WorldWideScience

Sample records for spot crab spiders

  1. Heritability of defence and life-history traits in the two-spotted spider mite

    NARCIS (Netherlands)

    Tien, N.S.H.; Sabelis, M.W.; Egas, M.

    2009-01-01

    Background: Two-spotted spider mites hide against predatory mites in a web of self-produced sticky silk. The proteins invested in this shelter may reduce investment in reproduction. Questions: Do spider mite populations harbor genetic variation for web production, thereby enabling a response to

  2. Setal morphology of grooming appendages in the spider crab, Libinia dubia.

    Science.gov (United States)

    Wortham, Jen L; LaVelle, Amanda D

    2016-08-01

    In crustaceans, grooming behaviors decrease fouling by removing debris from the exoskeleton and body structures; these grooming behaviors improve respiration, sensory reception, movement, and reproduction. Setal morphologies of the following grooming appendages in the decapod crustacean spider crab Libinia dubia are examined including the first pereiopod (cheliped), first, second, and third maxillipeds (mouthparts), and first, second, and third epipods (internal extensions of the maxillipeds). The objective of this study was to describe setal morphologies of these grooming appendages and to elucidate possible functions and efficiencies of setal structures. Spider crabs are hypothesized to have elaborate setal morphologies, mainly for cleaning specialized decorating setae as well as for cleaning inside the gill chamber, which has a higher likelihood of becoming fouled compared to other decapods such as shrimps. Fourteen setal types are documented and included several varieties of serrate and pappose setae as well as simple setae, cuspidate setae, papposerrate setae, and canoe setae. Maxillipodal epipods in the gill chamber are free of fouling, suggesting the setation on the third maxilliped protopod has an efficient functional morphology in removing debris before water enters the gill chamber. Serrate setae may function for detangling and separating structures whereas pappose setae may function for fine detailed grooming. The cheliped is the only grooming appendage that can reach decorating setae and it contains only pappose setae; thus decorating setae is not likely groomed in a manner that would greatly decrease fouling. J. Morphol. 277:1045-1061, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  3. Weak trophic links between a crab-spider and the effective pollinators of a rewardless orchid

    Science.gov (United States)

    Quintero, Carolina; Corley, Juan C.; Aizen, Marcelo A.

    2015-01-01

    Sit and wait predators hunting on flowers are considered to be exploiters of plant-pollinator mutualisms. Several studies have shown that plant-pollinator interactions can be highly susceptible to the impact of a third trophic level, via consumptive (direct) and non-consumptive (indirect) effects that alter pollinator behavior and, ultimately, plant fitness. However, most flowering plants attract a wide array of flower visitors, from which only a subset will be effective pollinators. Hence, a negative effect of an ambush predator on plant fitness should be expected only when: (i) the effective pollinators are part of the predators' diet and/or (ii) the non-consumptive effects of predator presence (e.g. dead prey) alter the behavior of effective pollinators and pollen movement among individual plants. We analyzed the direct and indirect effects of a crab-spider (Misumenops pallidus), on the pollination and reproductive success of Chloraea alpina, a Patagonian rewardless orchid. Our results indicate that most of the flower visitors do not behave as effective pollinators and most effective pollinators were not observed as prey for the crab-spider. In terms of non-consumptive effects, inflorescences with and without spiders and/or dead-prey did not vary the frequency of flower visitors, nor pollinia removal or deposition. Hence, it is not surprising that M. pallidus has a neutral effect on pollinia removal and deposition as well as on fruit and seed set. Similar to other rewardless orchids, the low reproductive success of C. alpina (∼6% fruit set) was associated with the limited number of visits by effective pollinators. Negative top-down effects of a flower-visitor predator on plant pollination may not be anticipated without studying the direct and indirect effects of this predator on the effective pollinators. In pollination systems where effective pollinators visited flowers erratically, such as in deceptive orchids, we expect weak or no effect of predators on

  4. Biological control of two-spotted spider mites using phytoseiid predators

    OpenAIRE

    Sabelis, M.W.

