Baltic Sea will require significant reduction of total nitrogen and phosphorus released. The contribution of nutrients from food waste compared to sewage will therefore be relatively larger in the future, if food waste still can be legally discharged. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. SKB Annual Report 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-05-01

    This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m{sup 3} or waste. At the end of 1996 at total of 21000 m{sup 3} of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD).

  7. SKB Annual Report 1996

    International Nuclear Information System (INIS)

    1997-05-01

    This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m 3 or waste. At the end of 1996 at total of 21000 m 3 of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD)

  8. Cleaner fuels for ships provide public health benefits with climate tradeoffs.

    Science.gov (United States)

    Sofiev, Mikhail; Winebrake, James J; Johansson, Lasse; Carr, Edward W; Prank, Marje; Soares, Joana; Vira, Julius; Kouznetsov, Rostislav; Jalkanen, Jukka-Pekka; Corbett, James J

    2018-02-06

    We evaluate public health and climate impacts of low-sulphur fuels in global shipping. Using high-resolution emissions inventories, integrated atmospheric models, and health risk functions, we assess ship-related PM 2.5 pollution impacts in 2020 with and without the use of low-sulphur fuels. Cleaner marine fuels will reduce ship-related premature mortality and morbidity by 34 and 54%, respectively, representing a ~ 2.6% global reduction in PM 2.5 cardiovascular and lung cancer deaths and a ~3.6% global reduction in childhood asthma. Despite these reductions, low-sulphur marine fuels will still account for ~250k deaths and ~6.4 M childhood asthma cases annually, and more stringent standards beyond 2020 may provide additional health benefits. Lower sulphur fuels also reduce radiative cooling from ship aerosols by ~80%, equating to a ~3% increase in current estimates of total anthropogenic forcing. Therefore, stronger international shipping policies may need to achieve climate and health targets by jointly reducing greenhouse gases and air pollution.

  9. Cleaner shipping. Trade off between air pollution, costs and refinery CO2 emissions

    International Nuclear Information System (INIS)

    De Wilde, H.P.J.; Kroon, P.

    2008-05-01

    Still subject to final approval in October 2008, the International Maritime Organisation (IMO) agreed on a maximum sulphur content of 0.5% for shipping fuels in 2020. This target will induce major changes in the global refinery industry. We have estimated the impact on the Dutch refinery industry, which annually produces about 8 million tons of heavy fuel oil for sea shipping, with refinery residues as main component. It is technically possible to convert all residues, although this process will cause an additional energy use of about one million tons of crude oil and a related CO2 emission of about 4 million tons. The investment costs for these major changes in the Dutch refinery industry are estimated at about 1.5 tot 2 billion euros. The recent IMO agreement enables a gradual introduction of cleaner shipping fuels, which will reduce market disruptions and peak prices. Nevertheless, Rotterdam may not necessarily be able to develop a similar position in import, export and bunkering of future low sulphur fuels, compared to its present strong position in the market of heavy marine bunkers. Extrapolation of our national study to the global scale suggests that the deep conversion of 350 million tons of heavy fuel oil for shipping would require refinery investments in the order of 70-100 billion euros. The associated CO2 emissions would amount up to 175 Mton. The net additional CO2 emission, however, would be smaller since lighter shipping fuels result in less CO2 emissions at sea. On balance, we expect that the improvements in fuel economy, driven by the expensive low-carbon shipping fuels, will decrease CO2 emissions more than the increase in CO2 emissions from additional desulphurization in the refineries. Nevertheless CO2 emissions from sea shipping will continue to increase since marine transport is rapidly growing

  10. SKI's and SSI's review of SKB's safety report SR-Can

    Energy Technology Data Exchange (ETDEWEB)

    Dverstorp, Bjoern; Stroemberg, Bo (and others)

    2008-03-15

    This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be

  11. NERSC 2001 Annual Report; ANNUAL

    International Nuclear Information System (INIS)

    Hules, John

    2001-01-01

    The National Energy Research Scientific Computing Center (NERSC) is the primary computational resource for scientific research funded by the DOE Office of Science. The Annual Report for FY2001 includes a summary of recent computational science conducted on NERSC systems (with abstracts of significant and representative projects); information about NERSC's current systems and services; descriptions of Berkeley Lab's current research and development projects in applied mathematics, computer science, and computational science; and a brief summary of NERSC's Strategic Plan for 2002-2005

  12. Annual report 1994. NV Gemeenschappelijk Kolenbureau Elektriciteitsproduktiebedrijven (GVE)

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    GKE supplies coal for public generation of electricity and heating in the Netherlands. The annual report gives details of GKE's business and activities during the year including information on coal markets, shipping, coal requirements, coal sources, suppliers, contracts, logistics, coal quality, quality control, air pollution control, throughput and coal stocks and inland transportation. Financial data for the year ending 31 December 994 are included

  13. Contribution of ship emissions to the concentration and deposition of air pollutants in Europe

    Directory of Open Access Journals (Sweden)

    S. Aksoyoglu

    2016-02-01

    Full Text Available Emissions from the marine transport sector are one of the least-regulated anthropogenic emission sources and contribute significantly to air pollution. Although strict limits were introduced recently for the maximum sulfur content in marine fuels in the SECAs (sulfur emission control areas and in EU ports, sulfur emissions outside the SECAs and emissions of other components in all European maritime areas have continued to increase in the last two decades. We have used the air quality model CAMx (Comprehensive Air Quality Model with Extensions with and without ship emissions for the year 2006 to determine the effects of international shipping on the annual as well as seasonal concentrations of ozone, primary and secondary components of PM2.5, and the dry and wet deposition of nitrogen and sulfur compounds in Europe. The largest changes in pollutant concentrations due to ship emissions were predicted for summer. Concentrations of particulate sulfate increased due to ship emissions in the Mediterranean (up to 60 %, the English Channel and the North Sea (30–35 %, while increases in particulate nitrate levels were found especially in the north, around the Benelux area (20 %, where there were high NH3 land-based emissions. Our model results showed that not only are the atmospheric concentrations of pollutants affected by ship emissions, but also depositions of nitrogen and sulfur compounds increase significantly along the shipping routes. NOx emissions from the ships, especially in the English Channel and the North Sea, cause a decrease in the dry deposition of reduced nitrogen at source regions by moving it from the gas phase to the particle phase which then contributes to an increase in the wet deposition at coastal areas with higher precipitation. In the western Mediterranean region, on the other hand, model results show an increase in the deposition of oxidized nitrogen (mostly HNO3 due to the ship traffic. Dry deposition of SO2 seems to

  14. Nuclear ship accidents, description and analysis

    International Nuclear Information System (INIS)

    Oelgaard, P.L.

    1993-03-01

    In this report available information on 44 reported nuclear ship events is considered. Of these 6 deals with U.S. ships and 38 with USSR ships. The ships are in almost all cases nuclear submarines. Only events that involve the sinking of vessels, the nuclear propulsion plants, radiation exposures, fires/ explosions, sea-water leaks into the submarines and sinking of vessels are considered. Comments are made on each of the events, and at the end of the report an attempt is made to point out the weaknesses of the submarine designs which have resulted in the accidents. It is emphasized that some of the information of which this report is based, may be of dubious nature. Consequently some of the results of the assessments made may not be correct. (au)

  15. Orchestrating Transnational Environmental Governance in Maritime Shipping

    DEFF Research Database (Denmark)

    Lister, Jane; Taudal Poulsen, René; Ponte, Stefano

    2015-01-01

    Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body—the Interna......Maritime shipping is the transmission belt of the global economy. It is also a major contributor to global environmental change through its under-regulated air, water and land impacts. It is puzzling that shipping is a lagging sector as it has a well-established global regulatory body...... emerging private ‘green shipping’ initiatives to achieve better ecological outcomes? Contributing to transnational governance theory, we find that conditions stalling regulatory progress include low environmental issue visibility, poor interest alignment, a broadening scope of environmental issues...

  16. Ship dynamics for maritime ISAR imaging.

    Energy Technology Data Exchange (ETDEWEB)

    Doerry, Armin Walter

    2008-02-01

    Demand is increasing for imaging ships at sea. Conventional SAR fails because the ships are usually in motion, both with a forward velocity, and other linear and angular motions that accompany sea travel. Because the target itself is moving, this becomes an Inverse- SAR, or ISAR problem. Developing useful ISAR techniques and algorithms is considerably aided by first understanding the nature and characteristics of ship motion. Consequently, a brief study of some principles of naval architecture sheds useful light on this problem. We attempt to do so here. Ship motions are analyzed for their impact on range-Doppler imaging using Inverse Synthetic Aperture Radar (ISAR). A framework for analysis is developed, and limitations of simple ISAR systems are discussed.

  17. Solvency and Liquidity in Shipping Companies

    Directory of Open Access Journals (Sweden)

    Heejung Yeo

    2016-12-01

    Full Text Available This study examines factors affecting the solvency of shipping firms. The paper uses a panel dataset and employs the GLM and FGLS regression analyses. This study explores the financial structure of top 130 shipping firms provided by the Factiva database during the period between 2009 and 2013. The paper finds that liquidity is closely related to the leverage of shipping companies. The negative association between the asset liquidity and the leverage level implies that there exist conflicts of interest between managers and investors. Shipping firms have a comfortable high liquidity position, but they have a high degree of leverage. They need to take steps to reduce debts. There is evidence of heterogeneity in the determinants of leverage level. The paper also finds that the variables such as profitability, FSIZE, FAGE influence differently the leverage level whether the debt is short-term or long-term.

  18. Communication from the Radioactive Shipping Service

    CERN Multimedia

    DDGS Unit

    2011-01-01

    The radioactive materials Import/Export service reminds you that all movements of potentially radioactive material must be declared in advance. For exports, shipping requests must be made via the EDH request form, ticking the box “radioactive material”. For imports, an electronic form must be completed before the arrival of the material. Requests which do not comply with the above procedure and any unauthorized imports of radioactive material will be refused.The same applies to imports/exports of radioactive sources. All necessary information is given in the web site: http://cern.ch/service-rp-shipping Yann Donjoux / Radioactive Shipping Service Phone: +41 22 767.31.71 Fax: +41 22 766.92.00 Email: service-rp-shipping@cern.ch

  19. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  20. Evaluation of the Service Performance of Ships

    DEFF Research Database (Denmark)

    Andersen, Poul; Borrod, Anne-Sophie; Blanchot, Hervé

    2005-01-01

    of voyages for the same ship. The procedure has been applied to two ships that are identical, with the exception that one has a conventional propeller, whereas the other one is fitted with a high-efficiency propeller of the KAPPEL type. The results are obtained from a period of 2 years steaming for both...... vessels. They clearly confirm the increase of propulsive efficiency obtained with the KAPPEL propeller in the order of magnitude of 4%....

  1. Study of the Optimal Timing of Container Ship Orders Considering the Uncertain Shipping Environment

    Directory of Open Access Journals (Sweden)

    Jun Woo Jeon

    2017-07-01

    Full Text Available This study aims to apply System Dynamics (SD to analyze the optimal timing of container ship orders by considering the uncertain shipping environment. The collected monthly data for 12 years was obtained from the China seaborne container trade (CSCT and the China Containerized Freight Index (CCFI. Containership fleet development and the prices of new and second-hand container ships were classified based on five container vessel sizes (January of 2004–December of 2015. The period of simulation for this study was from 2004 to 2020. To analyze the optimal timing for the container ship orders, container ship fleet development as a supply factor and the CSCT as a demand factor, both of which are components of CCFI, were simulated. After the first simulation, CCFI was simulated holistically. Based on the CCFI simulation results, it was possible to develop three optimal timing scenarios for ship order placement. The CCFI for October 2016 was in the initial entry status of a short-term rebound, which makes it possible for shipping companies to order ships without the risk of revenue loss. The second best time period is May 2018, before the CCFI recovery of May 2019. The third best time for ship orders is later in 2020 for a CCFI recovery after 2021.

  2. Optimal Evasive Maneuver for a Ship in an Environment of Fixed Installations and Other Ships

    Directory of Open Access Journals (Sweden)

    Rolf Skjong

    1982-10-01

    Full Text Available Collision avoidance for encounters between several ships and installations in the open sea, is treated as a problem of optimal control, using the theory of differential games. Each ship is, in this idealized model, assumed to have two controls corresponding to rudder angle and engine setting. The objective function, which the shipmasters try to minimize in an optimal evasive manoeuvre, is defined as the collision risk. Numerical solutions for the M-ships and I-installations optimal evasive manoeuvre problem, can be found by the ping-pong algorithm. Numerical examples are given for up to five ships and two installations.

  3. A Nonlinear Ship Manoeuvering Model: Identification and adaptive control with experiments for a model ship

    Directory of Open Access Journals (Sweden)

    Roger Skjetne

    2004-01-01

    Full Text Available Complete nonlinear dynamic manoeuvering models of ships, with numerical values, are hard to find in the literature. This paper presents a modeling, identification, and control design where the objective is to manoeuver a ship along desired paths at different velocities. Material from a variety of references have been used to describe the ship model, its difficulties, limitations, and possible simplifications for the purpose of automatic control design. The numerical values of the parameters in the model is identified in towing tests and adaptive manoeuvering experiments for a small ship in a marine control laboratory.

  4. Structural health monitoring for ship structures

    Energy Technology Data Exchange (ETDEWEB)

    Farrar, Charles [Los Alamos National Laboratory; Park, Gyuhae [Los Alamos National Laboratory; Angel, Marian [Los Alamos National Laboratory; Bement, Matthew [Los Alamos National Laboratory; Salvino, Liming [NSWC, CADEROCK

    2009-01-01

    Currently the Office of Naval Research is supporting the development of structural health monitoring (SHM) technology for U.S. Navy ship structures. This application is particularly challenging because of the physical size of these structures, the widely varying and often extreme operational and environmental conditions associated with these ships missions, lack of data from known damage conditions, limited sensing that was not designed specifically for SHM, and the management of the vast amounts of data that can be collected during a mission. This paper will first define a statistical pattern recognition paradigm for SHM by describing the four steps of (1) Operational Evaluation, (2) Data Acquisition, (3) Feature Extraction, and (4) Statistical Classification of Features as they apply to ship structures. Note that inherent in the last three steps of this process are additional tasks of data cleansing, compression, normalization and fusion. The presentation will discuss ship structure SHM challenges in the context of applying various SHM approaches to sea trials data measured on an aluminum multi-hull high-speed ship, the HSV-2 Swift. To conclude, the paper will discuss several outstanding issues that need to be addressed before SHM can make the transition from a research topic to actual field applications on ship structures and suggest approaches for addressing these issues.

  5. AGING EFFECTS ON SHIP STRUCTURAL INTEGRITY

    Directory of Open Access Journals (Sweden)

    Joško Parunov

    2017-01-01

    Full Text Available The most important degradation effects of ship structures are corrosion and fatigue cracks. Both of these aging effects have clear consequences of increasing the level of stresses and degrading the strength of ship structures for almost all relevant failure modes. This study presents an overview of some recent developments on the aging effects on the ship structural integrity. The analysis of the thickness measurements has been undertaken to improve understanding of the corrosion degradation phenomena and to develop prediction models of aging effects suitable for practical applications in the ship structural design and analysis. The study also deals with the application of the non-linear finite element analysis as a suitable tool for a collapse assessment of uniaxially loaded plates and stiffened panels of ship structures weakened by non-uniform corrosion degradation and fatigue cracks. Experimental studies have also been reviewed to better understand the recently found degradation of mechanical properties of corroded steel, while theoretical calculations have been performed to evaluate consequences of such degradation on the ship structural integrity.

  6. Ship design methodologies of preliminary design

    CERN Document Server

    Papanikolaou, Apostolos

    2014-01-01

    This book deals with ship design and in particular with methodologies of the preliminary design of ships. The book is complemented by a basic bibliography and five appendices with useful updated charts for the selection of the main dimensions and other basic characteristics of different types of ships (Appendix A), the determination of hull form  from the data of systematic hull form series (Appendix B), the detailed description of the relational method for the preliminary estimation of ship weights (Appendix C), a brief review of the historical evolution of shipbuilding science and technology from the prehistoric era to date (Appendix D) and finally a historical review of regulatory developments of ship's damage stability to date (Appendix E).  The book can be used as textbook for ship design courses or as additional reading for university or college students of naval architecture courses and related disciplines; it may also serve as a reference book for naval architects, practicing engineers of rel...

  7. The Liner Shipping Fleet Repositioning Problem with Cargo Flows

    DEFF Research Database (Denmark)

    Tierney, Kevin; Jensen, Rune Møller

    2012-01-01

    We solve an important problem for the liner shipping industry called the Liner Shipping Fleet Repositioning Problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. Shippers wish...

  8. Automatic production planning for the construction of complex ships

    NARCIS (Netherlands)

    Rose, C.D.

    2017-01-01

    European shipyards specialize in building complex ship types including offshore vessels, yachts, dredgers, and cruise ships. One key difference between these ships and the simple cargo ships typically built in the Far East is the amount and variety of mission-related equipment required to operate

  9. 76 FR 30229 - Shipping Coordinating Committee; Notice of Committee Meeting

    Science.gov (United States)

    2011-05-24

    ... systems. --Requirements for ships carrying hydrogen and compressed natural gas vehicles. --Fire resistance.... --Recycling of ships. --Prevention of air pollution from ships. --Reduction of GHG emissions from ships..., air inlets and openings in the superstructure of tankers. --Means of escape from machinery spaces...

  10. A building cost estimation method for inland ships

    NARCIS (Netherlands)

    Hekkenberg, R.G.

    2014-01-01

    There is very little publicly available data about the building cost of inland ships, especially for ships that have dimensions that differ significantly from those of common ships. Also, no methods to determine the building cost of inland ships are described in literature. In this paper, a method

  11. 32 CFR 700.872 - Ships and craft in drydock.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Ships and craft in drydock. 700.872 Section 700... Special Circumstances/ships in Naval Stations and Shipyards § 700.872 Ships and craft in drydock. (a) The... ship or craft, not in commission, is in a naval drydock, the provisions of this article shall apply...

  12. The systematic roles of SKI and SSI in the Swedish nuclear waste management system. Syncho`s report for project RISCOM

    Energy Technology Data Exchange (ETDEWEB)

    Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)

    1998-01-01

    The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.

  13. Development of software for handling ship's pharmacy.

    Science.gov (United States)

    Nittari, Giulio; Peretti, Alessandro; Sibilio, Fabio; Ioannidis, Nicholas; Amenta, Francesco

    2016-01-01

    Ships are required to carry a given amount of medicinal products and medications depending on the flag and the type of vessel. These medicines are stored in the so called ship's "medicine chest" or more properly - a ship pharmacy. Owing to the progress of medical sciences and to the increase in the mean age of seafarers employed on board ships, the number of pharmaceutical products and medical devices required by regulations to be carried on board ships is increasing. This may make handling of the ship's medicine chest a problem primarily on large ships sailing on intercontinental routes due to the difficulty in identifying the correspondence between medicines obtained abroad with those available at the national market. To minimise these problems a tool named Pharmacy Ship (acronym: PARSI) has been developed. The application PARSI is based on a database containing the information about medicines and medical devices required by different countries regulations. In the first application the system was standardised to comply with the Italian regulations issued on the 1st October, 2015 which entered into force on the 18 January 2016. Thanks to PARSI it was possible to standardize the inventory procedures, facilitate the work of maritime health authorities and make it easier for the crew, not professional in the field, to handle the 'medicine chest' correctly by automating the procedures for medicines management. As far as we know there are no other similar tools available at the moment. The application of the software, as well as the automation of different activities, currently carried out manually, will help manage (qualitatively and quantitatively) the ship's pharmacy. The system developed in this study has proved to be an effective tool which serves to guarantee the compliance of the ship pharmacy with regulations of the flag state in terms of medicinal products and medications. Sharing the system with the Telemedical Maritime Assistance Service may result in

  14. Annual report

    International Nuclear Information System (INIS)

    1986-01-01

    This is the thirty-ninth annual report of the Atomic Energy Control Board. The period covered by this report is the year ending March 31, 1986. The Atomic Energy Control Board (AECB) was established in 1946, by the Atomic Energy Control Act (AEC Act), (Revised Statues of Canada (R.S.C.) 1970 cA19). It is a departmental corporation (Schedule B) within the meaning and purpose of the Financial Administration Act. The AECB controls the development, application and use of atomic energy in Canada, and participates on behalf of Canada in international measures of control. The AECB is also repsonsible for the administration of the Nuclear Liability Act, (R.S.C. 1970 c29 1st Supp) as amended, including the designation of nuclear installations and the prescription of basic insurance to be carried by the operators of such nuclear installations. The AECB reports to Parliament through a designated Minister, currently the Minister of Energy, Mines and Resources

  15. The Administrator's Annual Report 2000-2001

    International Nuclear Information System (INIS)

    2001-01-01

    This annual report of the Ship-Source Oil Pollution Fund (SOPF) describes the compensation regime of the Fund which may include claims for oil pollution damage; claims for costs and expenses of oil spill clean-up, including the cost of preventive measures; and claims for oil pollution damage and clean-up costs where the identity of the ship that caused the discharge cannot be established, the so-called 'mystery spills'. The main body of the report consists of descriptions of the status of oil pollution incidents brought to the attention of the Administrator. It does not include incidents which were settled directly with ship owners, hence not requiring intervention by the SOPF Administrator. The current status of recovery action by the Administrator against ship-owners is also discussed, along with the issue of port of refuge for damaged ships at sea; the continuing challenge for classification societies, and others in the marine industry to ensure construction, staffing and management of well-founded ships, so that they can be operated safely to preclude environmental damage; and international safety management principles and guidelines for the safe operation of ships and pollution prevention. Also discussed are various actions by the International Maritime Organization (IMO) to review the effectiveness and impact of the ISM code to date, the IMO's timetable for the accelerated phasing out of single hull oil tankers, the differences in handling compensation for environmental damage under the CSA (Canada Shipping Act), the IOPC (International Oil Pollution Compensation Fund) regime, and the US OPA (Oil Pollution Act). SOPF's liabilities to the International Fund, and SOPF's outreach activities during the reporting period are also discussed. A financial summary is provided. Full financial statement is said to available on request. Seven appendices contain various relevant documentation, including summaries of the proceedings of the 1971 and 1992 IOPC Fund executive

  16. Prediction of Ship Unsteady Maneuvering in Calm Water by a Fully Nonlinear Ship Motion Model

    Directory of Open Access Journals (Sweden)

    Ray-Qing Lin

    2012-01-01

    Full Text Available This is the continuation of our research on development of a fully nonlinear, dynamically consistent, numerical ship motion model (DiSSEL. In this study we will report our results in predicting ship motions in unsteady maneuvering in calm water. During the unsteady maneuvering, both the rudder angle, and ship forward speed vary with time. Therefore, not only surge, sway, and yaw motions occur, but roll, pitch and heave motions will also occur even in calm water as heel, trim, and sinkage, respectively. When the rudder angles and ship forward speed vary rapidly with time, the six degrees-of-freedom ship motions and their interactions become strong. To accurately predict the six degrees-of-freedom ship motions in unsteady maneuvering, a universal method for arbitrary ship hull requires physics-based fully-nonlinear models for ship motion and for rudder forces and moments. The numerical simulations will be benchmarked by experimental data of the Pre-Contract DDG51 design and an Experimental Hull Form. The benchmarking shows a good agreement between numerical simulations by the enhancement DiSSEL and experimental data. No empirical parameterization is used, except for the influence of the propeller slipstream on the rudder, which is included using a flow acceleration factor.