    1982-01-01

    The searching behaviour of individual predators of four phytoseiid species ( Phytoseiulus persimilis , Amblyseius p o tentillae , Amblyseius bibens , Metaseiulus occidentalis ) is investigated in relation to the two-spotted spider mite ( Tetranychus urticae ), which infests greenhouse roses. Especially the role of spider- mite webbing in the predator-prey relation is s...

  5. Chemical and physiological changes during the embryonic development of the spider crab, Hyas araneus L. (Decapoda: Majidae)

    OpenAIRE

    Petersen, S.; Anger, Klaus

    1997-01-01

    During embryogenesis of the spider crab, Hyas araneus, four developmental phases were distinguished microscopically: cleavage, gastrula,;embryo differentiation, prehatching phase. Changes in fresh weight (FW), dry weight (DW), ash-free dry weight (AFDW), water, carbon (C), nitrogen (N), total lipids, proteins, carbohydrates, and respiration rates were measured in developing eggs. The percentage of water increased from 52% to 87% of FW, most rapidly after the beginning of organ differentiation...

  6. Females are the brighter sex: Differences in external fluorescence across sexes and life stages of a crab spider.

    Directory of Open Access Journals (Sweden)

    Erin E Brandt

    Full Text Available Fluorescence is increasingly recognized to be widespread in nature. In particular, some arachnids fluoresce externally, and in spiders the hemolymph fluoresces. In this study, we examined the external fluorescence and the fluorophores of different sexes and life stages of the crab spider Misumena vatia (Clerk 1757, a sit-and-wait predator that feeds on insects as they visit flowers. We designed novel instrumentation to measure external fluorescence in whole specimens. We found that although males and females possess internal fluorophores with similar properties, the external expression of fluorescence varies across sexes and life stages. Spiders fluoresce brightly as immatures. Females maintain their brightness to adulthood, whereas males become increasingly dim as they mature. We suggest that external fluorescence likely contributes to visual signaling in these animals, and that it differs between the sexes as a result of differences in foraging ecology and behavior.

  7. Alternative phenotypes of male mating behaviour in the two-spotted spider mite

    NARCIS (Netherlands)

    Sato, Y.; Sabelis, M.W.; Egas, M.; Faraji, F.

    2013-01-01

    Severe intraspecific competition for mates selects for aggressive individuals but may also lead to the evolution of alternative phenotypes that do not act aggressively, yet manage to acquire matings. The two-spotted spider mite, Tetranychus urticae, shows male mate-guarding behaviour and male-male

  8. Male behavioural plasticity depends on maternal mating status in the two-spotted spider mite

    NARCIS (Netherlands)

    Oku, Keiko; Den Beuken, van Tom P.G.

    2017-01-01

    In haplodiploid organisms including the two-spotted spider mite, Tetranychus urticae (Acari: Tetranychidae), both unmated and mated females can produce male offspring. A previous study reported that males produced by unmated females (UM males) find pre-reproductive females more quickly than males

  9. Redescription of the poorly known crab spider Xysticus spasskyi (Araneae: Thomisidae).

    Science.gov (United States)

    Marusik, Yuri M; Azarkina, Galina N

    2016-09-07

    With 372 species, Xysticus C.L. Koch, 1835 is the largest genus in the family Thomisidae (WSC 2016). As with other speciose genera, the genus has never been revised on a global scale and is only thoroughly known in a few parts of the Holarctic, namely Central and Northern Europe, North America, Israel and Japan. Over 200 species are known from one/two taxonomic references only, or from a single illustrated description/redescription (WSC 2016). The fact that 40% of species are known from only one sex (104 females and 54 males) or from juveniles (8 species) (WSC 2016) suggests that Xysticus requires revision. During a study of crab spiders of the Caucasus, we experienced difficulties in identifying Xysticus spasskyi Utochkin, 1968 due to the lack of detailed figures of the male palp and female epigyne. This species was based on the holotype female collected from an unspecified locality in the coastal part of modern Kransnodar Province (Utochkin 1968). The male of X. spasskyi was described as X. umbrinus Utochkin, 1968 from Kuban' Region (currently Krasnodar Province). The two species were synonymised by Ovtsharenko (1979). Besides Krasnodar Province, the species has been reported from North Ossetia (Ponomarev & Komarov 2013) and South Ossetia (Ponomarev & Komarov 2015), Georgia, Azerbaijan and the Crimea (Mikhailov 2013; Otto 2015). The illustrations in the descriptions of Utochkin (1968) and Ovtsharenko (1979), are either very small, schematic or provide no diagnostic details. The endogyne (=vulva) of this species has never been illustrated. Here we redescribe this species and compare distant populations.