  17. Risk Analysis on Ship Wreck and Container Cargo to Ship Navigation

    Directory of Open Access Journals (Sweden)

    Muhammad Badrus Zaman

    2017-03-01

    Full Text Available Wreck of a ship is an incident that must be avoided. Ship accidents are generally caused by a several cases, such as human error, natural disaster, technical errors, missed communication, poor condition of the ship, and many more. Ship wreckage have huge impact for ship navigation, environment, economics, and others. Those impact have many disadvantages for the shipowners, and also for environment. For examples the fuel spills that pollute the environment, make disturbance to sailing ship because the track for those navigation is blocked by the ship wreck and their cargo especially on shallow location (<50 m. These research will discuss the effect the container when it is floats on the sea and its interference other ships. The main objective of this study is to present a risk assessment on the environmental impact of the wreck and container cargo. Wrecks on the seabed is likely to pose a risk to passing ships. container and its contents as well as the possibility of refloat, and also their environmental risks emanating from the wreck and container cargo, such as fuels, lubricants, and chemical cargo. Variations scenario is a collision between ships that pass by floating containers. The frequency of refloating container, and the consequences of the passing ship depends on several factors, which will be the subject of research. However, because of the frequency of refloating containers is unlikely, then the risk is low and does not pose a danger to navigation. These risk assessment using risk matrix 5x5 which is the combined value of the frequency and consequences of the incident. The results of this study indicate the level of risk, whether the risk is accepted, not accepted or received by considering the costs and benefits (ALARP. To consequence, there are two parameters which energy is absorbed and the penetration occurs. The absorbed energy is divided into two, namely the energy absorbed by ship and the energy absorbed by containers. In this

  18. A Simplified Method for Calculating Propeller Thrust Decrease for a Ship Sailing on a Given Shipping Lane

    Directory of Open Access Journals (Sweden)

    Zelazny Katarzyna

    2014-04-01

    Full Text Available During ship sailing on rough water, relative ship motions can be observed which make the propeller emerge from the water, and decrease its thrust as a consequence. The article presents a simplified method for calculating the thrust decrease and the time of propeller emergence from water for the ship on a regular an irregular wave. The method can be used for predicting the operating speed of the ship on a given shipping lane.

  19. Radiative Forcing Over Ocean by Ship Wakes

    Science.gov (United States)

    Gatebe, Charles K.; Wilcox, E.; Poudyal, R.; Wang, J.

    2011-01-01

    Changes in surface albedo represent one of the main forcing agents that can counteract, to some extent, the positive forcing from increasing greenhouse gas concentrations. Here, we report on enhanced ocean reflectance from ship wakes over the Pacific Ocean near the California coast, where we determined, based on airborne radiation measurements that ship wakes can increase reflected sunlight by more than 100%. We assessed the importance of this increase to climate forcing, where we estimated the global radiative forcing of ship wakes to be -0.00014 plus or minus 53% Watts per square meter assuming a global distribution of 32331 ships of size of greater than or equal to 100000 gross tonnage. The forcing is smaller than the forcing of aircraft contrails (-0.007 to +0.02 Watts per square meter), but considering that the global shipping fleet has rapidly grown in the last five decades and this trend is likely to continue because of the need of more inter-continental transportation as a result of economic globalization, we argue that the radiative forcing of wakes is expected to be increasingly important especially in harbors and coastal regions.

  20. Qualification of ship doctors: a German approach.

    Science.gov (United States)

    Seidenstuecker, Klaus H; Neidhardt, Stefan

    2014-01-01

    While a steady growth of cruise tourism since the 1970s created an increasing demand for ship doctors medical postgraduate specialty training did not sufficiently reflect the scope of skills and knowledge required from a physician being left to himself at sea. The German Maritime Health Association therefore tasked a working group with analysing the situation and coming up with suggestions for an adequate postgraduate training for ship doctors. The working group consisted of 19 experts with various backgrounds in maritime medicine. A literature review was done on cruise ship epidemiology as well as an assessment of tasks and environmental factors influencing medical care on board of cruise ships. Necessary knowledge and skills were derived and compared with those imparted by standard German medical education. Mandatory knowledge and skills were identified as well as elements of standard medical education contributing to these goals. Those aspects that would or could not be adequately covered by German standard education were catalogued and summarised in a course curriculum. In 2013 after approval by its board of directors the German Maritime Health Association published a qualification and training recommendation addressing colleagues planning to muster as ship doctors.

  1. Quantitative analysis method for ship construction quality

    Directory of Open Access Journals (Sweden)

    FU Senzong

    2017-03-01

    Full Text Available The excellent performance of a ship is assured by the accurate evaluation of its construction quality. For a long time, research into the construction quality of ships has mainly focused on qualitative analysis due to a shortage of process data, which results from limited samples, varied process types and non-standardized processes. Aiming at predicting and controlling the influence of the construction process on the construction quality of ships, this article proposes a reliability quantitative analysis flow path for the ship construction process and fuzzy calculation method. Based on the process-quality factor model proposed by the Function-Oriented Quality Control (FOQC method, we combine fuzzy mathematics with the expert grading method to deduce formulations calculating the fuzzy process reliability of the ordinal connection model, series connection model and mixed connection model. The quantitative analysis method is applied in analyzing the process reliability of a ship's shaft gear box installation, which proves the applicability and effectiveness of the method. The analysis results can be a useful reference for setting key quality inspection points and optimizing key processes.

  2. The Caribbean Cruise Ship Business and the Emergence of a Transnational Capitalist Class

    Directory of Open Access Journals (Sweden)

    Jeb Sprague-Silgado

    2017-02-01

    Full Text Available This paper will provide an overview of the fundamental changes that the cruise ship business has undergone with the emergence of capitalist globalization and in the context of the Caribbean region. Rising profits and investments in tourism during the later decades of the 20th century and into the 21st century have been an important part of the globalizing economy. This has been a consequence of both the major technological and organizational developments of global capitalism, but also, and most importantly, of the global system’s changing social and class relations. The shifting social relations and productive activities that undergird the cruise ship business have meant gains for some involved, most especially, transnational capitalists, and exploitative and contradictory dynamics for many others. Annually millions of tourists from high consuming sectors worldwide partake in brief holiday escapes aboard cruise ship vessels. At the same time, the cruise ship business has become an oligopoly, controlled by a handful of large companies, that has driven many competitors out of business or acquiried them. Labor in the business has become more flexibilized, with low-wage workers (from a variety of nationalities whose activities are increasingly standardized, monitored and micro-managed. While moving away from indicative development planning (with an eye to national goals, state policymakers in the Caribbean, for their own social reproduction, increasingly promote the interests of transnational capital such as with the cruise ship business. Importantly, labor and environmental protections have been stymied as the cruise ship companies, adept at public relations and skirting regulations, remain largely unaccountable.

  3. Ganymede’s stratigraphy and crater distributions in Voyager and Galileo SSI images: results from the anti-jovian hemisphere

    Science.gov (United States)

    Wagner, Roland Josef; Schmedemann, Nico; Stephan, Katrin; Werner, Stephanie; Ivanov, Boris A.; Roatsch, Thomas; Jaumann, Ralf; Palumbo, Pasquale

    2017-10-01

    Crater size distributions are a valuable tool in planetary stratigraphy to derive the sequence of geologic events. In this study, we extend our previous work [1] in Ganymede’s sub-jovian hemisphere to the anti-jovian hemisphere. For geologic mapping, the map by [2] is used as a reference. Our study provides groundwork for the upcoming imaging by the JANUS camera aboard ESA’s JUICE mission [3]. Voyager-2 images are reprocessed using a map scale of 700 m/pxl achieved for parts of the anti-jovian hemisphere. To obtain relative ages from crater frequencies, we apply an updated crater scaling law for cratering into icy targets in order to derive a crater production function for Ganymede [1]. Also, we adopt the Poisson timing analysis method discussed and implemented recently [4] to obtain relative (and absolute model) ages. Results are compared to those from the sub-jovian hemisphere [1] as well as to support and/or refine the global stratigraphic system by [2]. Further emphasis is placed on local target areas in the anti-jovian hemisphere imaged by Galileo SSI at regional map scales of 100 to 300 m/pxl in order to study local geologic effects and processes. These areas incorporate (1) dark and (2) light tectonized materials, and (3) impact crater materials including an area with numerous secondaries from ray crater Osiris. References: [1] Wagner R. et al. (2014), DPS meeting #46, abstract 418.09. [2] Collins G. et al. (2013), U.S.G.S. Sci. Inv. Map 3237. [3] Della Corte V. et al. (2014), Proc. SPIE 9143, doi:10.1117/12.2056353. [4] Michael G. et al. (2016), Icarus 277, 279-285.

  4. A Composition Study of Europa's Impact Scars (Tyre and Pwyll) as Seen By Galileo NIMS and SSI

    Science.gov (United States)

    Granahan, J.; Fanale, F.; Greeley, R.; Kadel, S.; Chuang, F.; Pappalardo, R.; Head, J. W., III; Moore, J.; Asphaug, E.; Kamp, L.; Smythe, W. D.; Carlson, R. W.; Galileo NIMS Team; Galileo SSI Team

    1998-09-01

    Tyre's morphology suggests that the impact occurred on a target with a brittle elastic lithosphere underlain by a liquid or highly ductile material. Infrared data show this region and the impact scar dominated by water ice with some features such as linea, some lenticulae, and a few portions of Tyre's concentric ring structure possessing a subtle asymmetric spectral features near 1.48 and 2.0 micrometers in wavelength. Using linear spectral mixing models of NIMS data or Rhadamanthys Linea and that of water ice, we have determined that these spectra can be matched with approximately 10% Rhadamanthys Linea material and 90% water ice. A candidate for the Rhadamanthys Linea material are saline hydrates. Why is this signature so weak? The infrared data has a resolution of 6 km/pixel compared to the Rhadamanthys Linea observation with 2 km/pixel. Areal mixing of the spectra of water ice and the possible saline hydrate material could match the infrared observations. SSI observations also see red spectral material (also associated with Rhadamanthys Linea) in the concentric ring structure of Tyre not seen by NIMS. The morphology of Tyre suggests that the candidate saline hydrate material was derived from the fluid/highly ductile layers below. Pwyll's morphology implies that it impacted a brittle lithosphere overlying much less ductile material. Its long rays have a strong infrared water ice signature. Pwyll also possesses `dark' material within its crater which also possess infrared asymmetric features (described above). Linear spectra mixing models suggest that these `dark' materials may be 50/50 water ice and candidate saline hydrate material. As the infrared data has a resolution of 1.25 km/pixel, we are not seeing the same concentration of this candidate saline hydrate materials as seen in some linea. It does suggest that Pwyll impacted into a layer of material which maybe a salt/ice mixture.

  5. The Two Regimes of Postwar Shipping

    DEFF Research Database (Denmark)

    Iversen, Martin Jes; Tenold, Stig

    2014-01-01

    The aim of this article is to illustrate the most important changes in the regulatory framework of the shipping sector from the 1960s to 2010, and to analyse the basis for, and effects of, these changes. In order to explain how the transformation has occurred, we use two traditional maritime...... nations—Denmark and Norway—as case studies. First, we introduce the two regimes of Danish and Norwegian shipping: ‘the national regime’ from the early 1960s to the mid-1970s; and ‘the competitive regime’, which was fully established by the middle of the 1990s and still persists. Then, we briefly sketch...... the bargaining that accompanied the shift from the national regime to the competitive regime. Specifically, we show that the new regime primarily accommodated the interests of private actors such as shipping companies, rather than the interests of the authorities and the trade unions....

  6. BALTIC CONTAINER SHIPPING MARKET GOES GLOBAL

    Directory of Open Access Journals (Sweden)

    Ernest Czermański

    2016-03-01

    Full Text Available This paper aims at summarizing the last period of the Baltic container shipping mar-ket’s development, especially after 2000. The author, taking especially into account changes that have occurred in 2010, ultimately demonstrate that through the analyzed changes, this market has become a global one - thus being shaped by global determinants influencing its further development. Author selected and analyzed some chosen, most important factors influencing future market development. Secondly, some chances and threats resulting from the described changes were presented, either for the entire market as a base for international trade of Baltic Sea Region countries, and for its actors, mainly shipping owners and operators acting as a supply side of the Baltic container market. Finally, author has tried to verify and questioned the doubts and strong concerns about the future of the Baltic container shipping, especially about the feeder services, as because there are real indications and arguments against these concern.

  7. Key Design Properties for Shipping Information Pipeline

    DEFF Research Database (Denmark)

    Jensen, Thomas; Tan, Yao-Hua

    2015-01-01

    on paper, e-mail, phone and text message, and far too costly. This paper explores the design properties for a shared information infrastructure to exchange information between all parties in the supply chain, commercial parties as well as authorities, which is called a Shipping Information Pipeline...... Infrastructures. The paper argues why the previous attempts are inadequate to address the issues in the domain of international supply chains. Instead, a different set of key design properties are proposed for the Shipping Information Pipeline. The solution has been developed in collaboration with a network......This paper reports on the use of key design properties for development of a new approach towards a solution for sharing shipping information in the supply chain for international trade. Information exchange in international supply chain is extremely inefficient, rather uncoordinated, based largely...

  8. Ship information system: overview and research trends

    Directory of Open Access Journals (Sweden)

    Sheng Liu

    2014-09-01

    Full Text Available Ship Information Systems (SISs have been one of the main research focuses in ship design and become a multidisciplinary area. With these growing research trends, it is important to consolidate the latest knowledge and information to keep up with the research needs. In this paper, the SIS and its different forms are introduced and discussed. The beginning of this paper discusses the history and evolution of SIS. The next part of this paper focuses on different fields and research areas such as networking technology, information fusion, information decision, message display, ship control in real-time SISs. A Semi-Physical Simulation Platform (SPSIM designed for SIS research and its running effect through a new Fuzzy-PID fusion algorithm are introduced in this paper then. A brief literature survey and possible future direction concerning each topic is included.

  9. Time constrained liner shipping network design

    DEFF Research Database (Denmark)

    Karsten, Christian Vad; Brouer, Berit Dangaard; Desaulniers, Guy

    2017-01-01

    We present a mathematical model and a solution method for the liner shipping network design problem. The model takes into account coordination between vessels and transit time restrictions on the cargo flow. The solution method is an improvement heuristic, where an integer program is solved...... iteratively to perform moves in a large neighborhood search. Our improvement heuristic is applicable as a real-time decision support tool for a liner shipping company. It can be used to find improvements to the network when evaluating changes in operating conditions or testing different scenarios...

  10. Code of safety for nuclear merchant ships

    International Nuclear Information System (INIS)

    1982-01-01

    The Code is in chapters, entitled: general (including general safety principles and principles of risk acceptance); design criteria and conditions; ship design, construction and equipment; nuclear steam supply system; machinery and electrical installations; radiation safety (including radiological protection design; protection of persons; dosimetry; radioactive waste management); operation (including emergency operation procedures); surveys. Appendices cover: sinking velocity calculations; seaway loads depending on service periods; safety assessment; limiting dose-equivalent rates for different areas and spaces; quality assurance programme; application of single failure criterion. Initial application of the Code is restricted to conventional types of ships propelled by nuclear propulsion plants with pressurized light water type reactors. (U.K.)

  11. Probabilistic Damage Stability Calculations for Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    1996-01-01

    compartments in the formulation of a computer-based general procedure for probabilistic damaged stability assessment is shown. Some comments are given on the current state of knowledge on the ship survivability in damaged conditions. Finally, problems regarding proper account of water ingress through openings......The aim of these notes is to provide background material for the present probabilistic damage stability rules fro dry cargo ships.The formulas for the damage statistics are derived and shortcomings as well as possible improvements are discussed. The advantage of the definiton of fictitious...

  12. Quarterly, Bi-annual and Annual Reports

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Quarterly, Bi-annual and Annual Reports are periodic reports issued for public release. For the deep set fishery these reports are issued quarterly and anually....

  13. A PDDL Domain for the Liner Shipping Fleet Repositioning Problem

    DEFF Research Database (Denmark)

    Tierney, Kevin; Coles, Amanda; Coles, Andrew

    The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs that are a ......The Liner Shipping Fleet Repositioning Problem (LSFRP) poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between services in a liner shipping network. The LSFRP is characterized by chains of interacting activities, many of which have costs...

  14. Challenges to Ship Hydrodynamics in the XXI Century

    Directory of Open Access Journals (Sweden)

    Lech Kobylinski

    2014-09-01

    Full Text Available The beginning of twenty-first century is characterized with important changes in world shipping and exploitation of ocean resources. Three important trends are clearly visible: environment protection, safety and economy. They materialize in important changes in the structure of world fleet where some existing ship types are going to disappear and new ship types emerge. Increasing the size of some ship types is another visible tendency. Stress on environment protection has serious impact on the hydrodynamic characteristics of ships whether with regard to safety zero accident rate is the goal. Important challenges to ship hydrodynamics caused by those tendencies are discussed in the paper.

  15. Chemical tracers of shipping emissions in a Mediterranean harbour

    Science.gov (United States)

    Viana, M.; Amato, F.; Alastuey, A.; Querol, X.; Román, A.; García, M.

    2009-04-01

    , 30 m3/h) at a rate of 2 samples per week for each size fraction. This resulted in 78 and 77 valid PM10 and PM2.5 samples, respectively. All samples were weighed and analysed for major and trace elements following the methodology described by Querol et al. (2004). The data collected over the annual period was analysed as a function of the wind sectors defining the main PM sources: 0-45° (open sea), 45-135° (harbour) and 135-360° (land). PM levels and chemical composition were evaluated for each of these sectors, and initial results on hourly PM levels (24000 data points) showed striking similarities between the results from the open sea (46 µgPM10/m3, 22 µgPM2.5/m3, 14 µgPM1/m3) and the harbour (44 µgPM10/m3, 21 µgPM2.5/m3, 13 µgPM1/m3) sectors, which were markedly different from those recorded from the land (37 µgPM10/m3, 16 µgPM2.5/m3, 11 µgPM1/m3). This indicated that the impact of shipping emissions on urban background PM levels do not represent only harbour emissions, but also emissions produced during vessel traffic into and out of the harbour, and also across from Melilla and through the Gibraltar Strait. The same kind of analysis was carried out for the levels of tracers species and tracer ratios, in search for a marker of shipping emissions. Results showed that the V/Ni ratio followed a similar pattern to that detected for PM levels, with similar values for the open sea and harbour sectors (4.1 and 4.0, respectively), which differed widely from the ratio obtained from land (12.4). These results evidence the value of the V/Ni ratio as a marker for shipping emissions in Melilla. Further research is ongoing in search of other tracer species and/or tracer ratios. Furthermore, a source apportionment analysis will be carried our by means of PMF, which will be followed by a Multi-linear Engine (ME) analysis with pulling towards the marker V/Ni ratio and aimed at quantifying the impact on urban PM levels of shipping emissions in Melilla. Acknowledgements

  16. WP2 Annual Report 1st year

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    2006-01-01

    This report constitutes a contribution to the consolidated annual report covering the activities in SAFEDOR for the first year (1/2-2005 to 1/2-2006). The report deals in five separate chapters one for each of the five subprojects. The objectives of WP2 are • To develop and / or refine...... such advanced design tools • To enable integration of the tools into a design environment • To evaluate risk and the effect of risk-control options with the aim to provide tools for fast and reliable evaluation of various risks associated with failure of the ship or its subsystems. Thereby, WP6 dealing...

  17. Microbiologically influenced corrosion in ship ballast tanks

    NARCIS (Netherlands)

    Heyer, A.