  10. Impact of anthropogenic ocean acidification on thermal tolerance of the spider crab Hyas araneus

    Directory of Open Access Journals (Sweden)

    H. O. Pörtner

    2009-10-01

    Full Text Available Future scenarios for the oceans project combined developments of CO2 accumulation and global warming and their impact on marine ecosystems. The synergistic impact of both factors was addressed by studying the effect of elevated CO2 concentrations on thermal tolerance of the cold-eurythermal spider crab Hyas araneus from the population around Helgoland. Here ambient temperatures characterize the southernmost distribution limit of this species. Animals were exposed to present day normocapnia (380 ppm CO2, CO2 levels expected towards 2100 (710 ppm and beyond (3000 ppm. Heart rate and haemolymph PO2 (PeO2 were measured during progressive short term cooling from 10 to 0°C and during warming from 10 to 25°C. An increase of PeO2 occurred during cooling, the highest values being reached at 0°C under all three CO2 levels. Heart rate increased during warming until a critical temperature (Tc was reached. The putative Tc under normocapnia was presumably >25°C, from where it fell to 23.5°C under 710 ppm and then 21.1°C under 3000 ppm. At the same time, thermal sensitivity, as seen in the Q10 values of heart rate, rose with increasing CO2 concentration in the warmth. Our results suggest a narrowing of the thermal window of Hyas araneus under moderate increases in CO2 levels by exacerbation of the heat or cold induced oxygen and capacity limitation of thermal tolerance.

  11. Protocols for the delivery of small molecules to the two-spotted spider mite, Tetranychus urticae.

    Directory of Open Access Journals (Sweden)

    Takeshi Suzuki

    Full Text Available The two-spotted spider mite, Tetranychus urticae, is a chelicerate herbivore with an extremely wide host range and an extraordinary ability to develop pesticide resistance. Due to its responsiveness to natural and synthetic xenobiotics, the spider mite is becoming a prime pest herbivore model for studies of the evolution of host range, plant-herbivore interactions and mechanisms of xenobiotic resistance. The spider mite genome has been sequenced and its transcriptional responses to developmental and various biotic and abiotic cues have been documented. However, to identify biological and evolutionary roles of T. urticae genes and proteins, it is necessary to develop methods for the efficient manipulation of mite gene function or protein activity. Here, we describe protocols developed for the delivery of small molecules into spider mites. Starting with mite maintenance and the preparation of the experimental mite populations of developmentally synchronized larvae and adults, we describe 3 methods for delivery of small molecules including artificial diet, leaf coating, and soaking. The presented results define critical steps in these methods and demonstrate that they can successfully deliver tracer dyes into mites. Described protocols provide guidelines for high-throughput setups for delivery of experimental compounds that could be used in reverse genetics platforms to modulate gene expression or protein activity, or for screens focused on discovery of new molecules for mite control. In addition, described protocols could be adapted for other Tetranychidae and related species of economic importance such as Varroa, dust and poultry mites.

  12. Consistent habitat segregation between sexes in the spider crabs Maja brachydactyla and Maja squinado (Brachyura, as revealed by stable isotopes

    Directory of Open Access Journals (Sweden)

    Guillermo Guerao

    2016-03-01

    Full Text Available Differences in the resource use patterns of males and females of the spider crab species Maja brachydactyla Balss, 1922 and M. squinado (Herbst, 1788 from several geographic areas (three in the Atlantic and two in the Mediterranean were studied through the analysis of stable isotopes of carbon and nitrogen in the exoskeleton of post-pubertal (adult specimens. Results confirmed that males and females from the same population usually did not differ in δ15N values and hence foraged at the same trophic level. In contrast, females were usually enriched in 13C as compared with males from the same population, thus suggesting that females use shallower habitats than males before the terminal moult. The results reported here also indicate that stable isotop.

  13. Mud crab susceptibility to disease from white spot syndrome virus is species-dependent

    Directory of Open Access Journals (Sweden)

    Sritunyalucksana Kallaya

    2010-11-01

    Full Text Available Abstract Background Based on a report for one species (Scylla serrata, it is widely believed that mud crabs are relatively resistant to disease caused by white spot syndrome virus (WSSV. We tested this hypothesis by determining the degree of susceptibility in two species of mud crabs, Scylla olivacea and Scylla paramamosain, both of which were identified by mitochondrial 16 S ribosomal gene analysis. We compared single-dose and serial-dose WSSV challenges on S. olivacea and S. paramamosain. Findings In a preliminary test using S. olivacea alone, a dose of 1 × 106 WSSV copies/g gave 100% mortality within 7 days. In a subsequent test, 17 S. olivacea and 13 S. paramamosain were divided into test and control groups for challenge with WSSV at 5 incremental, biweekly doses starting from 1 × 104 and ending at 5 × 106 copies/g. For 11 S. olivacea challenged, 3 specimens died at doses between 1 × 105 and 5 × 105 copies/g and none died for 2 weeks after the subsequent dose (1 × 106 copies/g that was lethal within 7 days in the preliminary test. However, after the final challenge on day 56 (5 × 106 copies/g, the remaining 7 of 11 S. olivacea (63.64% died within 2 weeks. There was no mortality in the buffer-injected control crabs. For 9 S. paramamosain challenged in the same way, 5 (55.56% died after challenge doses between 1 × 104 and 5 × 105 copies/g, and none died for 2 weeks after the challenge dose of 1 × 106 copies/g. After the final challenge (5 × 106 copies/g on day 56, no S. paramamosain died during 2 weeks after the challenge, and 2 of 9 WSSV-infected S. paramamosain (22.22% remained alive together with the control crabs until the end of the test on day 106. Viral loads in these survivors were low when compared to those in the moribund crabs. Conclusions S. olivacea and S. paramamosain show wide variation in response to challenge with WSSV. S. olivacea and S. paramamosain are susceptible to white spot disease, and S. olivacea is more

  14. Mud crab susceptibility to disease from white spot syndrome virus is species-dependent.

    Science.gov (United States)

    Somboonna, Naraporn; Mangkalanan, Seksan; Udompetcharaporn, Attasit; Krittanai, Chartchai; Sritunyalucksana, Kallaya; Flegel, Tw

    2010-11-20

    Based on a report for one species (Scylla serrata), it is widely believed that mud crabs are relatively resistant to disease caused by white spot syndrome virus (WSSV). We tested this hypothesis by determining the degree of susceptibility in two species of mud crabs, Scylla olivacea and Scylla paramamosain, both of which were identified by mitochondrial 16 S ribosomal gene analysis. We compared single-dose and serial-dose WSSV challenges on S. olivacea and S. paramamosain. In a preliminary test using S. olivacea alone, a dose of 1 × 106 WSSV copies/g gave 100% mortality within 7 days. In a subsequent test, 17 S. olivacea and 13 S. paramamosain were divided into test and control groups for challenge with WSSV at 5 incremental, biweekly doses starting from 1 × 104 and ending at 5 × 106 copies/g. For 11 S. olivacea challenged, 3 specimens died at doses between 1 × 105 and 5 × 105 copies/g and none died for 2 weeks after the subsequent dose (1 × 106 copies/g) that was lethal within 7 days in the preliminary test. However, after the final challenge on day 56 (5 × 106 copies/g), the remaining 7 of 11 S. olivacea (63.64%) died within 2 weeks. There was no mortality in the buffer-injected control crabs. For 9 S. paramamosain challenged in the same way, 5 (55.56%) died after challenge doses between 1 × 104 and 5 × 105 copies/g, and none died for 2 weeks after the challenge dose of 1 × 106 copies/g. After the final challenge (5 × 106 copies/g) on day 56, no S. paramamosain died during 2 weeks after the challenge, and 2 of 9 WSSV-infected S. paramamosain (22.22%) remained alive together with the control crabs until the end of the test on day 106. Viral loads in these survivors were low when compared to those in the moribund crabs. S. olivacea and S. paramamosain show wide variation in response to challenge with WSSV. S. olivacea and S. paramamosain are susceptible to white spot disease, and S. olivacea is more susceptible than S. paramamosain. Based on our single

  15. The effects of trophic transfer and environmental factors on microplastic uptake by plaice, Pleuronectes plastessa, and spider crab, Maja squinado.