    2013-01-01

    Microbiologically influenced corrosion (MIC) is known to be a dangerous process in ship tanks due to its rapid and yet unpredictable occurrence, leading to extremely fast local corrosion, possibly jeopardizing the structural integrity, in a relatively short time. This project focuses on a

  18. 46 CFR Sec. 19 - Ship Repair Summaries.

    Science.gov (United States)

    2010-10-01

    ... unsupported shall be forwarded by the District offices to the Chief, Operating Cost Control Branch, Office of..., purchase orders, price warehouse delivery tickets, property removal notices, WORKSMALREP Contracts, a... removed from a vessel, etc., shall be forwarded to the Chief, Division of Ship Repair and Maintenance...

  19. Design and evaluation of ship's power plants

    NARCIS (Netherlands)

    Meijer, G.J.; Nienhuis, U.; Vugt, J. van; Folkersma, W.

    1999-01-01

    The cruise industry is host to major changes in the way the skip's power plants are configured. Diesel-electric propulsion has replaced most diesel-mechanic systems for larger ships. Podded propulsion is making serious headway and gas turbines are currently under order. In future, fuel cells,

  20. Exergy Analysis of Complex Ship Energy Systems

    Directory of Open Access Journals (Sweden)

    Pierre Marty

    2016-04-01

    Full Text Available With multiple primary and secondary energy converters (diesel engines, steam turbines, waste heat recovery (WHR and oil-fired boilers, etc. and extensive energy networks (steam, cooling water, exhaust gases, etc., ships may be considered as complex energy systems. Understanding and optimizing such systems requires advanced holistic energy modeling. This modeling can be done in two ways: The simpler approach focuses on energy flows, and has already been tested, approved and presented; a new, more complicated approach, focusing on energy quality, i.e., exergy, is presented in this paper. Exergy analysis has rarely been applied to ships, and, as a general rule, the shipping industry is not familiar with this tool. This paper tries to fill this gap. We start by giving a short reminder of what exergy is and describe the principles of exergy modeling to explain what kind of results should be expected from such an analysis. We then apply these principles to the analysis of a large two-stroke diesel engine with its cooling and exhaust systems. Simulation results are then presented along with the exergy analysis. Finally, we propose solutions for energy and exergy saving which could be applied to marine engines and ships in general.

  1. Dutch Ships and Sailors Linked Data

    NARCIS (Netherlands)

    de Boer, Victor; Leinenga, Jurjen; Hoekstra, F.G.; van Rossum, Matthias; Mika, Peter; Tudorache, Tadia; Bernstein, Abraham

    2014-01-01

    We present the Dutch Ships and Sailors Linked Data Cloud. This heterogeneous dataset brings together four curated datasets on Dutch Maritime history as five-star linked data. The individual datasets use separate datamodels, designed in close collaboration with maritime historical researchers. The

  2. Trace of the nuclear powered ship 'Mutsu'

    International Nuclear Information System (INIS)

    1992-01-01

    The development of the nuclear powered ship 'Mutsu' required the long period of about 30 years from 1963 to 1992. When this period is looked back, it is roughly divided into the period from the initial planning to the construction, the period of the power increase test and the occurrence of radiation leak, the period of the repair of shielding and the general safety checkup as the countermeasures, the period of the checkup and maintenance based on the new research plan, the period of the power increase test and the sea trial, and the period of the experimental voyage after the completion. The course of the development of the nuclear powered ship 'Mutsu' is shown. The design of Mutsu, the incidental land facilities for Mutsu, the power increase test and the experimental voyage of Mutsu, the law system for nuclear powered ships, the research and development of an improved marine nuclear reactor and the development of nuclear powered ships in the world are reported. Nuclear powered warships are operated in USA, USSR, UK, France and China. (K.I.)

  3. Reconfigurable Control of a Ship Propulsion Plant

    DEFF Research Database (Denmark)

    Blanke, M.; Izadi-Zamanabadi, Roozbeh

    1998-01-01

    -tolerant control is a fairly new area. Thise paper presents a ship propulsion system as a benchmark that should be useful as a platform for the development of new ideas and a comparison of methods. The benchmark has two main elements. One is the development of efficient FDI algorithms, and the other...

  4. Measuring ship acoustic signatures against mine threat

    NARCIS (Netherlands)

    Jong, C.A.F. de; Quesson, B.A.J.; Ainslie, M.A.; Vermeulen, R.C.N.

    2012-01-01

    The NATO standard ‘AMP-15’ [1] provides procedures for the measurement and reporting of the acoustic signature of ships and for the establishment of acoustic signature goals to counter the naval mine threat. Measurements are carried out at dedicated shallow water acoustic ranges. Measurements

  5. Transfer of structureborne sound to ship's cabins

    NARCIS (Netherlands)

    Regt, M.J.A.M. de

    1979-01-01

    In the laboratory the transfer of structureborne sound from a ship-like steel structure to cabin bulkheads has heen investigated for three types of bulkhead material: chipboard, plastic faced calcium silicate and steel plates sandwiching a rock wool core. The most relevant results of the

  6. Wave energy extraction using decommisioned ships

    DEFF Research Database (Denmark)

    Mansour, A.E.; Pedersen, Preben Terndrup; Paik, J.K.

    2013-01-01

    to scrap naval vessels in 2002 was $33.4 million. Now apparently the Navy sinks naval vessels by bombs and torpedos. Scrapping can cause pollution, health hazards, accidents and threat to the ecosystem. Can a “polluting” ship about to be scrapped be used to generate clean wave energy? Maybe! It is possible...

  7. NOAA Ship Okeanos Explorer Video Collection

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — During each NOAA Ship Okeanos Explorer field season, full-resolution video in a ProRes 422 format at a bitrate of 145 Mbps is produced during each deployment of the...

  8. Navy Ship Names: Background for Congress

    Science.gov (United States)

    2013-06-12

    evolutionary change, and the name sources of the Navy’s ships have not been immune to this change.”9 The July 2012 Navy report to Congress states that...Legion of Honor, and the Croix de Guerre with Gilt Star and 2 palms; Whereas during World War II, Clifton B. Cates led Marines at Guadalcanal, and

  9. Detection of Parametric Roll on Ships

    DEFF Research Database (Denmark)

    Galeazzi, Roberto; Blanke, Mogens; Poulsen, Niels Kjølstad

    2012-01-01

    Recent years have shown several incidents with dramatic damage on container vessels caused by parametric resonance. When the resonance starts, the roll oscillation at a sub-harmonic frequency of the wave excitation may be completely unexpected. Timely warning about the onset of the resonance...... on experimental data from towing tank tests and data from a container ship passing an Atlantic storm....

  10. IS INLAND SHIPPING NEEDED IN POLAND?

    Directory of Open Access Journals (Sweden)

    Ryszard Rolbiecki

    2014-06-01

    Full Text Available In Poland, inland shipping plays only a mariginal role in transport needs fulfillment. Inland shipping has a share of mere 0,3% in goods transport modal split. The reason for this is poor and variable technical parameters of inland waterways together with adverse legal regulations. Different situation takes place in Western European countries, in which the development of this mode of transport is viewed as a way of road transport develop-ment restraint. In Poland, the need to move some of the volume from road transport to in-land shipping is specifically observed within marine ports surroundings. Because of their complex nature, the investments in inland shipping infrastructure would also be helpful in solving the current problems of water management. Inland waterways in Poland guaran-tee neither an adequate level of flood protection, nor the water needs fulfillment of do-mestic economy. When it comes to water reserves, Poland is one of the most deficient countries in Europe. Thus there is a need to invest in inland waterways in Poland.

  11. PARTICIPATION BASED MODEL OF SHIP CREW MANAGEMENT

    Directory of Open Access Journals (Sweden)

    Toni Bielić

    2014-10-01

    Full Text Available 800x600 This paper analyse the participation - based model on board the ship as possibly optimal leadership model existing in the shipping industry with accent on decision - making process. In the paper authors have tried to define master’s behaviour model and management style identifying drawbacks and disadvantages of vertical, pyramidal organization with master on the top. Paper describes efficiency of decision making within team organization and optimization of a ship’s organisation by introducing teamwork on board the ship. Three examples of the ship’s accidents are studied and evaluated through “Leader - participation” model. The model of participation based management as a model of the teamwork has been applied in studying the cause - and - effect of accidents with the critical review of the communication and managing the human resources on a ship. The results have showed that the cause of all three accidents is the autocratic behaviour of the leaders and lack of communication within teams. Normal 0 21 false false false HR X-NONE X-NONE MicrosoftInternetExplorer4

  12. Propagation of light through ship exhaust plumes

    Science.gov (United States)

    van Iersel, M.; Mack, A.; van Eijk, A. M. J.; Schleijpen, H. M. A.

    2014-10-01

    Looking through the atmosphere, it is sometimes difficult to see the details of an object. Effects like scintillation and blur are the cause of these difficulties. Exhaust plumes of e.g. a ship can cause extreme scintillation and blur, making it even harder to see the details of what lies behind the plume. Exhaust plumes come in different shapes, sizes, and opaqueness and depending on atmospheric parameters like wind speed and direction, as well as engine settings (power, gas or diesel, etc.). A CFD model is used to determine the plume's flow field outside the stack on the basis of exhaust flow properties, the interaction with the superstructure of the ship, the meteorological conditions and the interaction of ship's motion and atmospheric wind fields. A modified version of the NIRATAM code performs the gas radiation calculations and provides the radiant intensity of the (hot) exhaust gases and the transmission of the atmosphere around the plume is modeled with MODTRAN. This allows assessing the irradiance of a sensor positioned at some distance from the ship and its plume, as function of the conditions that influence the spatial distribution and thermal properties of the plume. Furthermore, an assessment can be made of the probability of detecting objects behind the plume. This plume module will be incorporated in the TNO EOSTAR-model, which provides estimates of detection range and image quality of EO-sensors under varying meteorological conditions.

  13. Propagation of light through ship exhaust plumes

    NARCIS (Netherlands)

    Iersel, M. van; Mack, A.; Eijk, A.M.J. van; Schleijpen, H.M.A.

    2014-01-01

    Looking through the atmosphere, it is sometimes difficult to see the details of an object. Effects like scintillation and blur are the cause of these difficulties. Exhaust plumes of e.g. a ship can cause extreme scintillation and blur, making it even harder to see the details of what lies behind the

  14. Load and Global Response of Ships

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    The present monograph covers wave load and global structural response for ships. It is primary written as a textbook for students with an introductionary background in naval architecture and a basic knowledge of statistics and strength of materials. The subjects are treated in details starting from...

  15. Global Loads on FRP Ship Hulls

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup

    1997-01-01

    Fibre reinforced plastic (FRP) composites used for high-speed vessels have lower modulus of elasticity than the conventionally used steels.Therefore, for large fast ships the lowest natural frequencies of the global hull modes can be relatively low compared to the frequency of waveencounter...

  16. Network Design Models for Container Shipping

    DEFF Research Database (Denmark)

    Reinhardt, Line Blander; Kallehauge, Brian; Nielsen, Anders Nørrelund

    This paper presents a study of the network design problem in container shipping. The paper combines the network design and fleet assignment problem into a mixed integer linear programming model minimizing the overall cost. The major contributions of this paper is that the time of a vessel route...

  17. Facts about Noroviruses on Cruise Ships

    Science.gov (United States)

    ... passengers sailed on cruise ships in the Vessel Sanitation Program’s jurisdiction. Only 129,678 passengers met the program’s case definition for acute gastrointestinal illness and only a small proportion of those cases (1 in 10) were part of ...

  18. 48 CFR 8.708 - Shipping.

    Science.gov (United States)

    2010-10-01

    ... small orders, ordering offices may specify other shipment methods. (c) When shipments are under.... Failure of an ordering office to furnish bills of lading or to designate a method of transportation may... Blind or Severely Disabled 8.708 Shipping. (a) Delivery is accomplished when a shipment is placed aboard...

  19. Teaching of Naval Architecture and Ship Design

    DEFF Research Database (Denmark)

    Andersen, Poul; Jensen, Jørgen Juncher

    1998-01-01

    freely select their courses. In the paper this system is briefly outlined and the teaching of naval achitecture and offshore engineering within this system described. In contrast to many other universities ship design is taught for students relatively early in their study. This course and the advantages...

  20. Environmental accounting for Arctic shipping - a framework building on ship tracking data from satellites.

    Science.gov (United States)

    Mjelde, A; Martinsen, K; Eide, M; Endresen, Ø

    2014-10-15

    Arctic shipping is on the rise, leading to increased concern over the potential environmental impacts. To better understand the magnitude of influence to the Arctic environment, detailed modelling of emissions and environmental risks are essential. This paper describes a framework for environmental accounting. A cornerstone in the framework is the use of Automatic Identification System (AIS) ship tracking data from satellites. When merged with ship registers and other data sources, it enables unprecedented accuracy in modelling and geographical allocation of emissions and discharges. This paper presents results using two of the models in the framework; emissions of black carbon (BC) in the Arctic, which is of particular concern for climate change, and; bunker fuels and wet bulk carriage in the Arctic, of particular concern for oil spill to the environment. Using the framework, a detailed footprint from Arctic shipping with regards to operational emissions and potential discharges is established. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. EX1101: Ship Shakedown and Patch Tests on NOAA Ship Okeanos Explorer (EM302)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project will involve the shakedown of all Okeanos Explorer ship capabilities and a patch test of the Kongsberg EM302 multibeam system. Operations for this...

  2. Contribution of ship traffic to aerosol particle concentrations downwind of a major shipping lane

    DEFF Research Database (Denmark)

    Kivekäs, N.; Massling, Andreas; Grythe, H.

    2014-01-01

    in Denmark. During episodes of western winds, the site is about 50 km downwind of a major shipping lane and the plumes are approximately 1 hour old when they arrive at the site. We have used a sliding percentile-based method for separating the plumes from the measured background values and to calculate...... species in both particle and gas phase. The total number of analyzed ship plumes was 726, covering on average 19% of the time when air masses were arriving at the site over the shipping lane. During the periods when plumes were present, the particle concentration exceeded the background values on average...... the ship plume contribution to the total particle number and PM0.15 mass concentration (mass of particles below 150 nm in diameter, converted from volume assuming sphericity) at the site. The method is not limited to particle number or volume concentration, but can also be used for different chemical...

  3. INFLUENCE OF OPERABILITY CRITERIA LIMITING VALUES ON SHIP SPEED

    Directory of Open Access Journals (Sweden)

    Jasna Prpić-Oršić

    2016-09-01

    Full Text Available When the ship is caught in heavy seas, there are two manoeuvres that the shipmaster can undertake to avoid excessive ship motion and hull damage: changing course or voluntary speed reduction. This paper presents a study of the effect of the various voluntary speed reduction criteria to attainable speed of ship on seaway. The speed loss is calculated by taking into account wind and wave effect on ship speed, the engine and propeller performance in actual seas as well as the mass inertia of the ship. The attainable ship speed for ship in head, following and beam waves by accounting for voluntary speed reduction is estimated for various significant wave height. The criteria of slamming, deck wetness, propeller emergence, excessive accelerations and roll are taken into account. The impact of variations of the limiting values of certain criteria due to which the captain intentionally reduces the ship speed is analysed and discussed.

  4. Virtual Ship Architecture Description Document Issue 1.00

    National Research Council Canada - National Science Library

    Best, John

    2000-01-01

    The Virtual Ship concept calls for simulation models of systems to be brought together to create a virtual representation of a warship, in a process analogous to the construction of a physical ship...

  5. 78 FR 15031 - Agency Information Collection Activities: Ship's Store Declaration

    Science.gov (United States)

    2013-03-08

    ... stores, ship's stores, controlled narcotic drugs, bunker coal, or bunker oil in a format that can be..., and the articles on the ship. It is pursuant to the provisions of section 432, Tariff Act of 1930 and...

  6. Sustainability reporting within the shipping industry - An exploratory study of the ten largest container shipping companies

    OpenAIRE

    Olsen, Christian

    2015-01-01

    The shipping industry is one of the driving forces of the global economy, and sustainability issues are of key importance to the future of our world. Therefore, this thesis will combine them and look at sustainability within the shipping sector by doing an exploratory study of the ten largest container sh ipping companies . Sustainability reporting is becoming commonplace among larger companies, and therefore this thesis sets out to look at what i...

  7. Autonomous ships in sight: Starting signal for the unmanned merchant shipping project MUNIN

    OpenAIRE

    Burmeister, Hans-Christoph

    2012-01-01

    Autonomous and unmanned vessels are seen as a key element in a competitive and sustainable European shipping industry in the future. For this reason, a new research project called MUNIN (Maritime Unmanned Navigation through Intelligence in Networks) started this September aiming to develop a concept for autonomous ships and to prove its feasibility. It is named after the Old Norse raven, Munin that flew around the world each day without guidance, gathering information and safely returning it ...

  8. The investigation of ship maneuvering with hydrodynamic effects between ships in curved narrow channel

    Directory of Open Access Journals (Sweden)

    Chun-Ki Lee

    2016-01-01

    Full Text Available The hydrodynamic interaction between two large vessels can't be neglected when two large vessels are closed to each other in restricted waterways such as in a harbor or narrow channel. This paper is mainly concerned with the ship maneuvering motion based on the hydrodynamic interaction effects between two large vessels moving each other in curved narrow channel. In this research, the characteristic features of the hydrodynamic interaction forces between two large vessels are described and illustrated, and the effects of velocity ratio and the spacing between two vessels are summarized and discussed. Also, the Inchon outer harbor area through the PALMI island channel in Korea was selected, and the ship maneuvering simulation was carried out to propose an appropriate safe speed and distance between two ships, which is required to avoid sea accident in confined waters. From the inspection of this investigation, it indicates the following result. Under the condition of SP12≤0.5L, it may encounter a dangerous tendency of grounding or collision due to the combined effect of the interaction between ships and external forces. Also considering the interaction and wind effect as a parameter, an overtaken and overtaking vessel in narrow channel can navigate while keeping its own original course under the following conditions; the lateral separation between two ships is about kept at 0.6 times of ship length and 15 degrees of range in maximum rudder angle. On the other hand, two ships while overtaking in curved narrow channel such as Inchon outer harbor in Korea should be navigated under the following conditions; SP12 is about kept at 1.0 times of ship length and the wind velocity should not be stronger than 10 m/s.

  9. Routing and scheduling and fleet management for liner shipping

    DEFF Research Database (Denmark)

    Kjeldsen, Karina Hjortshøj

    2009-01-01

    The problem of routing, scheduling and fleet management in global liner shipping is presented. The developed model incorporates the ships' speed as a decision variable. Furthermore, the model must be able to handle problems of the size and complexity experienced by the global liner shipping compa...

  10. A Mathematical Model for Analysis on Ships Collision Avoidance ...

    African Journals Online (AJOL)

    This study develops a mathematical model for analysis on collision avoidance of ships. The obtained model provides information on the quantitative effect of the ship's engine's response and the applied reversing force on separation distance and stopping abilities of the ships. Appropriate evasive maneuvers require the ...

  11. 75 FR 8176 - Shipping Coordinating Committee; Notice of Committee Meeting

    Science.gov (United States)

    2010-02-23

    ... --Formal safety assessment --Noise from commercial shipping and its adverse impacts on marine life --Work... is to prepare for the sixtieth Session of the International Maritime Organization (IMO) Marine... ballast water --Recycling of ships --Prevention of air pollution from ships --Consideration and adoption...

  12. 10 CFR 71.127 - Handling, storage, and shipping control.

    Science.gov (United States)

    2010-01-01

    ... handling, storage, shipping, cleaning, and preservation of materials and equipment to be used in packaging... MATERIAL Quality Assurance § 71.127 Handling, storage, and shipping control. The licensee, certificate... 10 Energy 2 2010-01-01 2010-01-01 false Handling, storage, and shipping control. 71.127 Section 71...

  13. 48 CFR 47.305-16 - Shipping characteristics.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Shipping characteristics... CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 47.305-16 Shipping characteristics... shipments of agreed size. (b) Guaranteed shipping characteristics. (1) The contracting officer shall insert...

  14. Experimental Assessment of Underwater Radiated Sound of Different Ship Types

    NARCIS (Netherlands)

    Jansen, H.W.; Jong, C.A.F. de

    2015-01-01

    The aim of the SONIC project is to develop tools to investigate and mitigate the effects of underwater noise generated by shipping. One way to study the contribution of shipping noise to the background noise in the seas is to produce shipping noise maps. The SONIC project delivers the required

  15. 29 CFR 1915.165 - Ship's deck machinery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's deck machinery. 1915.165 Section 1915.165 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.165 Ship's deck machiner...

  16. 29 CFR 1915.164 - Ship's propulsion machinery.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's propulsion machinery. 1915.164 Section 1915.164 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR (CONTINUED) OCCUPATIONAL SAFETY AND HEALTH STANDARDS FOR SHIPYARD EMPLOYMENT Ship's Machinery and Piping Systems § 1915.164 Ship's...

  17. DOD Leases of Foreign-Built Ships: Background for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2007-01-01

    .... DOD argues that its ship leases are the most cost-effective way to meet its needs for the ships in question, and opposes the idea of reducing the leasing term from five years to two years for foreign-built ships...

  18. 29 CFR 1918.87 - Ship's cargo elevators.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 7 2010-07-01 2010-07-01 false Ship's cargo elevators. 1918.87 Section 1918.87 Labor... (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR LONGSHORING Handling Cargo § 1918.87 Ship's cargo elevators. (a) Safe working load. The safe working loads of ship's cargo elevators shall be determined and followed...

  19. 47 CFR 80.51 - Ship earth station licensing.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship earth station licensing. 80.51 Section 80.51 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES STATIONS IN THE MARITIME SERVICES Applications and Licenses § 80.51 Ship earth station licensing. A ship earth station must display the Commission...

  20. 47 CFR 80.1099 - Ship sources of energy.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Ship sources of energy. 80.1099 Section 80.1099... Stations § 80.1099 Ship sources of energy. (a) There must be available at all times, while the ship is at sea, a supply of electrical energy sufficient to operate the radio installations and to charge any...

  1. Model for Environmental Assessment of Container Ship Transport

    DEFF Research Database (Denmark)

    Kristensen, Hans Otto Holmegaard

    2012-01-01

    A generic computer model for systematic investigations of container ship designs is described in this paper. The primary statistical data on container ships used for the model development are also presented. The model can be used to calculate exhaust gas emissions from container ships, including...

  2. 47 CFR 80.81 - Antenna requirements for ship stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Antenna requirements for ship stations. 80.81 Section 80.81 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO... Stations § 80.81 Antenna requirements for ship stations. All telephony emissions of a ship station or a...

  3. 46 CFR 128.410 - Ship's service refrigeration systems.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Ship's service refrigeration systems. 128.410 Section 128.410 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS... service refrigeration systems. No self-contained unit either for air-conditioning or for refrigerated...

  4. Littoral Combat Ship: Is it a Blue-Green Asset?

    Science.gov (United States)

    2010-04-02

    4.5) CODAG: 2 gas turbines, 2 diesels; 4 steerable waterjets ; 1 steerable thruster 45 4,300 at 18 kt Raytheon RAM ·· e 5immti:0Mk2•220...the ship in dry-dock for extended periods of time, cutting holes in the side of the ship, or running lengths of cables and piping throughout the ship

  5. 44 CFR 402.5 - Forwarding commodities previously shipped.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Forwarding commodities... commodities previously shipped. Order T-1 applies to transportation on or discharge from ships documented... ship or aircraft, before the issuance of Order T-1, had transported restricted commodities manifested...

  6. Ship-Track Models Based on Poisson-Distributed Port-Departure Times

    National Research Council Canada - National Science Library

    Heitmeyer, Richard

    2006-01-01

    ... of those ships, and their nominal speeds. The probability law assumes that the ship departure times are Poisson-distributed with a time-varying departure rate and that the ship speeds and ship routes are statistically independent...

  7. Ship emissions and the use of current air cleaning technology: contributions to air pollution and acidification in the Baltic Sea

    Directory of Open Access Journals (Sweden)

    B. Claremar

    2017-10-01

    Full Text Available The shipping sector is a significant contributor to emissions of air pollutants in marine and coastal regions. In order to achieve sustainable shipping, primarily through new regulations and techniques, greater knowledge of dispersion and deposition of air pollutants is required. Regional model calculations of the dispersion and concentration of sulfur, nitrogen, and particulate matter, as well as deposition of oxidized sulfur and nitrogen from the international maritime sector in the Baltic Sea and the North Sea, have been made for the years 2011 to 2013. The contribution from shipping is highest along shipping lanes and near large ports for concentration and dry deposition. Sulfur is the most important pollutant coupled to shipping. The contribution of both SO2 concentration and dry deposition of sulfur represented up to 80 % of the total in some regions. WHO guidelines for annual concentrations were not trespassed for any analysed pollutant, other than PM2.5 in the Netherlands, Belgium, and central Poland. However, due to the resolution of the numerical model, 50 km  ×  50 km, there may be higher concentrations locally close to intense shipping lanes. Wet deposition is more spread and less sensitive to model resolution. The contribution of wet deposition of sulfur and nitrogen from shipping was up to 30 % of the total wet deposition. Comparison of simulated to measured concentration at two coastal stations close to shipping lanes showed some underestimations and missed maximums, probably due to resolution of the model and underestimated ship emissions. A change in regulation for maximum sulfur content in maritime fuel, in 2015 from 1 to 0.1 %, decreases the atmospheric sulfur concentration and deposition significantly. However, due to costs related to refining, the cleaning of exhausts through scrubbers has become a possible economic solution. Open-loop scrubbers meet the air quality criteria but their consequences for

  8. Lightning enhancement over major oceanic shipping lanes

    Science.gov (United States)

    Thornton, Joel A.; Virts, Katrina S.; Holzworth, Robert H.; Mitchell, Todd P.

    2017-09-01

    Using 12 years of high-resolution global lightning stroke data from the World Wide Lightning Location Network (WWLLN), we show that lightning density is enhanced by up to a factor of 2 directly over shipping lanes in the northeastern Indian Ocean and the South China Sea as compared to adjacent areas with similar climatological characteristics. The lightning enhancement is most prominent during the convectively active season, November-April for the Indian Ocean and April-December in the South China Sea, and has been detectable from at least 2005 to the present. We hypothesize that emissions of aerosol particles and precursors by maritime vessel traffic lead to a microphysical enhancement of convection and storm electrification in the region of the shipping lanes. These persistent localized anthropogenic perturbations to otherwise clean regions are a unique opportunity to more thoroughly understand the sensitivity of maritime deep convection and lightning to aerosol particles.

  9. Leadership Profiling of Ocean Going Ship Masters1

    Directory of Open Access Journals (Sweden)

    Ioannis Theotokas

    2014-12-01

    This paper focuses on the ocean going ship Masters and aims at identifying their leadership profiles and understanding their attitudes and reactions in given circumstances. It analyses and discusses the results of a field study of ship officers of different nationalities employed as Masters on board ships of a leading international maritime group. Results of the research reveal that the characteristics and the competencies of ship Masters as identified using the specially developed questionnaire, are compatible with those proposed by situational leadership theories. Ship Masters seem to give priority to the people on board and their needs and try to be supportive in their decisions.

  10. The Ship Movement Trajectory Prediction Algorithm Using Navigational Data Fusion.

    Science.gov (United States)

    Borkowski, Piotr

    2017-06-20

    It is essential for the marine navigator conducting maneuvers of his ship at sea to know future positions of himself and target ships in a specific time span to effectively solve collision situations. This article presents an algorithm of ship movement trajectory prediction, which, through data fusion, takes into account measurements of the ship's current position from a number of doubled autonomous devices. This increases the reliability and accuracy of prediction. The algorithm has been implemented in NAVDEC, a navigation decision support system and practically used on board ships.

  11. Bathyodontus mirus (Andrássy, 1956, first record of a representative of the suborder Bathyodontina (Nematoda, Mononchida in the Iberian fauna

    Directory of Open Access Journals (Sweden)

    Peña-Santiago, R.

    2010-12-01

    Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.

  12. Empty Container Management in Cyclic Shipping Routes

    OpenAIRE

    Dong-Ping Song; Jing-Xin Dong

    2008-01-01

    This paper considers the empty container management problem in a cyclic shipping route. The objective is to seek the optimal empty container repositioning policy in a dynamic and stochastic situation by minimising the expected total costs consisting of inventory holding costs, demand lost-sale costs, lifting-on and lifting-off charges, and container transportation costs. A three-phase threshold control policy is developed to reposition empty containers in cyclic routes. The threshold values a...

  13. Connecting Land-Based Networks to Ships

    Science.gov (United States)

    2013-06-01

    VSAT ) system. The stations, equipped with VSAT antennas, share the satellite’s transmission capacity to transmit to the station having the central hub...and base stations, which are connected to the ship’s VSAT system by which the voice and data connections from the phones are routed from the ship to...Maritime VSAT Communications Solutions, June 2010. [17] MCP Maritime Communications Partner, “Technology overview,” August 2012, http

  14. Trends in Integrated Ship Control Networking

    DEFF Research Database (Denmark)

    Jørgensen, N.; Nielsen, Jens Frederik Dalsgaard

    1997-01-01

    Integrated Ship Control systems can be designed as robust, distributed, autonomous control systems. The EU funded ATOMOS and ATOMOS II projects involves both technical and non technical aspects of this process. A reference modelling concept giving an outline of a generic ISC system covering...... the network and the equipment connected to it, a framework for verification of network functionality and performance by simulation and a general distribution platform for ISC systems, The ATOMOS Network, are results of this work....

  15. Speed Optimization in Liner Shipping Network Design

    DEFF Research Database (Denmark)

    Brouer, Berit Dangaard; Karsten, Christian Vad; Pisinger, David

    In the Liner Shipping Network Design Problem (LSNDP) services sail at a given speed throughout a round trip. In reality most services operate with a speed differentiated head- and back-haul, or even individual speeds on every sailing between two ports. The speed of a service is decisive for the b......In the Liner Shipping Network Design Problem (LSNDP) services sail at a given speed throughout a round trip. In reality most services operate with a speed differentiated head- and back-haul, or even individual speeds on every sailing between two ports. The speed of a service is decisive...... for the bunker consumption in the network as well as the transit time of cargo. Speed optimization has been considered for tramp shipping showing significant reductions in fuel consumption. However, variable speeds has not been considered for post optimization of the LSNDP, where speed optimization could result...... in changes to the cargo flow due to transit time restrictions as well as significant savings in fuel consumption and required vessel deployment due to a weekly frequency requirement. We present a heuristic method to calculate variable speed on a service and present computational results for improving...

  16. Ships in Russian Literature: Folklore Aesthetics

    Directory of Open Access Journals (Sweden)

    Marianna Dudareva

    2017-11-01

    Full Text Available The paper studies a genesis of the ship image in the Russian literature and folklore, an idea of “other kingdom” in the Russian literature poetics of the 19-20 centuries. An emphasis is put on the issues related to the metaphor of a ship, a boat in the artistic world of Lermontov, Turgenev, Dostoevsky and in the poetry of the early 20th century. A paradigm “the Moon – boat” is studied in detail. The image of a boat, which regularly appears in Russian literature, various word-painters’ art works, is associated with semantics of funeral ceremonial boat typical for different folk genres. Addressing to riddles about death, to Russian epic tradition, to plots dedicated to Razin demonstrates complexity and significance of the symbol of a boat/ferry/ship for the national culture. This symbol encapsulates the supreme idea of death as cosmic regeneration, character’s initiation, which appeared highly sought by Russian literature, both realistic prose and avantgarde and modernism poetry.

  17. Ship motion control system; Sentai shisei seigyo

    Energy Technology Data Exchange (ETDEWEB)

    Yamaga, H. [Mitsui Shipbuilding and Engineering Co. Ltd., Tokyo (Japan)

    1998-09-15

    Techno-super-liner is a large object combining with catamaran in application of an amphibious principle of a hover craft, called as the air pressure type complex support from (TSL-A form). In this paper, the driving device in the ship motion control system (RCS), equipped with `HISYO` developed as an experimental ship of TSL-A 70m type in the marine area, was mainly introduced. This RCS was a motion control system for a propose to reduce swing of a ship body when high speed navigation in the opening sea, this structural device consisted of the control calculation device, the swing detection device, the operation monitoring device, the underwater fin flip driving device, the lopper driving device, and the hydraulic power unit. As investigation results on the effectiveness of RCS in the HISYO through the marine experiments and general experiments, it was proved that the expected effect was obtained, high speed navigation was possible in a worse weather. 1 figs., 4 tabs.

  18. Adaptation to carbon dioxide tax in shipping

    International Nuclear Information System (INIS)

    Olsen, Kristian

    2000-01-01

    This note discusses the consequences for the sea transport sector between Norway and continental Europe of levying a carbon dioxide tax on international bunker. The influence of such a tax on the operational costs of various types of ship and various transport routes is calculated. The profit obtainable from the following ways of adapting to an increased tax level is assessed: (1) Reducing the speed, (2) Rebuilding the engine to decrease fuel consumption, (3) Changing the design speed for new ships. It is found that a carbon dioxide tax of NOK 200 per tonne of CO 2 will increase the transport costs by 3 - 15 percent. In the long run much of this may be transferred to the freight rates since so much of the sea transport are in segments in which the demand for the service is not sensitive to the prices. Even if the freight rates are not changed, a tax this size will not make it necessary to reduce the speed of the existing fleet. The income lost by taking fewer trips will exceed the costs saved in reducing the speed. However, the optimum design speed for new ships may be somewhat reduced (0.5 knots). Rebuilding engines to reduce the fuel consumption would pay off were it not for the fact that the remaining life of the present fleet is probably too short for this to be interesting

  19. Historic survey on nuclear merchant ships

    International Nuclear Information System (INIS)

    Freire, Luciano Ondir; Andrade, Delvonei Alves de

    2015-01-01

    Highlights: • The nuclear merchants ships already built are described and studied. • Their history and main architectural choices are presented, focusing nuclear domain. • The typical problems in those projects are discussed. • Some key factors for developing successful nuclear merchant ships are identified. - Abstract: This work provides a survey on past nuclear merchant ships experience. On light of new regulations on CO 2 , SO x and NO x , the options for clean naval propulsion need to be studied. Despite many efforts, the only already sea proven emissions-free energy is nuclear power of pressurized water reactor type. Given the past experience on the field, this work provides some information on history, architectures and hints of reasons for the success or failures of each project. It is found that adequate requirements identification must be done keeping economics always in the center of design. Experience shows, except after major catastrophic accidents, public trust may be earned by open dialog and sound engineering practices.

  20. SYNCHRONIZATION OF NATIONAL GRID NETWORK WITH THE ELECTRICITY SHIPS NETWORK IN THE "SHORE TO SHIP" SYSTEM

    Directory of Open Access Journals (Sweden)

    Dariusz TARNAPOWICZ

    2013-07-01

    Full Text Available ‘Shore to ship’ system – ships’ power supply from the local electrical substations – is one of the effective ways to limit the negative impact of the ships lying in ports on the environment. Energy infrastructure of the port installation necessary to provide ships with power supply has to be designed so that different types of ships can use it. The important issue concerning ‘shore to ship’ system is the quality of power supply. This can be achieved via sustaining continuity of power supply while switching from the ships’ electrical network over to the national grid. In this article the author presents the way of synchronizing the national grid with the ships’ electrical network during ship’s lying in port. Such synchronization would allow for uninterruptible work of the ship’s electrical devices.

  1. Joint SKI and SSI review of SKB preliminary safety assessment of repository for long-lived low- and intermediate-level waste. Review report

    International Nuclear Information System (INIS)

    2001-03-01

    SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have

  2. An Adaptive Ship Detection Scheme for Spaceborne SAR Imagery

    Directory of Open Access Journals (Sweden)

    Xiangguang Leng

    2016-08-01

    Full Text Available With the rapid development of spaceborne synthetic aperture radar (SAR and the increasing need of ship detection, research on adaptive ship detection in spaceborne SAR imagery is of great importance. Focusing on practical problems of ship detection, this paper presents a highly adaptive ship detection scheme for spaceborne SAR imagery. It is able to process a wide range of sensors, imaging modes and resolutions. Two main stages are identified in this paper, namely: ship candidate detection and ship discrimination. Firstly, this paper proposes an adaptive land masking method using ship size and pixel size. Secondly, taking into account the imaging mode, incidence angle, and polarization channel of SAR imagery, it implements adaptive ship candidate detection in spaceborne SAR imagery by applying different strategies to different resolution SAR images. Finally, aiming at different types of typical false alarms, this paper proposes a comprehensive ship discrimination method in spaceborne SAR imagery based on confidence level and complexity analysis. Experimental results based on RADARSAT-1, RADARSAT-2, TerraSAR-X, RS-1, and RS-3 images demonstrate that the adaptive scheme proposed in this paper is able to detect ship targets in a fast, efficient and robust way.

  3. Evidence for ship noise impacts on humpback whale foraging behaviour.

    Science.gov (United States)

    Blair, Hannah B; Merchant, Nathan D; Friedlaender, Ari S; Wiley, David N; Parks, Susan E

    2016-08-01

    Noise from shipping activity in North Atlantic coastal waters has been steadily increasing and is an area of growing conservation concern, as it has the potential to disrupt the behaviour of marine organisms. This study examines the impacts of ship noise on bottom foraging humpback whales (Megaptera novaeangliae) in the western North Atlantic. Data were collected from 10 foraging whales using non-invasive archival tags that simultaneously recorded underwater movements and the acoustic environment at the whale. Using mixed models, we assess the effects of ship noise on seven parameters of their feeding behaviours. Independent variables included the presence or absence of ship noise and the received level of ship noise at the whale. We found significant effects on foraging, including slower descent rates and fewer side-roll feeding events per dive with increasing ship noise. During 5 of 18 ship passages, dives without side-rolls were observed. These findings indicate that humpback whales on Stellwagen Bank, an area with chronically elevated levels of shipping traffic, significantly change foraging activity when exposed to high levels of ship noise. This measureable reduction in within-dive foraging effort of individual whales could potentially lead to population-level impacts of shipping noise on baleen whale foraging success. © 2016 The Author(s).

  4. Annual Check-up

    Science.gov (United States)

    ... Medical Conditions Nutrition & Fitness Emotional Health Annual Check-Up Posted under Health Guides . Updated 24 April 2017. + ... I get ready for my annual medical check-up? If this is your first visit to your ...

  5. OPTIMIZATION PROCEDURE FOR PRELIMINARY DESIGN STAGE OF CAIRO-DAMIETTA SELF-PROPELLED GRAIN BULK SHIPS

    Directory of Open Access Journals (Sweden)

    M.M. Moustafa

    2016-01-01

    Full Text Available The global logistics center for the storage and handling of grain which will be constructed at Damietta port will extremely increase the annual movement of grain through Cairo-Damietta waterway. Therefore, the demand for inland grain bulk ships has increased significantly in the recent years. This paper introduces a procedure to find out the fleet size and optimum characteristics of self-propelled grain bulk ships working between Cairo and Damietta through River Nile. The characteristics of the Cairo–Damietta waterway are investigated to define the constraints on dimensions and speed for such ship type. Also, mathematical model for the objective function was developed considering: powering, voyage, weight, stability and cost calculation. In this research, Specific cost (Sc, cost of transporting one ton of cargo a distance of one kilometre, is considered as the objective function for this optimization process. This optimization problem is handled as a single objective nonlinear constrained optimization problem using a specially developed computer program. Solutions are generated by varying design variables systematically in certain steps. The best of these solutions is then taken as the estimated optimum. Finally, the problem is presented, the main constrains analyzed and the optimum solution shown.

  6. Reconfigurable Control of a Ship Propulsion Plant

    DEFF Research Database (Denmark)

    Blanke, M.; Izadi-Zamanabadi, Roozbeh

    1998-01-01

    Fault-tolerant control combines fault detection and isolation techniques with supervisory control, to achieve the autonomous accommodation of faults before they develop into failures. While fault detection and isolation (FDI) methods have matured during the past decade, the extension to fault......-tolerant control is a fairly new area. Thise paper presents a ship propulsion system as a benchmark that should be useful as a platform for the development of new ideas and a comparison of methods. The benchmark has two main elements. One is the development of efficient FDI algorithms, and the other...... is the analysis and implementation of autonomous fault accommodation. A benchmark kit can be obtained from the authors....

  7. Containership Traffic Optimization on Feeder Shipping Line

    Directory of Open Access Journals (Sweden)

    Drozhzhyn Oleksii

    2016-12-01

    Full Text Available This article is devoted to feeder containership traffic optimization on the trunk and feeder shipping lines. The optimization is fulfilled in case of the necessity of laden containers delivery between fixed pairs of ports as well as in case of the requirement not to exceed the vessel's capacity, taking into account her residual value during transition between feeder port lines. The paper takes into account uneven distribution of empty container equipment in ports of line and the solution is suggested considering the estimation of the empty TEU’s number which is subject to reposition.

  8. Ultimate Strength of Ship Hulls under Torsion

    DEFF Research Database (Denmark)

    Paik, Jeom Kee; Thayamballi, Anil K.; Pedersen, Preben Terndrup

    2001-01-01

    subjected to torsion. A procedure for calculating these stresses is briefly described. As an illustrative example, the distribution and magnitude of warping and shear stresses for a typical container vessel hull cross section under unit torsion is calculated by the procedure. By theoretical and numerical...... analyses, it is shown that the influence of torsion induced warping stresses on the ultimate hull girder bending strength is small for ductile hull materials while torsion induced shear stresses will of course reduce the ship hull ultimate bending moment....

  9. Ship Grounding on Rock - I. Theory

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup

    1997-01-01

    This paper presents a set of analytical expressions which can be used to calculate the reaction force on a ship bottom deformed by a conical rock with a rounded tip. Closed form solutions are given for the resistance of inner and outer bottom plating, longitudinal stiffeners, girders and bulkhead...... the damage of four large scale tests and an accidental grounding with errors less than 10%. Moreover, it is illustrated by an example that the model evaluation of a grounding scenario is sufficientlty fast to be used in a probabilistic framework in a Formal safety Assessment....

  10. The Retrograde of Shipping Containers from Afghanistan

    Science.gov (United States)

    2013-04-01

    War, (New York, New York: The Random House Publishing Group, 1993), Page 78. 2 MAJ Tony Velazquez , 1st TSC, SPO Mobility and Mark LaRue, Global...mail to author, March 23, 2013 25 Ibid. 26 Ibid. 27 MAJ Tony Velazquez , 1st TSC, SPO Mobility and Mark LaRue, Global Container Manager, Surface...Late Fees for Military Shipping Containers Soar”, USA Today, October 4, 2012 33 MAJ Tony Velazquez , 1st TSC, SPO Mobility and Mark LaRue, Global

  11. Fast Evaluation of Ship Responses in Waves

    DEFF Research Database (Denmark)

    Jensen, Jørgen Juncher

    2004-01-01

    The aim of the present paper is to provide a rational and efficient procedure able to predict the design wave-induced motions, accelerations and loads with sufficient engineering accuracy in the conceptual design phase and in risk assessment. The procedure relies only on the following main parame...... parameters of the ship: Length, breadth, draught, block coefficient and water plane area together with the operational profile. The formulas are semi-analytical and the calculations can be easily done using a standard spreadsheet program....