    Science.gov (United States)

    Welden, Natalie Ann; Abylkhani, Bexultan; Howarth, Leigh Michael

    2018-04-16

    Microplastic pollution is apparent throughout the marine environment from deep ocean sediments to coastal habitats. Most of this is believed to originate on land, although marine activities, such as fishing and shipping, also contribute to the release and redistribution of microplastic. The relative importance of these maritime plastic sources, the manner by which they are distributed in the environment, and their effect on uptake by marine organisms are yet to be fully quantified. In this study, the relative impact of fishing activities on microplastic uptake by demersal fish and crustaceans was explored. Local fishing intensity, proximity to land and mean water velocity are compared to microplastic uptake in plaice, Pleuronectes platessa, and spider crab, Maja squinado, from the Celtic Sea. Observations were also made of microplastic contamination in ingested sand eels, Ammodytes tobianus, to establish a potential route of trophic transfer. This study is the first to identify microplastic contamination in spider crab and to document trophic transfer in the wild. Individuals were sampled from sites of varied fishing intensity in the Celtic Sea, and their stomach contents examined for the presence of microplastic. Contamination was observed in 50% of P. platessa, 42.4% of M. squinado, and 44.4% of A. tobianus. Locations of highest plastic abundance varied between P. platessa and M. squinado, indicating that different factors influence the uptake of microplastic in these two taxa. No significant link was observed between fishing effort and microplastic abundance; however, proximity to land was linked to increased abundance in M. squinado and Observations of whole prey demonstrate ongoing trophic transfer from A. tobianus to P. platessa. The lack of significant difference in microplastic abundance between predator and prey suggests that microplastic is not retained by P. platessa. Copyright © 2018 Elsevier Ltd. All rights reserved.

  16. Genetic diversity within and among two-spotted spider mite resistant and susceptible common bean genotypes

    Directory of Open Access Journals (Sweden)

    Zeinab YOUSEFI

    2017-12-01

    Full Text Available Two-spotted spider mite (Tetranychus urticae C. L. Koch, 1836, is one of the most destructive herbivores of common bean. Very little is known about the diversity among resistant sources in this crop. The present study was conducted to characterize 22 resistant and susceptible common bean genotypes by 8 Simple Sequence Repeats (SSRs and 8 Random Amplified Polymorphic DNA (RAPD markers. These SSR and RAPD primers produced 100 % and 81.8 % polymorphic bands. Based on RAPD fingerprints and SSR profiles, pairwise genetic similarity ranged from 0.0 to 0.857 and from 0.125 to 1, respectively. The resistant and susceptible common bean accessions were grouped together in the dendrograms generated from RAPD and SSR clustering analyses. The results indicate that RAPD and SSR analysis could be successfully used for the estimation of genetic diversity among genotypes. SSR markers could group genotypes according to their resistibility and susceptibility to the spotted spider mite but RAPD could not. Therefore, the SSR markers can facilitate the development of resistant common bean cultivars through breeding programs against T. urticae.

  17. Application of Two-spotted Spider Mite Tetranychus urticae for Plant-pest Interaction Studies

    Science.gov (United States)