  12. Absorbed Energy in Ship Collisions and Grounding

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Zhang, Shengming

    1998-01-01

    Minorsky's well-known empirical formula, which relates the absorbed energy to the destroyed material volume, has been widely used in analyses of high energy collision and grounding accidents for nearly 40 years. The advantage of the method is its apparent simplcity. Obviously, its drawback...... collisions and grounding. The developed expressions reflect the structural arrangement, the material properties and different damage patterns.The present method is validated against a large number of existing experimental results and detailed numerical simulation results. Applications to full-sale ship...

  13. SSI's independent consequence calculations in support of the regulatory review of the SR-Can safety assessment

    Energy Technology Data Exchange (ETDEWEB)

    Shulan Xu; Dverstorp, Bjoern (Swedish Radiation Protection Authority, Stockholm (Sweden)); Woerman, Anders; Marklund, Lars (Royal Institute of Technology (KTH), Stockholm (SE)); Klos, Richard (Aleksandria Sciences, Sheffield (GB)); Shaw, George (Univ. of Nottingham (GB))

    2008-03-15

    With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB

  14. Annual report, 1981-82

    International Nuclear Information System (INIS)

    1982-01-01

    Recent operational restructuring implemented grouped the Engineering, Chemical, and International Companies under CANDU Operations. The Research Company was charged with finding products and markets to bridge the gap in new orders for reactors apparent for the next few years. Net income rose 46 percent to $19.7 million. Economic slowdown in Canada and elsewhere had little effect as AECL continued to fufill obligations on previously negotiated multi-year contracts. Over 60 percent of commercial revenue came from outside Canada, and at $234 million was marginally higher than 1980-81. Development of the superconducting cyclotron continued at Chalk River, with successful testing of magnetic field and radiofrequency systems. The nuclear fuel waste management program continued, with selection of a site for an underground research laboratory near Pinawa, Manitoba. The Therac-25 high energy accelerator for cancer therapy neared completion of its development and manufacturing program. There are more than 10 orders already booked. A record 15.2 million curies of cobalt 60 were shipped, an increase of 25 percent in orders for gamma irradiation processing. The prototype Douglas Point generating station was returned to full power and reached its highest annual capacity factor since 1975. Conceptual design of the new standardized two 950MW-unit CANDU PHWR generating station was completed. AECL responded to a request for quotations from the Mexican government for its nuclear power program

  15. Structural analysis of a ship on global aspect using ANSYS

    Science.gov (United States)

    Rahman, M. Muzibur; Kamol, Rajia Sultana; Islam, Reyana

    2017-12-01

    Ship is a complex geometry which undergoes a combination of loadings such as hydrostatic, hydrodynamic, wind, wave etc. at sea and thus adequate strength in a ship has always been one of the most challenging tasks for the ship designers. International Maritime Organization (IMO) and classification societies are providing the standards to ensure the adequacy of strength for the ship against all demands throughout its service life. Thus, structural analysis is needed to assess the overall strength of hull, and the means in this regard are based on finite element method which may be applied either local or global aspect of the ship. This paper is an attempt to carry out the structural analysis of a ship in global aspect using ANSYS software to locate the most stress concentration and deformed area, which will have ultimate effect on fatigue fracture.

  16. Reliability of Hull Girder Ultimate Strength of Steel Ships

    Science.gov (United States)

    Da-wei, Gao; Gui-jie, Shi

    2018-03-01

    Hull girder ultimate strength is an evaluation index reflecting the true safety margin or structural redundancy about container ships. Especially, after the hull girder fracture accident of the MOL COMFORT, the 8,000TEU class large container ship, on June 17 2013, larger container ship safety has been paid on much more attention. In this paper, different methods of calculating hull girder ultimate strength are firstly discussed and compared with. The bending ultimate strength can be analyzed by nonlinear finite element method (NFEM) and increment-iterative method, and also the shear ultimate strength can be analyzed by NFEM and simple equations. Then, the probability distribution of hull girder wave loads and still water loads of container ship are summarized. At last, the reliability of hull girder ultimate strength under bending moment and shear forces for three container ships is analyzed by using a first order method. The conclusions can be applied to give guidance for ship design and safety evaluation.

  17. A Way Forward for Ship Classification and Technical Services

    Directory of Open Access Journals (Sweden)

    Lam-Bee Goh

    2014-04-01

    Full Text Available Classification societies are one of key organizations that promote the highest standards in ship safety and quality shipping. The paper reviews the ship classification industry and identifies what the classification societies can do to add value to the maritime industry more effectively. To meet this objective, an analysis of the five competitive forces is carried out, together with an opinion survey performed on some of the leading shipping companies, to assess and to establish some of the key factors which should be considered when formulating an overall business strategy for the growth of the classification services business. The findings from the study are discussed with the strategic options and choices. A classification services industrial value chain analysis together with ship management and operation is undertaken to explore the opportunities for classification societies. These findings also provide guidance to policy-makers who design and seek to implement more effective international shipping policies.

  18. A quantitative assessment of Arctic shipping in 2010–2014

    KAUST Repository

    Eguíluz, Victor M.

    2016-08-01

    Rapid loss of sea ice is opening up the Arctic Ocean to shipping, a practice that is forecasted to increase rapidly by 2050 when many models predict that the Arctic Ocean will largely be free of ice toward the end of summer. These forecasts carry considerable uncertainty because Arctic shipping was previously considered too sparse to allow for adequate validation. Here, we provide quantitative evidence that the extent of Arctic shipping in the period 2011–2014 is already significant and that it is concentrated (i) in the Norwegian and Barents Seas, and (ii) predominantly accessed via the Northeast and Northwest Passages. Thick ice along the forecasted direct trans-Arctic route was still present in 2014, preventing transit. Although Arctic shipping remains constrained by the extent of ice coverage, during every September, this coverage is at a minimum, allowing the highest levels of shipping activity. Access to Arctic resources, particularly fisheries, is the most important driver of Arctic shipping thus far.

  19. Crushing of ship bows in head-on collision

    DEFF Research Database (Denmark)

    Ocakli, H.; Zhang, S.; Pedersen, Preben Terndrup

    2004-01-01

    . The approach developed can be used easily to determine the crushing resistance and damage extent of the ship bow when ship length and collision speed are known. The method can be used in probabilistic analysis of damage extents in ship collisions where a large number of calculations are generally required.......Semi-analytical methods for analysis of plate crushing and ship bow damage in head-on collisions are developed in this paper. Existing experimental and theoretical studies for crushing analysis of plated structures are summarized and compared. Simple formulae for determining the crushing force......, force-deformation curve and damge extent of a ship bow, expressed in terms of ship principal particulars, are derived for longitudinally stiffened oil tankers and bulk carriers with length of 150 meters and above. The methods are compared with published results and good agreement is achieved...

  20. Update on emissions and environmental impacts from the international fleet of ships: the contribution from major ship types and ports

    Directory of Open Access Journals (Sweden)

    S. B. Dalsøren

    2009-03-01

    Full Text Available A reliable and up-to-date ship emission inventory is essential for atmospheric scientists quantifying the impact of shipping and for policy makers implementing regulations and incentives for emission reduction. The emission modelling in this study takes into account ship type and size dependent input data for 15 ship types and 7 size categories. Global port arrival and departure data for more than 32 000 merchant ships are used to establish operational profiles for the ship segments. The modelled total fuel consumption amounts to 217 Mt in 2004 of which 11 Mt is consumed in in-port operations. This is in agreement with international sales statistics. The modelled fuel consumption is applied to develop global emission inventories for CO2, NO2, SO2, CO, CH4, VOC (Volatile Organic Compounds, N2O, BC (Black Carbon and OC (Organic Carbon. The global emissions from ships at sea and in ports are distributed geographically, applying extended geographical data sets covering about 2 million global ship observations and global port data for 32 000 ships. In addition to inventories for the world fleet, inventories are produced separately for the three dominating ship types, using ship type specific emission modelling and traffic distributions.

    A global Chemical Transport Model (CTM was used to calculate the environmental impacts of the emissions. We find that ship emissions is a dominant contributor over much of the world oceans to surface concentrations of NO2 and SO2. The contribution is also large over some coastal zones. For surface ozone the contribution is high over the oceans but clearly also of importance over Western North America (contribution 15–25% and Western Europe (5–15%. The contribution to tropospheric column ozone is up to 5–6%. The overall impact of ship emissions on global methane lifetime is large due to the high NOx emissions. With

  1. Building consensus: development of a Best Practice Guideline (BPG) for surgical site infection (SSI) prevention in high-risk pediatric spine surgery.

    Science.gov (United States)

    Vitale, Michael G; Riedel, Matthew D; Glotzbecker, Michael P; Matsumoto, Hiroko; Roye, David P; Akbarnia, Behrooz A; Anderson, Richard C E; Brockmeyer, Douglas L; Emans, John B; Erickson, Mark; Flynn, John M; Lenke, Lawrence G; Lewis, Stephen J; Luhmann, Scott J; McLeod, Lisa M; Newton, Peter O; Nyquist, Ann-Christine; Richards, B Stephens; Shah, Suken A; Skaggs, David L; Smith, John T; Sponseller, Paul D; Sucato, Daniel J; Zeller, Reinhard D; Saiman, Lisa

    2013-01-01

    Perioperative surgical site infection (SSI) after pediatric spine fusion is a recognized complication with rates between 0.5% and 1.6% in adolescent idiopathic scoliosis and up to 22% in "high risk" patients. Significant variation in the approach to infection prophylaxis has been well documented. The purpose of this initiative is to develop a consensus-based "Best Practice" Guideline (BPG), informed by both the available evidence in the literature and expert opinion, for high-risk pediatric patients undergoing spine fusion. For the purpose of this effort, high risk was defined as anything other than a primary fusion in a patient with idiopathic scoliosis without significant comorbidities. The ultimate goal of this initiative is to decrease the wide variability in SSI prevention strategies in this area, ultimately leading to improved patient outcomes and reduced health care costs. An expert panel composed of 20 pediatric spine surgeons and 3 infectious disease specialists from North America, selected for their extensive experience in the field of pediatric spine surgery, was developed. Using the Delphi process and iterative rounds using a nominal group technique, participants in this panel were as follows: (1) surveyed for current practices; (2) presented with a detailed systematic review of the relevant literature; (3) given the opportunity to voice opinion collectively; and (4) asked to vote regarding preferences privately. Round 1 was conducted using an electronic survey. Initial results were compiled and discussed face-to-face. Round 2 was conducted using the Audience Response System, allowing participants to vote for (strongly support or support) or against inclusion of each intervention. Agreement >80% was considered consensus. Interventions without consensus were discussed and revised, if feasible. Repeat voting for consensus was performed. Consensus was reached to support 14 SSI prevention strategies and all participants agreed to implement the BPG in their

  2. The berthing ship problem : Forces on berthing structures from moving ships

    NARCIS (Netherlands)

    Fontijn, H.L.

    1978-01-01

    In this report a mathematical model is formulated which is sufficiently accurate to describe quantitatively and qualitatively the behaviour of a ship berthing to a structure equipped with fenders as well as to determine the response of the fenders themselves. In order to achieve this a set of

  3. Ship berthing to a vertical quay-wall : Fender forces and ship motion

    NARCIS (Netherlands)

    Fontijn, H.L.

    1983-01-01

    In this report a mathematical model is formulated which is sufficiently accurate to describe the typical behaviour of a ship berthing to a vertical quay-wall fitted with fenders as well as to determine the response of the fenders themselves. In order to achieve this a three-dimensional set of

  4. Emission of toxic organic microcontaminants from ship's engines: first measurements on three cruising ships

    NARCIS (Netherlands)

    Compaan, H.; Rhemrev, M.M.; Houtzager, M.M.G.

    1992-01-01

    This work was undertaken within the framework of Lloyd's Register's Marine Exhaust Emissions Research Programme. Phase II of this research programme [] evaluated exhaust emissions from ships in service under steady state and transient modes of operation and incorporated measurements of CO, CO2, 02,

  5. EX1201: Ship Shakedown and Patch Tests on NOAA Ship Okeanos Explorer between 20100214 and 20120223

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — EX1201 is the 2012 shakedown mission of NOAA ship Okeanos Explorer (EX) and will perform system patch tests of the vessel’s Kongsberg EM302 multibeam sonar....

  6. A method for remote sensing of acoustic ship noise

    OpenAIRE

    Coward, Stian

    2013-01-01

    Ship noise in the ocean due to commercial shipping has gained increased interest in recent years because of its potential impact on marine life and the ocean environment. Hence, rapid methods to estimate the source level of commercial ships has obtained considerable research interest. Although a number of measurement standards exist that describe measurement procedures for dedicated measurement ranges or well-controlled measurement conditions, there is an interest in methods adapted/develop...

  7. Ship Operation Research and Development, A Program for Industry.

    Science.gov (United States)

    1983-01-01

    operating technologically advanced ships manned by nontraditionally organized crews--the Baff Project in Sweden, the Netherlands’ Ship 󈨔 Project, Japan’s...example: o Manning the technically advanced ships of the future (the BAFF project conducted and financed by the Swedish Shipowners’ Association) o The... BAFF Development Project: Manning of Technically Advanced Snips of the Future. Swedish Shipowners’ Association, 1972. Bolton, F., A Statement of

  8. Effect of Fracture on Crushing of Ship Structures

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup; Abramowicz, W.

    2003-01-01

    This paper is concerned with loads and energy absorption during crushing of ship structures. Particular focus is on the effect of fracture of welds or parent material on the energy absorption of typical structural subassemblies of ships during deep collapse. The paper presents experiments...... absorption in axial crushing of typical ship structural components. This effect of fracture has been neglected in previously published studies of bow crushing mechanics....

  9. Characterization of ships as sources of underwater noise

    OpenAIRE

    Jong, C.A.F. de

    2009-01-01

    There is a growing interest in the possible impact of anthropogenic underwater noise on marine life [1]. One of the concerns is the increasing contribution of shipping noise, with the growing number and size of commercial ships. Traditionally, underwater radiated noise control was only of interest for naval [2,3] and fishery research vessels [4]. Due to the potential environmental impact, it becomes also relevant for commercial shipping. The challenge is to bring the expertise from the naval ...

  10. REVIEW OF AGING DATA ON EPDM O-RINGS IN THE H1616 SHIPPING PACKAGE

    Energy Technology Data Exchange (ETDEWEB)

    Skidmore, E.

    2012-03-27

    Currently, all H1616 shipping package containers undergo annual re-verification testing, including containment vessel leak testing to verify leak-tightness (<1 x 10{sup -7} ref cc/sec air) as per ANSI N14.5. The purpose of this literature review is to supplement aging studies currently being performed by SRNL on the EPDM O-rings to provide the technical basis for extending annual re-verification testing for the H1616 shipping package and to predict the life of the seals at bounding service conditions. The available data suggest that the EPDM O-rings can retain significant mechanical properties and sealing force at or below bounding service temperatures (169 F or 76 C) beyond the 1 year maintenance period. Interpretation of available data suggests that a service life of at least 2 years and potentially 4-6 years may be possible at bounding temperatures. Seal lifetimes at lower, more realistic temperatures will likely be longer. Being a hydrocarbon elastomer, EPDM O-rings may exhibit an inhibition period due to the presence of antioxidants. Once antioxidants are consumed, mechanical properties and seal performance could decline at a faster rate. Testing is being performed to validate the assumptions outlined in this report and to assess the long-term performance of O-ring seals under actual service conditions.

  11. Review of SKB's Safety Assessment SR-Can: Contributions in Support of SKI's and SSI's Review by External Consultants

    Energy Technology Data Exchange (ETDEWEB)

    2008-03-15

    The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish

  12. Urbanistid ja keskkonnaeksperdid: iga muudatuse eest Reidi tee projektis oleme pidanud võitlema / Helen Sooväli-Sepping, Kristi Grišakov, Mari Jüssi ; intervjueerinud Mari Peegel ; kommenteerinud Taavi Aas

    Index Scriptorium Estoniae

    Sooväli-Sepping, Helen, 1974-

    2016-01-01

    TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik

  13. Adaptive ship autopilot with wave filter

    Directory of Open Access Journals (Sweden)

    Steinar Sælid

    1983-01-01

    Full Text Available This paper is concerned with analysis and design of an adaptive autopilot for ships. The design is based on a low and high frequency model of the vessel motion adequate to ship steering. The low frequency model describes the vessel response to rudder control and slowly varying environmental forces. The high frequency model represents the wave induced oscillatory part of the yaw motion. The models are used in a Kalman filter and the rudder control is computed from linear quadratic theory based on the low frequency part of the vector. This yields a very effective filtering of the wave component of the yaw motion. Proper operation of this filter/controller structure requires knowledge of the vessel model parameters and the dominating wave frequency. The vessel parameters are estimated on line by a recursive prediction error method. In order to reduce the computing requirements, the state estimator is operated using scheduled gains. This results in an easy and robust design. The convergence properties are investigated by using the method of Ljung. The performance is confirmed by simulation experiments.

  14. LNG systems for natural gas propelled ships

    Science.gov (United States)

    Chorowski, M.; Duda, P.; Polinski, J.; Skrzypacz, J.

    2015-12-01

    In order to reduce the atmospheric pollution generated by ships, the International Marine Organization has established Emission Controlled Areas. In these areas, nitrogen oxides, sulphur oxides and particulates emission is strongly controlled. From the beginning of 2015, the ECA covers waters 200 nautical miles from the coast of the US and Canada, the US Caribbean Sea area, the Baltic Sea, the North Sea and the English Channel. From the beginning of 2020, strong emission restrictions will also be in force outside the ECA. This requires newly constructed ships to be either equipped with exhaust gas cleaning devices or propelled with emission free fuels. In comparison to low sulphur Marine Diesel and Marine Gas Oil, LNG is a competitive fuel, both from a technical and economical point of view. LNG can be stored in vacuum insulated tanks fulfilling the difficult requirements of marine regulations. LNG must be vaporized and pressurized to the pressure which is compatible with the engine requirements (usually a few bar). The boil-off must be controlled to avoid the occasional gas release to the atmosphere. This paper presents an LNG system designed and commissioned for a Baltic Sea ferry. The specific technical features and exploitation parameters of the system will be presented. The impact of strict marine regulations on the system's thermo-mechanical construction and its performance will be discussed. The review of possible flow-schemes of LNG marine systems will be presented with respect to the system's cost, maintenance, and reliability.

  15. 3D RECORDING OF A 19-CENTURY OB RIVER SHIP

    Directory of Open Access Journals (Sweden)

    A. A. Pushkarev

    2016-06-01

    Full Text Available A 3D recording of a 19-century wooden ship discovered on the bank of the river Ob (Western Siberia was performed in autumn 2015. The archaeologized ship was partly under water, partly lying ashore, buried under fluvial deposits. The 3D recording was performed in October, when the water level was at its lowest after clearing the area around the ship. A 3D recording at the place of discovery was required as part of the ship museumification and reconstruction project. The works performed were primarily aimed at preserving as much information about the object as possible. Given the location and peculiar features of the object, a combination of close-range photogrammetry and aerial photography was considered to be the best possible solution for creating a high-quality 3D model. The dismantled ship was delivered to Nizhnevartovsk Museum of Local History in October 2015. The ship is going to be reassembled using the created 3D model to be exhibited in the museum. The resulting models are also going to be used to make a virtual 3D reconstruction of the ship in the future. We shot a stereoscopic video for Nizhnevartovsk Museum of Local History to let visitors see the place of discovery and explore the ship in greater details. Besides, 3D printing allowed for creating a miniature of the ship, which is also going to be included in the exposition devoted to this unique discovery.

  16. Drills and Training on board Ship in Maritime Transport

    Directory of Open Access Journals (Sweden)

    Cristina Dragomir

    2016-01-01

    Full Text Available In maritime transport, drills are methods of practicing how a team or individuals should behavein case of an emergency on board ship (fire, explosion, pirates’ attacks, ship sinking, shipgrounding, capsizing etc.. Most commonly acknowledged in the shipping domain, drills aresynonyms to training exercises. Drills are extremely important for the safety of ship, crew andpassengers and are mandatory to be performed in any sea voyage. In this paper is made anoverview on regulatory framework and strategic role of efficient maritime drills and training.

  17. Crushing of ship bows in head-on collision

    DEFF Research Database (Denmark)

    Ocakli, H.; Zhang, S.; Pedersen, Preben Terndrup

    2004-01-01

    Semi-analytical methods for analysis of plate crushing and ship bow damage in head-on collisions are developed in this paper. Existing experimental and theoretical studies for crushing analysis of plated structures are summarized and compared. Simple formulae for determining the crushing force....... The approach developed can be used easily to determine the crushing resistance and damage extent of the ship bow when ship length and collision speed are known. The method can be used in probabilistic analysis of damage extents in ship collisions where a large number of calculations are generally required....

  18. The Ship Movement Trajectory Prediction Algorithm Using Navigational Data Fusion

    Directory of Open Access Journals (Sweden)

    Piotr Borkowski

    2017-06-01

    Full Text Available It is essential for the marine navigator conducting maneuvers of his ship at sea to know future positions of himself and target ships in a specific time span to effectively solve collision situations. This article presents an algorithm of ship movement trajectory prediction, which, through data fusion, takes into account measurements of the ship’s current position from a number of doubled autonomous devices. This increases the reliability and accuracy of prediction. The algorithm has been implemented in NAVDEC, a navigation decision support system and practically used on board ships.

  19. [Medicine aboard cruise ships--law insurance specifics].

    Science.gov (United States)

    Ottomann, C; Frenzel, R; Muehlberger, T

    2013-04-01

    The booming cruise industry, associated with ships with more passengers and crew on board, results in growing medical needs for the ship doctor. The ship's doctor insurance policy includes different jurisdictions, namely national law, international law, tort law, insurance law and labor law. In addition, international agreements must be taken into account, which complicates the design of an adequate insurance policy. Equally high are the costs and defense costs for the ship's doctor in case of liability. In order to limit the liability for all parties is to ask for appropriately qualified medical staff, hired on board. © Georg Thieme Verlag KG Stuttgart · New York.

  20. Solving the Liner Shipping Fleet Repositioning Problem with Cargo Flows

    DEFF Research Database (Denmark)

    Tierney, Kevin; Askelsdottir, Björg; Jensen, Rune Møller

    2015-01-01

    We solve a central problem in the liner shipping industry called the liner shipping fleet repositioning problem (LSFRP). The LSFRP poses a large financial burden on liner shipping firms. During repositioning, vessels are moved between routes in a liner shipping network. Liner carriers wish...... introduce a novel mathematical model and a simulated annealing algorithm for the LSFRP with cargo flows that makes use of a carefully constructed graph; we evaluate these approaches using real-world data from our industrial collaborator. Additionally, we compare the performance of our approach against...... to solve the LSFRP....

  1. Radar imagery from the 1994 Lock Linnhe ship wake experiment

    Energy Technology Data Exchange (ETDEWEB)

    Mullenhoff, C.J.; Lehman, S.K.; Jones, H. [Lawrence Livermore National Lab., CA (United States)] [and others

    1994-11-15

    The 1994 Loch Linnhe radar ocean imaging trials were held from September 4 through September 17. Two ships were used: the R.V. Colonel Templer, and the RMAS Collie. Thorn EMI, Inc., fielded a dual band, dual polarization radar on a hillside overlooking the loch. A primary purpose of the experiment was to obtain highly visible images of ship generated internal waves. Presented here is imagery for a few of the good ship runs, as well as a study of the environment of the visibility of ship generated internal waves.

  2. International R&D Rivalry with a Shipping Firm

    OpenAIRE

    Takauchi, Kazuhiro

    2012-01-01

    To examine the role of shipping firms in the international research and development (R&D) rivalry, we build a two-country (exporting and importing), two-firm (exporting and local) duopoly model with a shipping firm. The exporting firm competes with the local firm in the duopoly market of the local country but must pay a shipping fee to the shipping firm in order to sell its product in the local market. Similar to market competition, exporting and local firms engage in R&D competition. We comp...

  3. A Study on Green Shipping in Major Countries: In the View of Shipyards, Shipping Companies, Ports, and Policies

    Directory of Open Access Journals (Sweden)

    Taehee Lee

    2017-12-01

    Full Text Available The purpose of this study is to define green shipping and eco-friendly vessels and identify the regulations and current market situation regarding eco-friendly vessels in major countries such as Europe, United States, Japan, China and South Korea within the framework of shipping companies, shipyards, ports, and policies. This conceptual study defines and analyzes the current market situation of green shipping based on the previous literatures as well as the cases of each stakeholder in major countries. As the results, this study identifies six major problems and proposes countermeasures to enhance strategic plans in preparation for green shipping in South Korea. The countermeasures are 1 the establishment of a shipping–shipbuilding collaborative network, 2 information sharing and joint cost reduction for shipping and shipbuilding industry, 3 investment in R&D in eco-friendly vessels by shipbuilding industry, 4 expanded support for LNG fueled ship.

  4. Community on a cruise ship: The contribution of an ethnographic research in studying the cruise ship industry

    Directory of Open Access Journals (Sweden)

    Končar Lara

    2017-01-01

    Full Text Available Originating from a very small part of the industry of ocean passenger transport, the cruise ship phenomenon grew into a global international business for organizing vacation and travel, becoming by the mid-20th century the fastest-growing branch of tourism industry. Seen as both a process and a project of globalization, and a manifestation of the fluidity of modern society, a series of scientific research questions were raised regarding the nature of globalization and consumerism. As opposed to the wider social, economic and cultural processes, the experiences of cruise ship workers offer a completely different perspective to this phenomenon. As the “fluid” nature of the industry and the ships themselves blurs the borders between places and space, within which communities of cruise ship workers are appearing, in this text I will try to point out the existence of a “social order” on the ships which is simultaneously defined by wider globalization processes and established regulations of cruise ship companies. With the ethnographic approach to researching the cruise ship industry, this text aims to offer a view from “within”: from the perspective of those who live and work on cruise ships, thus pointing out the existence and the particularities of “displaced enclaves” being formed on the ships, as well as the important connection between work, everyday life and travel.

  5. Diatom community structure on in-service cruise ship hulls.

    Science.gov (United States)

    Hunsucker, Kelli Zargiel; Koka, Abhishek; Lund, Geir; Swain, Geoffrey

    2014-10-01

    Diatoms are an important component of marine biofilms found on ship hulls. However, there are only a few published studies that describe the presence and abundance of diatoms on ships, and none that relate to modern ship hull coatings. This study investigated the diatom community structure on two in-service cruise ships with the same cruise cycles, one coated with an antifouling (AF) system (copper self-polishing copolymer) and the other coated with a silicone fouling-release (FR) system. Biofilm samples were collected during dry docking from representative areas of the ship and these provided information on the horizontal and vertical zonation of the hull, and intact and damaged coating and niche areas. Diatoms from the genera Achnanthes, Amphora and Navicula were the most common, regardless of horizontal ship zonation and coating type. Other genera were abundant, but their presence was more dependent on the ship zonation and coating type. Samples collected from damaged areas of the hull coating had a similar community composition to undamaged areas, but with higher diatom abundance. Diatom fouling on the niche areas differed from that of the surrounding ship hull and paralleled previous studies that investigated differences in diatom community structure on static and dynamically exposed coatings; niche areas were similar to static immersion and the hull to dynamic immersion. Additionally, diatom richness was greater on the ship with the FR coating, including the identification of several new genera to the biofouling literature, viz. Lampriscus and Thalassiophysa. These results are the first to describe diatom community composition on in-service ship hulls coated with a FR system. This class of coatings appears to have a larger diatom community compared to copper-based AF systems, with new diatom genera that have the ability to stick to ship hulls and withstand hydrodynamic forces, thus creating the potential for new problematic species in the biofilm.

  6. Status of spent fuel shipping cask development

    International Nuclear Information System (INIS)

    Hall, I.K.; Hinschberger, S.T.

    1989-01-01

    This paper discusses how several new-generation shopping cask systems are being developed for safe and economical transport of commercial spent nuclear fuel and other radioactive wastes for the generating sites to a federal geologic repository or monitored retrievable storage (MRS) facility. Primary objectives of the from-reactor spent fuel cask development work are: to increase cask payloads by taking advantage of the increased at-reactor storage time under the current spent fuel management scenario, to facilitate more efficient cask handling operations with reduced occupational radiation exposure, and to promote standardization of the physical interfaces between casks and the shipping and receiving facilities. Increased cask payloads will significantly reduce the numbers of shipments, with corresponding reductions in transportation costs and risks to transportation workers, cask handling personnel, and the general public

  7. Cargo-mix optimization in Liner Shipping

    DEFF Research Database (Denmark)

    Christensen, Jonas Mark; Pacino, Dario; Fonseca, Joao Filipe Paiva

    ’ utilization.The more containers a vessel carries the smaller is the resulting CO2 emissions per transported tonof cargo. This is what can be seen as a win-win situation. Better vessel utilization will result bothin cleaner transport and in better revenue margins for the shippers. Focus on vessel intake...... maximization is old news for liner shippers. Container vessels are deliveredwith a nominal capacity that ship owners know is only theoretical. Unless the cargo weightdistribution is perfect, the nominal intake cannot be reached. Stowage coordinators fight this battleeveryday. They are the planners of the cargo...... and have to find a load configuration (stowage plan)that both suits the current cargo to be loaded but also guarantees that the vessel can be utilizedto its maximum in future ports. The size of nowadays vessels is, however, making this work harderand harder (Pacino et al. (2011)). Moreover, the cargo...

  8. Annual report 1973

    International Nuclear Information System (INIS)

    1973-01-01

    The GKSS scientific annual report summarizes the problems and results of the research and development projects of 1973. In contrast to earlier annual reports, a comprehensive description of the research facilities is not included. The annual report was extended by the paragraph 'Financial Report 1973' in the chapter 'Development of Geesthacht Research Centre'. The financial report gives a survey of the financial transactions and the major operations of the year under review. (orig./AK) [de

  9. 10 CFR 72.166 - Handling, storage, and shipping control.

    Science.gov (United States)

    2010-01-01

    ... materials and equipment to prevent damage or deterioration. When necessary for particular products, special... 10 Energy 2 2010-01-01 2010-01-01 false Handling, storage, and shipping control. 72.166 Section 72... WASTE Quality Assurance § 72.166 Handling, storage, and shipping control. The licensee, applicant for a...

  10. Real-Time Simulation of Ship Impact for Crew Training

    DEFF Research Database (Denmark)

    Simonsen, Bo Cerup

    2003-01-01

    Real-time simulation of marine accidents and representation in a realistic, virtual environment may be an efficient way to train emergency procedures for ship?s crews and thus improve safety at sea. However, although various fast, simplified methods have been presented over the past decades...

  11. Ship Inspection Strategies: Effects on Maritime Safety and Environmental Protection

    NARCIS (Netherlands)

    C. Heij (Christiaan); G.E. Bijwaard (Govert); S. Knapp (Sabine)

    2010-01-01

    textabstractGlobal trade depends for a large part on maritime transport, and safe ships are needed not only to protect precious cargo but also to prevent environmental damage. Flag state and port state authorities spend much effort in ship safety inspections to ensure a minimum safety level and to

  12. Ship inspection strategies: effects on maritime safety and environmental protection

    NARCIS (Netherlands)

    Heij, C.; Bijwaard, G.E.; Knapp, S.

    2011-01-01

    Global trade largely depends on maritime transport, and appropriate ships are needed to protect cargo but to minimize environmental damage and to this end, flag and port state authorities expend considerable effort in ship safety inspections. This paper investigates the safety gains of current

  13. Model for Estimation of Fuel Consumption of Cruise Ships

    Directory of Open Access Journals (Sweden)

    Morten Simonsen

    2018-04-01

    Full Text Available This article presents a model to estimate the energy use and fuel consumption of cruise ships that sail Norwegian waters. Automatic identification system (AIS data and technical information about cruise ships provided input to the model, including service speed, total power, and number of engines. The model was tested against real-world data obtained from a small cruise vessel and both a medium and large cruise ship. It is sensitive to speed and the corresponding engine load profile of the ship. A crucial determinate for total fuel consumption is also associated with hotel functions, which can make a large contribution to the overall energy use of cruise ships. Real-world data fits the model best when ship speed is 70–75% of service speed. With decreased or increased speed, the model tends to diverge from real-world observations. The model gives a proxy for calculation of fuel consumption associated with cruise ships that sail to Norwegian waters and can be used to estimate greenhouse gas emissions and to evaluate energy reduction strategies for cruise ships.

  14. Recognition of ships for long-term tracking

    NARCIS (Netherlands)

    Broek, S.P. van den; Bouma, H.; Veerman, H.E.T.; Benoist, K.W.; Hollander, R.J.M. den; Schwering, P.B.W.

    2014-01-01

    Long-term tracking is important for maritime situational awareness to identify currently observed ships as earlier encounters. In cases of, for example, piracy and smuggling, past location and behavior analysis are useful to determine whether a ship is of interest. Furthermore, it is beneficial to

  15. A matheuristic for the liner shipping network design problem

    DEFF Research Database (Denmark)

    Brouer, Berit Dangaard; Desaulniers, Guy; Pisinger, David

    2014-01-01

    We present an integer programming based heuristic, a matheuristic, for the liner shipping network design problem. This problem consists of finding a set of container shipping routes defining a capacitated network for cargo transport. The objective is to maximize the revenue of cargo transport...

  16. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to complete...

  17. 75 FR 39089 - Shipping Coordinating Committee; Notice of Committee Meeting

    Science.gov (United States)

    2010-07-07

    ... to July 30, 2010. The primary matters to be considered include: --Adoption of the agenda --Decisions of other IMO bodies --Routing of ships, ship reporting and related matters --Guidelines for... equipment --International Telecommunication Union (ITU) matters, including Radiocommunication ITU-R Study...

  18. Unsupervised ship trajectory modeling and prediction using compression and clustering

    NARCIS (Netherlands)

    de Vries, G.; van Someren, M.; van Erp, M.; Stehouwer, H.; van Zaanen, M.

    2009-01-01

    In this paper we show how to build a model of ship trajectories in a certain maritime region and use this model to predict future ship movements. The presented method is unsupervised and based on existing compression (line-simplification) and clustering techniques. We evaluate the model with a

  19. 76 FR 44977 - Shipping Coordinating Committee; Notice of Committee Meeting

    Science.gov (United States)

    2011-07-27

    ... international trade. --Ship/port interface. --Technical co-operation and assistance. --Relations with other... DEPARTMENT OF STATE [Public Notice 6827] Shipping Coordinating Committee; Notice of Committee... upcoming events at the International Maritime Organization (IMO) in London, United Kingdom. The first of...

  20. Tramp Ship Routing and Scheduling - Models, Methods and Opportunities

    DEFF Research Database (Denmark)

    Vilhelmsen, Charlotte; Larsen, Jesper; Lusby, Richard Martin

    to mergers, pooling, and collaboration efforts between shipping companies, the fleet sizes have grown to a point where manual planning is no longer adequate in a market with tough competition and low freight rates. The aim of this paper is to provide a comprehensive introduction to tramp ship routing...

  1. The plundering of the ship graves from Oseberg and Gokstad

    DEFF Research Database (Denmark)

    Bill, Jan; Daly, Aoife

    2012-01-01

    Not the least of the unusual revelations that have come from the wonderfully preserved ninth-century Norwegian ship burials at Oseberg and Gokstad, is the fact that both had been later broken into-by interlopers who defaced the ship, damaged the grave goods and pulled out and dispersed the bones ...

  2. Proposed New Method of Interpretation of Infrared Ship Signature Requirements

    NARCIS (Netherlands)

    Neele, F.P.; Wilson, M.T.; Youern, K.

    2005-01-01

    new method of deriving and defining requirements for the infrared signature of new ships is presented. The current approach is to specify the maximum allowed temperature or radiance contrast of the ship with respect to its background. At present, in most NATO countries, it is the contractor’s

  3. Characterization of ships as sources of underwater noise

    NARCIS (Netherlands)

    Jong, C.A.F. de

    2009-01-01

    There is a growing interest in the possible impact of anthropogenic underwater noise on marine life [1]. One of the concerns is the increasing contribution of shipping noise, with the growing number and size of commercial ships. Traditionally, underwater radiated noise control was only of interest

  4. The Liner Shipping Routing and Scheduling Problem Under Environmental Considerations

    DEFF Research Database (Denmark)

    Dithmer, Philip; Reinhardt, Line Blander; Kontovas, Christos

    2017-01-01

    This paper deals with the Liner Shipping Routing and Scheduling Problem (LSRSP), which consists of designing the time schedule for a vessel to visit a fixed set of ports while minimizing costs. We extend the classical problem to include the external cost of ship air emissions and we present some ...

  5. Observations during the first K West fuel shipping campaign

    International Nuclear Information System (INIS)

    Makenas, B.J.

    1995-11-01

    Three fuel elements were shipped to the 300 Area hotcells during the first characterization shipping campaign from K West Basin. This document summarizes observations made during this campaign including the gas, liquid, and sludge content of the observed canisters. Included in an appendix is a detailed evaluation of fuel element condition for each canister opened

  6. Technological and economic study of ship recycling in Egypt

    Science.gov (United States)

    Welaya, Yousri M. A.; Abdel Naby, Maged M.; Tadros, Mina Y.

    2012-12-01

    The ship recycling industry is growing rapidly. It is estimated that the International Maritime Organization's (IMO) decision to phase-out single hull tankers by 2015 will result in hundreds of ships requiring disposal. At present, the ship recycling industry is predominantly based in South Asia. Due to the bad practice of current scrapping procedure, the paper will highlight the harm occurring to health, safety and environment. The efforts of the Marine Environment Protection Committee (MEPC) which led to the signing of the Hong Kong International Convention are also reviewed. The criteria and standards required to reduce the risk and damage to the environment are discussed and a proposed plan for the safe scrapping of ships is then presented. A technological and economic study for the ship recycling in Egypt is carried out as a case study. This includes the ship recycling facility size and layout. The equipment and staff required to operate the facility are also evaluated. A cost analysis is then carried out. This includes site development, human resources, machineries and equipment. A fuzzy logic approach is used to assess the benefits of the ship breaking yard. The use of the fuzzy logic approach is found suitable to make decisions for the ship breaking industry. Based on given constraints, the proposed model has proved capable of assessing the profit and the internal rate of return.

  7. 75 FR 65551 - Shipping Coordinating Committee; Notice of Subcommittee Meeting

    Science.gov (United States)

    2010-10-25

    ... from passenger ships. --Review of damage stability regulations for ro-ro passenger ships. --Legal and... SOLAS chapter II-1 subdivision and damage stability regulations. --Consideration of IACS unified... 2012. --Any other business. --Report to the Maritime Safety Committee. Members of the public may attend...

  8. Toolset for evaluating infrared countermeasures and signature reduction for ships

    NARCIS (Netherlands)

    Schleijpen, H.M.A.

    2010-01-01

    The protection of ships against infrared guided missiles is a concern for modern naval forces. The vulnerability of ships can be reduced by applying countermeasures such as infrared decoys and infrared signature reduction. This paper presents a set of simulation tools which can be used for assessing

  9. Exhaust emissions from ships at berth

    Science.gov (United States)

    Cooper, D. A.

    Emission measurements have been carried out on board six ships at berth during normal real-world operation (hotelling, unloading and loading activities). The study included three passenger ferries, one transoceanic container/ro-ro, one transoceanic car/truck carrier, and one chemical tanker. Emissions were measured from 22 auxiliary engines (AEs, medium and high-speed marine diesels) covering seven engine models and ranging in size from 720 to 2675 kW maximum output. The fuels varied from low sulphur gasoils ( 2.91 cst viscosity) through to residual oils ( 411 cst viscosity). Both specific emission factors ( g kWh -1) at a given engine load and total emissions (kg) of nitrogen oxides (NO x), sulphur dioxide, carbon monoxide, hydrocarbons, carbon dioxide, particulate matter (PM) and polyaromatic hydrocarbons during actual harbour stops were determined. In addition, some preliminary measurements to investigate PM size distributions were undertaken. The specific emissions showed significant variations between the different engine models and also within the same engine model on board the same ship. For example NO x emissions varied between 9.6 and 20.2 g kWh corr-1 between all engines and 14.2- 18.6 g kWh corr-1 between engines of the same model and fuel. Other emissions from boiler use and possible main engine warm-up prior to departure were in general expected to be considerably less than those from the AEs. The results obtained for the three passenger ferries demonstrate that empirically derived, emission formulae using dead weight tonnage can prove to be a cost-effective and accurate tool for harbour emission inventories.

  10. The KiteShip (TM) project

    Energy Technology Data Exchange (ETDEWEB)

    De winter, Francis; Swenson, Ronald B; Culp, David [Santa Cruz, CA (United States)

    2000-07-01

    Foreseeable crude oil shortages provide an incentive to use wind power in the merchant marine again, to save fuel by providing propulsion power. Out prototype KiteShip (TM), a lightweight fiberglass proa 7 m long, has been sailed with 2 different sizes of kites in fresh water. The kites are shaped like parafoil wings, with areas of 4 sq m and 9 sq m. Steering is accomplished with two coupled rudders, one fore and one aft. We have been encouraged by the boat speed and the handling, although we have encountered only light winds up to now, of no more than about 20 km/ht. In the next phase we will employ a custom-built kite of 2 sq m. and will also start sailing in the ocean with heavier winds, of 40 km/hr and above. [Spanish] La escasez previsible de petroleo motiva volver a utilizar la fuerza del viento en la marina mercante, para ahorrar combustible al suministrar la potencia de propulsion. Nuestro prototipo KiteShip (MR), con una proa ligera de fibra de vidrio con 7 m de longitud, ha navegado con dos diferentes tipos de vela ({sup k}ite{sup )} en agua dulce. Los kites tienen forma de alas de parafol, con areas de 4 m{sup 2} y 9 m{sup 2}. La direccion se logra con dos timones acoplados, uno en la proa y otro en la popa. Nos entusiasmo la velocidad del bote y su manejo, aunque hemos encontrado hasta ahora solo vientos ligeros de no mas de alrededor de 20 km/hr. En la siguiente fase emplearemos un kite hecho a la medida, de 28 m{sup 2} y tambien comenzaremos a navegar en el oceano con vientos mas fuertes de 40 km/hr o mas.

  11. Annual Statistical Supplement, 2001

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2001 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  12. Annual Statistical Supplement, 2011

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2011 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  13. Annual Statistical Supplement, 2003

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2003 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  14. Annual Statistical Supplement, 2015

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2015 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  15. Annual Statistical Supplement, 2000

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2000 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  16. Annual Statistical Supplement, 2005

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2005 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  17. Annual Statistical Supplement, 2014

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2014 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  18. Annual Statistical Supplement, 2009

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2009 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  19. Annual Statistical Supplement, 2017

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2017 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  20. Annual Statistical Supplement, 2008

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2008 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  1. Annual Statistical Supplement, 2010

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2010 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  2. Annual Statistical Supplement, 2016

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2016 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  3. Annual Statistical Supplement, 2004

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2004 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  4. Annual Statistical Supplement, 2002

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2002 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  5. Annual Statistical Supplement, 2007

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2007 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  6. Annual Statistical Supplement, 2006

    Data.gov (United States)

    Social Security Administration — The Annual Statistical Supplement, 2006 includes the most comprehensive data available on the Social Security and Supplemental Security Income programs. More than...

  7. Numerical Study on the Effect of Buffer Bow Structure in Ship-to-ship Collisions

    DEFF Research Database (Denmark)

    Yamada, Yasuhira; Endo, Hisayoshi; Pedersen, Preben Terndrup

    2005-01-01

    A disastrous oil spill from a struck oil tanker has become one of the major problems in view of conservation of maritime environment. So far double hulls (D/H) have been introduced to reduce the consequences of collision and grounding events In order to further reduce the oil spill from struck oil...... structure in ship-ship collisions as compared with that of standard bulbous bows. This is demonstrated by conducting a series of large-scale finite element analyses. The finite element analyses are conducted with the general-purpose nonlinear structural code “LS-DYNA”. The applied scenario is one where...... a very large crude oil carrier (VLCC) in ballast condition collides with the midship region of a D/H VLCC in a laden condition. Fracture of fillet welds, elastic-plastic material properties and strain rate effects, are taken into account in the simulations. The effect of the equivalent failure strain (FS...

  8. Analysis of Methods of Determining the Safe Ship Trajectory

    Directory of Open Access Journals (Sweden)

    Jozef Lisowski

    2016-07-01

    Full Text Available The paper describes six methods of optimal and game theory and artificial neural network for synthesis of safe control in collision situations at sea. The application of optimal and game control algorithms to determine the own ship safe trajectory during the passing of other encountered ships in good and restricted visibility at sea is presented. The comparison of the safe ship control in collision situation: multi-step matrix non-cooperative and cooperative games, multi-stage positional non-cooperative and cooperative games have been introduced. The considerations have been illustrated with examples of computer simulation of the algorithms to determine safe of own ship trajectories in a navigational situation during passing of eight met ships.

  9. Routing and Scheduling in Tramp Shipping - Integrating Bunker Optimization

    DEFF Research Database (Denmark)

    Vilhelmsen, Charlotte; Lusby, Richard Martin; Larsen, Jesper

    A tramp ship operator typically has some contracted cargoes that must be carried and seeks to maximize pro_t by carrying optional cargoes. Hence, tramp ships operate much like taxies following available cargoes and not according to a _xed route network and itinerary as liner ships. Marine fuel...... is referred to as bunker fuel or simply bunker and bunker costs constitute a signi_cant part of the daily operating costs. There can be great variations in bunker prices across bunker ports so it is important to carefully plan bunkering for each ship. As ships operate 24 hours a day, they must refuel during...... and bunker consumption. We devise a solution method based on column generation with a dynamic programming algorithm to generate columns. The method is heuristic mainly due to a discretization of the continuous bunker purchase variables. We show that the integrated planning approach can increase pro...

  10. Wastewater Pollution from Cruise Ships in the Adriatic Sea

    Directory of Open Access Journals (Sweden)

    Tina Perić

    2016-08-01

    Full Text Available The global growth of cruise tourism has brought increasing concern for the pollution of the marine environment. Marine pollution from sanitary wastewater is a problem especially pronounced on large cruise ships where the number of people on board may exceed 8,000. To evaluate future marine pollution in any selected period of time it is necessary to know the movement of ships in the Adriatic Sea. This paper presents the problem of marine pollution by sanitary wastewater from cruise ships, wastewater treatment technology and a model of cruise ship traffic in the Adriatic Sea considering MARPOL Annex IV areas of limited wastewater discharge. Using the model, it is possible to know in advance the routes of the cruisers and retention time in certain geographic areas. The data obtained by this model can be used as input parameters for evaluation model of wastewater pollution or for evaluation of other types of pollution from cruise ships.

  11. Numerical simulation of hydrodynamic performance of ship under oblique conditions

    Directory of Open Access Journals (Sweden)

    CHEN Zhiming

    2018-02-01

    Full Text Available [Objectives] This paper is intended to study the viscous flow field around a ship under oblique conditions and provide a research basis for ship maneuverability. [Methods] Using commercial software STRA-CCM+, the SST k-ω turbulence model is selected to predict the hydrodynamic performance of the KVLCC2 model at different drift angles, and predict the hull flow field. The pressure distribution of the ship model at different drift angles is observed and the vortex shedding of the ship's hull and constraint streamlines on the hull's surface are also observed. [Results] The results show that numerical simulation can satisfy the demands of engineering application in the prediction of the lateral force, yaw moment and hull surface pressure distribution of a ship. [Conclusions] The research results of this paper can provide valuable references for the study of the flow separation phenomenon under oblique conditions.

  12. An Integrated Approach to Naval Ship Survivability in Preliminary Ship Design

    OpenAIRE

    Piperakis, A. S.

    2013-01-01

    Alongside deploying weapons and sensors what makes a warship distinct is survivability, being the measure that enables a warship to survive in a militarily hostile environment. The rising cost of warship procurement, coupled with declining defence budgets, has led to a reduction in the number of ships in most western navies. Moreover, cost cutting is often aimed at aspects which may be difficult to quantify, such as survivability, and can lead to potentially inadequate designs. Innovation in ...

  13. Annual report 1991 TECO Energy Inc

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Achievements of TECO energy during 1991 are summarized in the annual report which includes financial statements for the year up to 31 December 1991. Methane production from coal seams in the Black Warrior Basin of Alabama, by TECO Coalbed Methane, increased to 55 million cubic feet per day. The purchase of Gulf-States Paper's interest in two coalbed methane projects brought TECO's total commitment in coalbed methane to 135 million dollars. TECO Coal acquired additional reserves of low-sulphur coal in bringing total holdings to 175 million tons. Work continued on construction of TECO Power Services' combined cycle power plant. Tampa Electric announced plans to build a power plant in Polk County using the latest coal gasification technology TECO Transport ampersand Trade's shipping and transloading companies performed well during the year

  14. Capability of geometric features to classify ships in SAR imagery

    Science.gov (United States)

    Lang, Haitao; Wu, Siwen; Lai, Quan; Ma, Li

    2016-10-01

    Ship classification in synthetic aperture radar (SAR) imagery has become a new hotspot in remote sensing community for its valuable potential in many maritime applications. Several kinds of ship features, such as geometric features, polarimetric features, and scattering features have been widely applied on ship classification tasks. Compared with polarimetric features and scattering features, which are subject to SAR parameters (e.g., sensor type, incidence angle, polarization, etc.) and environment factors (e.g., sea state, wind, wave, current, etc.), geometric features are relatively independent of SAR and environment factors, and easy to be extracted stably from SAR imagery. In this paper, the capability of geometric features to classify ships in SAR imagery with various resolution has been investigated. Firstly, the relationship between the geometric feature extraction accuracy and the SAR imagery resolution is analyzed. It shows that the minimum bounding rectangle (MBR) of ship can be extracted exactly in terms of absolute precision by the proposed automatic ship-sea segmentation method. Next, six simple but effective geometric features are extracted to build a ship representation for the subsequent classification task. These six geometric features are composed of length (f1), width (f2), area (f3), perimeter (f4), elongatedness (f5) and compactness (f6). Among them, two basic features, length (f1) and width (f2), are directly extracted based on the MBR of ship, the other four are derived from those two basic features. The capability of the utilized geometric features to classify ships are validated on two data set with different image resolutions. The results show that the performance of ship classification solely by geometric features is close to that obtained by the state-of-the-art methods, which obtained by a combination of multiple kinds of features, including scattering features and geometric features after a complex feature selection process.

  15. Aging Behavior of the EPDM O-Rings in the H1616 Shipping Package

    Energy Technology Data Exchange (ETDEWEB)

    Daugherty, W.; Stefek, T.; Skidmore, E.

    2015-06-09

    The H1616 shipping package is used within the DOE complex for shipping tritium reservoirs. The annual recertification frequency can create logistical difficulties with other constraints on the timing of shipments; thus, a longer re-certification period is desirable. The ethylene propylene diene monomer (EPDM) O-rings used in the H1616 shipping package are being aged and tested at the Savannah River National Laboratory (SRNL) to provide a technical basis for extending the annual maintenance of the H1616 shipping package. H1616 EPDM O-rings are being aged at elevated temperature, and tested for degradation in mechanical properties, compression stress relaxation (CSR) behavior, and leak performance. Mechanical properties of aged O-rings show significant degradation can occur, but an inert atmosphere (argon backfill) greatly reduces the rate of degradation. The CSR behavior of O-rings was evaluated in air at 79 to 177 °C. These collective data were used to develop a predictive model for extrapolation of CSR behavior to relevant service temperatures (<67 °C). O-rings were also aged in H1616 Containment Vessels (CV) in an inert atmosphere at 71 to 149 °C. The vessels are helium leak tested periodically to determine if they continue to remain leak-tight. The vessel tests provide a solid demonstration that the H1616 O-rings will remain leak-tight at temperatures up to 113 °C for up to approximately 2.3 years. Significantly longer periods of leak-tight service are expected at the lower temperatures actually experienced in service. The predictive model developed from the CSR data conservatively indicates a service life of ~5 years at 67 °C. Although the relationship between CSR behavior and leak-tight performance has not been established for this design, the CSR predictions for this O-ring are conservative relative to leak-tight performance. Based on the collective data developed to date, SRNL has recommended that the maintenance interval for the H1616 package be

  16. Towards a different view on ship design : The development of ships observed through a social?technological perspective

    NARCIS (Netherlands)

    Van Bruinessen, T.M.; Smulders, F.E.H.M.; Hopman, J.J.

    2013-01-01

    The research this paper reports on aims to develop a design and engineering strategy for complex ships in between incremental and radical innovation. The majority of European ship-design industry concentrates on the development of complex, one-off ‘specials’ for the offshore industry, like dredgers,

  17. Strategic guidance based on the concept of cleaner production to improve the ship recycling industry

    NARCIS (Netherlands)

    Jain, K.P.; Pruijn, J.F.J.; Hopman, J.J.

    2017-01-01

    The implementation of international ship recycling regulations and international standards of health, safety and environment on a ship recycling yard improves environmental protection, occupational health and safety of the workers. However, it results in increased costs of the ship recycling

  18. Annual report to Congress

    International Nuclear Information System (INIS)

    1987-01-01

    This is the ninth Annual Report to Congress of the United States Department of Energy. It covers the activities of all elements of the Department except the independent Federal Regulatory Commission, which issues its own annual report. 88 refs., 43 tabs

  19. Annual Report 2001

    International Nuclear Information System (INIS)

    Swiboda, G.

    2002-01-01

    This Annual Report of the Institute of Atomic Energy describes the results of the research works carried out at the Institute at 2001. As in the preceding years the authors of the individual scientific reports published in this Annual Report are fully responsible for their content and layout. The Report contains the information on other activities of the Institute as well. (author)

  20. Annual Report 1997

    Energy Technology Data Exchange (ETDEWEB)

    Golnik, N.; Mika, J.R.; Wieteska, K. [eds.

    1998-12-31

    This Annual Report of the Institute of Atomic Energy describes the results of the research works carried out at the Institute at 1997. As in the preceding years the authors of the individual scientific reports published in this Annual Report are fully responsible for their content and layout. The Report contains the information on other activities of the Institute as well. (author)

  1. CSIR Annual report 1990

    CSIR Research Space (South Africa)

    CSIR

    1990-01-01

    Full Text Available stream_source_info Annual Report_ 1990.pdf.txt stream_content_type text/plain stream_size 26 Content-Encoding ISO-8859-1 stream_name Annual Report_ 1990.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  2. Natural gas annual 1991

    International Nuclear Information System (INIS)

    1993-01-01

    The Natural Gas Annual 1991 provides information on the supply and disposition of natural gas to a wide audience including industry, consumers Federal and State agencies, and education institutions. This report, the Natural Gas Annual 1991 Supplement: Company Profiles, presents a detailed profile of selected companies

  3. CSIR Annual report 1995

    CSIR Research Space (South Africa)

    CSIR

    1995-01-01

    Full Text Available stream_source_info CSIR Annual report_1995.pdf.txt stream_content_type text/plain stream_size 33 Content-Encoding ISO-8859-1 stream_name CSIR Annual report_1995.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  4. CSIR Annual report 1992

    CSIR Research Space (South Africa)

    CSIR

    1992-01-01

    Full Text Available stream_source_info Annual Report_ 1992.pdf.txt stream_content_type text/plain stream_size 39 Content-Encoding ISO-8859-1 stream_name Annual Report_ 1992.pdf.txt Content-Type text/plain; charset=ISO-8859-1 ...

  5. Annual Partnership Report, 2016

    Science.gov (United States)

    Wyoming Community College Commission, 2016

    2016-01-01

    The "Annual Partnership Report" catalogs partnerships that Wyoming community colleges established and maintained for each fiscal year. This partnership report fulfills statutory reporting requirement W.S. 21-18-202(e)(iv) which mandates the development of annual reports to the legislature on the outcomes of partnerships between colleges…

  6. Annual Report 1997

    International Nuclear Information System (INIS)

    Golnik, N.; Mika, J.R.; Wieteska, K.

    1998-01-01

    This Annual Report of the Institute of Atomic Energy describes the results of the research works carried out at the Institute at 1997. As in the preceding years the authors of the individual scientific reports published in this Annual Report are fully responsible for their content and layout. The Report contains the information on other activities of the Institute as well. (author)

  7. 55th Annual

    Indian Academy of Sciences (India)

    1990-01-01

    Jan 1, 1990 ... At the invitation of the Madhya Pradesh. Council of Science and Technology, the. Barkatullah University and the Regional. Research laboratory, Bhopal, the 55th Annual. Meeting of the Academy was held at the. Tagore Bhawan, Bhopal from 10 to 13. November 1989. One of the best organized Annual.

  8. Annual Energy Review, 2008

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-06-01

    The Annual Energy Review (AER) is the Energy Information Administration's (EIA) primary report of annual historical energy statistics. For many series, data begin with the year 1949. Included are statistics on total energy production, consumption, trade, and energy prices; overviews of petroleum, natural gas, coal, electricity, nuclear energy, renewable energy, and international energy; financial and environment indicators; and data unit conversions.

  9. Radiated noise from commercial ships in the Gulf of Maine: implications for whale/vessel collisions.

    Science.gov (United States)

    Allen, J Kaitlyn; Peterson, Michael L; Sharrard, George V; Wright, Dana L; Todd, Sean K

    2012-09-01

    To understand mysticete acoustic-based detection of ships, radiated noise from high-speed craft, cruise ships, catamarans and fishing vessels was recorded June-September 2009. Calibrated acoustic data (fishing vessel had the lowest. Ship noise radiated asymmetrically and varied with depth. Bow null-effect acoustic shadow zones were observed for all ship classes and were correlated with ship-length-to-draft-ratios. These shadow zones may reduce ship detection by near-surface mysticetes.

  10. Assessment of Surface Ship Maintenance Requirements

    Science.gov (United States)

    2015-01-01

    may not be reflected in average class maintenance cost. If this is the case, the deferred actions may in fact pile up significantly and result in even...and preservation of the propulsion- combustion air intakes and louvers. Mandatory maintenance requirements are for the inspection of intakes annually...Pitch Propeller every dry docking. • SWLIN 2513X: Condition-based repair and preservation of the propulsion- combustion air intakes and louvers. Mandatory

  11. Novel restriction enzyme SSiI for the detection of mutation in GyrA gene of Salmonella enterica serovar Typhi

    Directory of Open Access Journals (Sweden)

    Agrawal Parul

    2010-07-01

    Full Text Available Aim: Enteric fever is an ongoing problem in the developing nations. Resistance and reduced susceptibility to ciprofloxacin narrows the therapeutic options in enteric fever. The present study was carried out with the objective of determining molecular basis of resistance to fluoroquinolone among the clinical isolates of Salmonella enterica serovar Typhi from different parts of India. Materials and Methods: A total of 60 S.Typhi clinical isolates were subjected to antimicrobial susceptibility testing and determination of minimum inhibitory concentration (MIC to ciprofloxacin and nalidixic acid. Polymerase chain reaction (PCR for GyrA gene followed by restriction fragment length polymorphism (RFLP with restriction enzyme (RE SSiI was performed to detect mutation at position Ser83. Further confirmation of mutation was done by nucleotide sequencing of GyrA gene. Results: Isolates showed 100% sensitivity to first-line drugs ampicillin, chloramphenicol, and cotrimoxazole. Twelve of the 60 isolates (18% were susceptible to nalidixic acid (NASST and the remaining 48 (82% were resistant to nalidixic acid (NARST. Of these 48 NARST strains, 46 (97.5% had reduced susceptibility to ciprofloxacin (MIC 0.25-1.0 μg/mL, whereas 2 strains (2.75% were resistant to ciprofloxacin (MIC 4.0 μg/mL. In RFLP analysis, all the NASST strains showed 3 fragments, whereas all the NARST strains showed 2 fragments due to the loss of 1 restriction site as a result of mutation. All the NARST strains with reduced susceptibility to ciprofloxacin (n = 46 had a single mutation in gyrA gene (Ser 83→Tyr or Ser 83→Phe, whereas double mutations (Ser 83→Phe and Asp 87→Asn were found in each of the 2 ciprofloxacin-resistant strains. None of the NASST strains (n = 12 revealed any mutation. Conclusion: Our study exemplifies the correlation between nalidixic acid screening test, MIC values, and the detection of mutation in GyrA gene by PCR-RFLP with a novel RE SSiI.This was further

  12. Annual report 2001

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    Det Norske Veritas (DNV) has been a ship classification society since 1864, and is recognised as a leader in today's global classification market. During the past decade there has been a significant growth in the fields of certification and consultacy. DNV is an independent foundation with headquarters in Oslo, Norway, and a network of offices in 100 countries. The offshore oil- and gas installations are an important recent field of work for DNV.

  13. Azimuth method for ship position in celestial navigation

    Directory of Open Access Journals (Sweden)

    Van-Suong Nguyen

    2017-06-01

    Full Text Available The methods of celestial navigation to fix the ship position in line with the stars are only applied in the twilight time interval when both the celestial bodies and the horizon apppear simultaneously. This means that these methods cannot be used during the night even if the stars are visible. This paper proposes a novel approach which uses the azimuth of the celestial body in order to establish the great circle equation relating the observed body to the ship position when the celestial bodies appear. In addition, the proposed method does not demand the horizon and sextant equipment as with the previous methods. The key advantage which differentiates this method from previous ones is its ability to determine the ship position during the night when the horizon is invisible. Firstly, the vector calculus is applied to find the mathematical equation for the ship position through analyzing the relationship between the ship position and the great-circle azimuth of the observed body. Secondly, the equation system for the ship position is expanded into a standard system in which the input for the proposed mathematical system are the great-circle azimuth and the coordinates of the observed body. Finally, the numerical technique is also proposed to solve the nonlinear system for the ship position. To verify the validation of this proposed method, a numerical experiment is carried out and the results show that it can be applied well in practice.

  14. High SHIP2 Expression Indicates Poor Survival in Colorectal Cancer

    Directory of Open Access Journals (Sweden)

    Ju Yang

    2014-01-01

    Full Text Available SH2-containing inositol 5′-phosphatase 2 (SHIP2, which generally regulates insulin signaling, cytoskeleton remodeling, and receptor endocytosis, has been suggested to play a significant role in tumor development and progression. However, the associations between SHIP2 expression and the clinical features to evaluate its clinicopathologic significance in colorectal cancer (CRC have not been determined yet. In the present study, one-step quantitative real-time polymerase chain reaction (qPCR test and immunohistochemistry (IHC analysis with CRC tissue microarrays (TMA were employed to evaluate the mRNA and protein expression of SHIP2 in CRC. The results showed that SHIP2 expression in the mRNA and protein levels was significantly higher in CRC tissues than that in corresponding noncancerous tissues (both P<0.05. The expression of SHIP2 protein in CRC was related to lymph node metastasis (P=0.036, distant metastasis (P=0.001, and overall survival (P=0.009. Kaplan-Meier method and Cox multifactor analysis suggested that high SHIP2 protein level (P=0.040 and positive distant metastasis (P=0.048 were critically associated with the unfavorable survival of CRC patients. The findings suggested that SHIP2 may be identified as a useful prognostic marker in CRC and targeting CRC may provide novel strategy for CRC treatment.

  15. Six cyclopic ships with the death of one of them.

    Science.gov (United States)

    Cohen, M Michael

    2010-09-01

    Given the knowledge of cyclopic humans and animals and their lethal nature, and given the negative way in which the cyclops is portrayed in mythology and in art, it is unusual that six naval ships--four English and two American--were named "Cyclops." However, there are also important positive attributes of the Cyclopes in Greek mythology, which explain the reasons the ships were given this name. One ship, the USS "Cyclops," with 306 men aboard, was lost at sea in the "Bermuda Triangle" in 1918 without a trace and no wreckage has ever been found.

  16. Legionella risk assessment in cruise ships and ferries

    Directory of Open Access Journals (Sweden)

    Pasqualina Laganà

    2017-06-01

    Legionella pneumophila sg 1 was isolated from the samples of shower and tap water in 7 (70% of the 10 ferries examined, and in 3 (33% of the 6 cruise ships examined, and L. pneumophila sg 2–14 in 8 (80% and 1 (16.7% of these ships, respectively. No Legionella contamination was found in whirlpool baths, air and ice samples. In conclusion, the data obtained confirm higher levels of Legionella contamination in local ferries and cruise ships, underlining the need to adopt corrective actions more specific for these smaller vessels.

  17. Routing and Scheduling in Tramp Shipping - Integrating Bunker Optimization

    DEFF Research Database (Denmark)

    Vilhelmsen, Charlotte; Lusby, Richard Martin; Larsen, Jesper

    A tramp ship operator typically has some contracted cargoes that must be carried and seeks to maximize proFIt by carrying optional cargoes. Hence, tramp ships operate much like taxies following available cargoes and not according to a fixed route network and itinerary as liner ships. Marine fuel...... and scheduling phase and present a mixed integer programming formulation for the integrated problem of optimally routing, scheduling and bunkering a tramp fleet. Aside from the integration of bunker, this model also extends standard tramp formulations by using load dependent costs, speed and bunker consumption...

  18. Tramp ship routing and scheduling with integrated bunker optimization

    DEFF Research Database (Denmark)

    Vilhelmsen, Charlotte; Lusby, Richard Martin; Larsen, Jesper

    2014-01-01

    A tramp ship operator typically has some contracted cargoes that must be carried and seeks to maximize prot by carrying optional cargoes. Hence, tramp ships operate much like taxies following available cargoes and not according to a fixed route network and itinerary as liner ships. Marine fuel...... and scheduling phase and present a mixed integer programming formulation for the integrated problem of optimally routing, scheduling and bunkering a tramp fleet. Aside from the integration of bunker, this model also extends standard tramp formulations by using load dependent costs, speed and bunker consumption...

  19. Methodology of Day-To-Day Ship Costs Assessment

    Directory of Open Access Journals (Sweden)

    Milojka Počuča

    2006-09-01

    Full Text Available The paper presents a methodology of assessing the day-to-day fixed costs of maritime cargo ships. The authoress refersthe reader to factors that affect the amount affixed daily costsand the day-to-day voyage costs of ships. In the last chapter thepaper presents an estimation of the average daily fixed costsand day-to-day voyage costs of ships per type and size for theyear 2003. Besides particular explanations, the reader is refe"ed to data bases that authentically impart data on the structureof maritime fleets and their technical characteristics, aswell as databases on prices and costs in maritime transport.

  20. Evaluation of Differentiation Strategy in Shipping Enterprises with Simulation Model

    Science.gov (United States)

    Vaxevanou, Anthi Z.; Ferfeli, Maria V.; Damianos, Sakas P.

    2009-08-01

    The present inquiring study aims at investigating the circumstances that prevail in the European Shipping Enterprises with special reference to the Greek ones. This investigation is held in order to explore the potential implementation of strategies so as to create a unique competitive advantage [1]. The Shipping sector is composed of enterprises that are mainly activated in the following three areas: the passenger, the commercial and the naval. The main target is to create a dynamic simulation model which, with reference to the STAIR strategic model, will evaluate the strategic differential choice that some of the shipping enterprises have.

  1. Water-immersion type ship reactor

    International Nuclear Information System (INIS)

    Okada, Hiroki; Yamamura, Toshio.

    1996-01-01

    In a water immersion-type ship reactor in which a water-tight wall is formed around a pressure vessel by way of an air permeable heat insulation layer and immersing the wall under water in a reactor container, a pressure equalizing means equipped with a back flow check valve and introducing a gas in a gas phase portion above the water level of the container into a water tight wall and a relief valve for releasing the gas in the water tight wall to the reactor container are disposed on the water tight wall. When the pressure in the water tight wall exceeds the pressure in the container, the gas in the water tight wall is released from the relief valve to the reactor container. On the contrary, when the pressure in the container exceeds the pressure in the water tight wall, the gas in the gas phase portion is flown from the pressure equalizing means equipped with a back flow check valve to the inside of the water tight wall. Thus, a differential pressure between both of them is kept around 0kg/cm 2 . A large differential pressure is not exerted on the water tight wall thereby capable of preventing rupture of them to improve reliability, as well as the thickness of the plate can be decreased thereby enabling to moderate the design for the pressure resistance and reduce the weight. (N.H.)

  2. A high temperature reactor for ship propulsion

    International Nuclear Information System (INIS)

    Lobet, P.; Seigel, R.; Thompson, A.C.; Beadnell, R.M.; Beeley, P.A.

    2002-01-01

    The initial thermal hydraulic and physics design of a high temperature gas cooled reactor for ship propulsion is described. The choice of thermodynamic cycle and thermal power is made to suit the marine application. Several configurations of a Helium cooled, Graphite moderated reactor are then analysed using the WIMS and MONK codes from AEA Technology. Two geometries of fuel elements formed using micro spheres in prismatic blocks, and various arrangements of control rods and poison rods are examined. Reactivity calculations through life are made and a pattern of rod insertion to flatten the flux is proposed and analysed. Thermal hydraulic calculations are made to find maximum fuel temperature under high power with optimized flow distribution. Maximum temperature after loss of flow and temperatures in the reactor vessel are also computed. The temperatures are significantly below the known limits for the type of fuel proposed. It is concluded that the reactor can provide the required power and lifetime between refueling within likely space and weight constraints. (author)

  3. F-16XL ship #1 crew

    Science.gov (United States)

    1995-01-01

    November 27, 1995 Photograph of the F-16XL Ship #1 Cranked-Arrow Wing Aerodynamic Project (CAWAP) Test Team; from left to right, Ron Wilcox; Operations Engineer, Art Cope; Aircraft Mechanic, Dave Fisher; Chief Project Engineer, Dick Denman; Aircraft Mechanic, Bob Garcia; A/C Crew Chief, Susan Ligon; Aircraft Mechanic, Rodger Tarango; Mobile Operations Facility (MOF) Staff, Jerry Cousins; Aircraft Mechanic, Bruce Gallmeyer; MOF Staff, and Mike Reardon; Aircraft Mechanic/Helper. The modified airplane features a delta 'cranked-arrow' wing with strips of tubing along the leading edge to the trailing edge to sense static on the wing and obtain pressure distribution data. The right wing receives data on pressure distribution and the left wing has three types of instrumentation - preston tubes to measure local skin friction, boundary layer rakes to measure boundary layer profiles (the layer where the air interacts with the surfaces of a moving aircraft), and hot films to determine boundary layer transition locations. The first flight of CAWAP occurred at NASA's Dryden Flight Research Center, Edwards, California, on November 21, 1995, and the test program ended in April 1996.

  4. Conversion of fracture toughness testing values from small scale three point bending test specimens to small scale yielding state (SSY) by elastic-plastic stress analysis

    International Nuclear Information System (INIS)

    Ikonen, K.

    1993-07-01

    The report describes the work performed for achieving readiness to calculate fracture toughness dependence on dimension effects and loading conditions in fracture test specimens and real structures. In the report two- and three-dimensional computer codes developed and calculational methods applied are described. One of the main goals is to converse fracture toughness from small scale three point bending test specimens to case of a depth crack in plane strain i.e. to small scale yielding state (SSY) by numerical elastic-plastic stress analysis. Thickness effect of a test specimens and effect of a crack depth are separately investigated. Tests of three point bending specimens with and without sidegrooves and curved crack front are numerically simulated and experimental and computed results are compared. J-integral is calculated along crack front and also from force-deflection dependence of the beam. For the analyses the computing system was thoroughly automatized. Measuring capacity of three point bending test specimens was tried to evaluate. (orig.) (7 refs., 54 figs.)

  5. International Expert Review of Sr-Can: Safety Assessment Methodology - External review contribution in support of SSI's and SKI's review of SR-Can

    International Nuclear Information System (INIS)

    Sagar, Budhi; Egan, Michael; Roehlig, Klaus-Juergen; Chapman, Neil; Wilmot, Roger

    2008-03-01

    In 2006, SKB published a safety assessment (SR-Can) as part of its work to support a licence application for the construction of a final repository for spent nuclear fuel. The purposes of the SR-Can project were stated in the main project report to be: 1. To make a first assessment of the safety of potential KBS-3 repositories at Forsmark and Laxemar to dispose of canisters as specified in the application for the encapsulation plant. 2. To provide feedback to design development, to SKB's research and development (R and D) programme, to further site investigations and to future safety assessments. 3. To foster a dialogue with the authorities that oversee SKB's activities, i.e. the Swedish Nuclear Power Inspectorate, SKI, and the Swedish Radiation Protection Authority, SSI, regarding interpretation of applicable regulations, as a preparation for the SR-Site project. To help inform their review of SKB's proposed approach to development of the longterm safety case, the authorities appointed three international expert review teams to carry out a review of SKB's SR-Can safety assessment report. Comments from one of these teams - the Safety Assessment Methodology (SAM) review team - are presented in this document. The SAM review team's scope of work included an examination of SKB's documentation of the assessment ('Long-term safety for KBS-3 Repositories at Forsmark and Laxemar - a first evaluation' and several supporting reports) and hearings with SKB staff and contractors, held in March 2007. As directed by SKI and SSI, the SAM review team focused on methodological aspects and sought to determine whether SKB's proposed safety assessment methodology is likely to be suitable for use in the future SR-Site and to assess its consistency with the Swedish regulatory framework. No specific evaluation of long-term safety or site acceptability was undertaken by any of the review teams. SKI and SSI's Terms of Reference for the SAM review team requested that consideration be given

  6. Review of SKB's interim report of SR-Can: SKI's and SSI's evaluation of SKB's up-dated methodology for safety assessment

    International Nuclear Information System (INIS)

    Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan; Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind

    2005-07-01

    This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report

  7. Design of Control and Monitoring System to Avoid Inter-Ship Collisions in West Shipping Lane Tanjung Perak Surabaya

    Directory of Open Access Journals (Sweden)

    Devina P. Sari

    2012-11-01

    Full Text Available The occurrence of several ship accidents in narrow waters of Madura strait which is the west shipping lane of Tanjung Perak Surabaya has inspired the research on the design of a control system on the ship to avoid any collision between ships. The existence of automatic control with the autopilot is required to minimize the occurrence of collisions between ships In this final study investigated the application of fuzzy logic to control the yaw angle on the vessel MV Karana Sembilan. Fuzzy logic used is Sugeno Takagi type with the input of the error yaw, yaw rate and distance of the ship with a disturbance. Tests conducted with a control system without disturbance, with disturbance, and the presence of obstacles in front of the ship. Performance of control system is obtained by using the disturbance, the fuzzy appearance is 2:41 hm distance position, the speed of 7.5 knots and 0.5 error, then the resulting yaw angle is 6580. Results control with fuzzy syncronized with monitoring at M&C system in visual basic. The view of the monitoring, 3 types of scenarios obtained. For the first scenario, which is created with the control on it, produces the best results of the avoidance, if compared to the second scenario, with trajectory and control anti-collision cross, and if compared with the third scenario that has no built control system with decision-making on it.

  8. Ship hull fouling in the port of Recife, Pernambuco

    Directory of Open Access Journals (Sweden)

    Cristiane Maria Rocha Farrapeira

    2007-09-01

    Full Text Available Ports of big coastal cities are exposed to exotic species as a consequence of shipping traffic. As the Port of Recife receives an annual average of 491 ships from other regions of Brazil and from all over the world, this work was aimed at knowing which marine animals were passively transported on such vessels hulls, in order to map and monitor new bioinvasions in the area. Thus, 32 vessels of several origins were investigated between November 2005 and March 2006, samples were taken and the macrofauna identified. Sixty species of associated animals were identified, consisting of 28 sessile species, particularly the Cirripedia Balanomorpha and Lepadomorpha as dominants, 8 sedentary animals, namely Mytillidae and Dreissenidae and 23 free-living species, particularly, Caprellidae, Gammaridae, Tanaidacea, Turbellaria, Nemertea and Polychaeta. The first occurrence of Conchoderma virgatum was recorded with exact location for the Brazilian littoral, and Conchoderma auritum, Amphibalanus subalbidus and Haliplanella lineata were recorded for the first time at the littoral of Pernambuco State. The invasion pathway was confirmed for Amphibalanus reticulatus and Mytilopsis leucophaeta, invader species of the estuarine area of Recife's city. Megabalanus coccopoma was considered as a risk invader species for the region.Regiões portuárias das grandes cidades litorâneas estão sujeitas à recepção de espécies exóticas como conseqüência da movimentação dos navios. Como o Porto do Recife recebe uma média anual de 491 atracações de navios, provenientes de várias regiões do Brasil e do mundo, objetivou-se conhecer quais animais marinhos eram transportados passivamente nos cascos das embarcações para mapear e monitorar novas invasões biológicas na área. Assim, foram investigados 32 barcos de diversas origens, nos meses de novembro de 2005 a março de 2006, tendo a macrofauna sido amostrada e identificada. Foram encontradas 60 espécies de animais

  9. Using waste heat of ship as energy source for an absorption refrigeration system

    International Nuclear Information System (INIS)

    Salmi, Waltteri; Vanttola, Juha; Elg, Mia; Kuosa, Maunu; Lahdelma, Risto

    2017-01-01

    Highlights: • A steady-state thermodynamic model is developed for absorption refrigeration in a ship. • Operation profile of B.Delta37 bulk carrier is used as an initial data. • Suitability of water-LiBr and ammonia-water working pairs were validated. • Coefficient of performance (COP) was studied in ISO and tropical conditions. • Estimated energy savings were 47 and 95 tons of fuel every year. - Abstract: This work presents a steady-state thermodynamic model for absorption refrigeration cycles with water-LiBr and ammonia-water working pairs for purpose of application on a ship. The coefficient of performance was studied with different generator and evaporator temperatures in ISO and tropical conditions. Absorption refrigeration systems were examined using exhaust gases, jacket water, and scavenge air as energy sources. Optimal generator temperatures for different refrigerant temperatures were found using different waste heat sources and for the absorption cycle itself. Critical temperature values (where the refrigeration power drops to zero) were defined. All of these values were used in order to evaluate the cooling power and energy production possibilities in a bulk carrier. The process data of exhaust gases and cooling water flows in two different climate conditions (ISO and tropical) and operation profiles of a B. Delta37 bulk carrier were used as initial data in the study. With the case ship data, a theoretical potential of saving of 70% of the electricity used in accommodation (AC use) compressor in ISO conditions and 61% in tropical conditions was recognized. Those estimates enable between 47 and 95 tons of annual fuel savings, respectively. Moreover, jacket water heat recovery with a water-LiBr system has the potential to provide 2.2–4.0 times more cooling power than required during sea-time operations in ISO conditions, depending on the main engine load.

  10. Allocation of ESS by interval optimization method considering impact of ship swinging on hybrid PV/diesel ship power system

    International Nuclear Information System (INIS)

    Wen, Shuli; Lan, Hai; Hong, Ying-Yi; Yu, David C.; Zhang, Lijun; Cheng, Peng

    2016-01-01

    Highlights: • An uncertainty model of PV generation on board is developed based on the experiments. • The moving and swinging of the ship are considered in the optimal ESS sizing problem. • Optimal sizing of ESS in a hybrid PV/diesel/ESS ship power system is gained by the interval optimization method. • Different cases were studied to show the significance of the proposed method considering the swinging effects on the cost. - Abstract: Owing to low efficiency of traditional ships and the serious environmental pollution that they cause, the use of solar energy and an energy storage system (ESS) in a ship’s power system is increasingly attracting attention. However, the swinging of a ship raises crucial challenges in designing an optimal system for a large oil tanker ship, which are associated with uncertainties in solar energy. In this study, a series of experiments are performed to investigate the characteristics of a photovoltaic (PV) system on a moving ship. Based on the experimental results, an interval uncertainty model of on-board PV generation is established, which considers the effect of the swinging of the ship. Due to the power balance equations, the outputs of the diesel generator and the ESS on a large oil tanker are also modeled using interval variables. An interval optimization method is developed to determine the optimal size of the ESS in this hybrid ship power system to reduce the fuel cost, capital cost of the ESS, and emissions of greenhouse gases. Variations of the ship load are analyzed using a new method, taking five operating conditions into account. Several cases are compared in detail to demonstrate the effectiveness of the proposed algorithm.

  11. Improving snow albedo processes in WRF/SSiB regional climate model to assess impact of dust and black carbon in snow on surface energy balance and hydrology over western U.S.

    OpenAIRE

    Oaida, CM; Xue, Y; Flanner, MG; Skiles, SMK; De Sales, F; Painter, TH

    2015-01-01

    © 2015. American Geophysical Union. All Rights Reserved. Two important factors that control snow albedo are snow grain growth and presence of light-absorbing impurities (aerosols) in snow. However, current regional climate models do not include such processes in a physically based manner in their land surface models. We improve snow albedo calculations in the Simplified Simple Biosphere (SSiB) land surface model coupled with the Weather Research and Forecasting (WRF) regional climate model (R...

  12. The inositol phosphatase SHIP-2 down-regulates FcγR-mediated phagocytosis in murine macrophages independently of SHIP-1

    Science.gov (United States)

    Ai, Jing; Maturu, Amita; Johnson, Wesley; Wang, Yijie; Marsh, Clay B.; Tridandapani, Susheela

    2006-01-01

    FcγR-mediated phagocytosis of IgG-coated particles is a complex process involving the activation of multiple signaling enzymes and is regulated by the inositol phosphatases PTEN (phosphatase and tensin homolog deleted on chromosome 10) and SHIP-1 (Src homology [SH2] domain-containing inositol phosphatase). In a recent study we have demonstrated that SHIP-2, an inositol phosphatase with high-level homology to SHIP-1, is involved in FcγR signaling. However, it is not known whether SHIP-2 plays a role in modulating phagocytosis. In this study we have analyzed the role of SHIP-2 in FcγR-mediated phagocytosis using independent cell models that allow for manipulation of SHIP-2 function without influencing the highly homologous SHIP-1. We present evidence that SHIP-2 translocates to the site of phagocytosis and down-regulates FcγR-mediated phagocytosis. Our data indicate that SHIP-2 must contain both the N-terminal SH2 domain and the C-terminal proline-rich domain to mediate its inhibitory effect. The effect of SHIP-2 is independent of SHIP-1, as overexpression of dominant-negative SHIP-2 in SHIP-1-deficient primary macrophages resulted in enhanced phagocytic efficiency. Likewise, specific knockdown of SHIP-2 expression using siRNA resulted in enhanced phagocytosis. Finally, analysis of the molecular mechanism of SHIP-2 down-regulation of phagocytosis revealed that SHIP-2 down-regulates upstream activation of Rac. Thus, we conclude that SHIP-2 is a novel negative regulator of FcγR-mediated phagocytosis independent of SHIP-1. (Blood. 2006;107:813-820) PMID:16179375

  13. Energy and exergy analysis of a cruise ship

    DEFF Research Database (Denmark)

    Baldi, Francesco; Ahlgren, Fredrik; Nguyen, Tuong-Van

    2015-01-01

    The shipping sector is today facing numerous challenges. Fuel prices are expected to increase in the medium - long term , and a sharp turn in environmental regulations will require several companies to switch to more expensive distillate fuels. In this context, passenger ships represent a small...... to its final use on board. To illustrate this, we perform ed an analysis of the energy and exergy flow rates of a cruise ship sailing in the Baltic Sea based on a combination of available measurements from ship operations and of mechanistic knowledge of the system . The energy analys is allows...... identifying propulsion as the main energy user (41% of the total) followed by heat (34%) and electric power (25%) generation ; the exergy analysis allow ed instead identifying the main inefficiencies of the system: exergy is primarily destroyed in all processes involving combustion (88% of the exergy...

  14. Using Face Recognition System in Ship Protection Process

    Directory of Open Access Journals (Sweden)

    Miroslav Bača

    2006-03-01

    Full Text Available The process of security improvement is a huge problem especiallyin large ships. Terrorist attacks and everyday threatsagainst life and property destroy transport and tourist companies,especially large tourist ships. Every person on a ship can berecognized and identified using something that the personknows or by means of something the person possesses. The bestresults will be obtained by using a combination of the person'sknowledge with one biometric characteristic. Analyzing theproblem of biometrics in ITS security we can conclude that facerecognition process supported by one or two traditional biometriccharacteristics can give very good results regarding ship security.In this paper we will describe a biometric system basedon face recognition. Special focus will be given to crew member'sbiometric security in crisis situation like kidnapping, robbelyor illness.

  15. NOAA Ship Nancy Foster Underway Meteorological Data, Near Real Time

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Nancy Foster Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System (SAMOS)...

  16. NOAA Ship Delaware II Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Delaware II Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic System...

  17. NOAA Ship Pisces Underway Meteorological Data, Near Real Time

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Pisces Underway Meteorological Data (Near Real Time, updated daily) are from the Shipboard Automated Meteorological and Oceanographic System (SAMOS)...

  18. Research Ship Southern Surveyor Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Research Ship Southern Surveyor Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...

  19. NOAA Ship Miller Freeman Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Miller Freeman Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic System...

  20. NOAA Ship Okeanos Explorer Underway Meteorological Data, Quality Controlled

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NOAA Ship Okeanos Explorer Underway Meteorological Data (delayed ~10 days for quality control) are from the Shipboard Automated Meteorological and Oceanographic...