    Negrave, Tara; Van Leeuwen, Thomas; Grbic, Vojislava; Grbic, Miodrag

    2014-01-01

    The two-spotted spider mite, Tetranychus urticae, is a ubiquitous polyphagous arthropod herbivore that feeds on a remarkably broad array of species, with more than 150 of economic value. It is a major pest of greenhouse crops, especially in Solanaceae and Cucurbitaceae (e.g., tomatoes, eggplants, peppers, cucumbers, zucchini) and greenhouse ornamentals (e.g., roses, chrysanthemum, carnations), annual field crops (such as maize, cotton, soybean, and sugar beet), and in perennial cultures (alfalfa, strawberries, grapes, citruses, and plums)1,2. In addition to the extreme polyphagy that makes it an important agricultural pest, T. urticae has a tendency to develop resistance to a wide array of insecticides and acaricides that are used for its control3-7. T. urticae is an excellent experimental organism, as it has a rapid life cycle (7 days at 27 °C) and can be easily maintained at high density in the laboratory. Methods to assay gene expression (including in situ hybridization and antibody staining) and to inactivate expression of spider mite endogenous genes using RNA interference have been developed8-10. Recently, the whole genome sequence of T. urticae has been reported, creating an opportunity to develop this pest herbivore as a model organism with equivalent genomic resources that already exist in some of its host plants (Arabidopsis thaliana and the tomato Solanum lycopersicum)11. Together, these model organisms could provide insights into molecular bases of plant-pest interactions. Here, an efficient method for quick and easy collection of a large number of adult female mites, their application on an experimental plant host, and the assessment of the plant damage due to spider mite feeding are described. The presented protocol enables fast and efficient collection of hundreds of individuals at any developmental stage (eggs, larvae, nymphs, adult males, and females) that can be used for subsequent experimental application. PMID:25046103

  18. Alternative phenotypes of male mating behaviour in the two-spotted spider mite.

    Science.gov (United States)

    Sato, Yukie; Sabelis, Maurice W; Egas, Martijn; Faraji, Farid

    2013-09-01

    Severe intraspecific competition for mates selects for aggressive individuals but may also lead to the evolution of alternative phenotypes that do not act aggressively, yet manage to acquire matings. The two-spotted spider mite, Tetranychus urticae, shows male mate-guarding behaviour and male-male combat for available females. This may provide opportunity for weaker males to avoid fighting by adopting alternative mating behaviour such as sneaker or satellite tactics as observed in other animals. We investigated male precopulatory behaviour in the two-spotted spider mite by means of video-techniques and found three types of male mating behaviour: territorial, sneaker and opportunistic. Territorial and sneaker males associate with female teleiochrysales and spend much time guarding them. Territorial males are easily disturbed by rival males and engage themselves in fights with them. However, sneaker males are not at all disturbed by rival males, never engage in fights and, strikingly, never face attack by territorial males. Opportunistic males wander around in search of females that are in the teleiochrysalis stage but very close to or at emergence. To quickly classify any given mate-guarding male as territorial or sneaker we developed a method based on the instantaneous response of males to disturbance by a live male mounted on top of a brush. We tested this method against the response of the same males to natural disturbance by two or three other males. Because this method proved to be successful, we used it to collect territorial and sneaker males, and subjected them to morphological analysis to assess whether the various behavioural phenotypes are associated with different morphological characters. However, we found no statistical differences between territorial and sneaker males, concerning the length of the first legs, the stylets, the pedipalps or the body.

  19. Stably expressed housekeeping genes across developmental stages in the two-spotted spider mite, Tetranychus urticae.

    Science.gov (United States)

    Yang, Chunxiao; Pan, Huipeng; Liu, Yong; Zhou, Xuguo

    2015-01-01

    Quantitative real-time PCR (qRT-PCR) is a reliable and reproducible technique for measuring mRNA expression. To facilitate gene expression studies and obtain more accurate qRT-PCR analysis, normalization relative to stable housekeeping genes is mandatory. In this study, ten housekeeping genes, including beta-actin (Actin) , elongation factor 1 α (EF1A) , glyceralde hyde-3-phosphate dehydrogenase (GAPDH) , ribosomal protein L13 (RPL13) , ribosomal protein 49 (RP49) , α-tubulin (Tubulin) , vacuolar-type H+-ATPase (v-ATPase) , succinate dehydrogenase subunit A (SDHA) , 28S ribosomal RNA (28S) , and 18S ribosomal RNA (18S) from the two-spotted spider mite, Tetranychus urticae, were selected as the candidate reference genes. Four algorithms, geNorm, Normfinder, BestKeeper, and the ΔCt method, were used to evaluate the performance of these candidates as endogenous controls across different developmental stages. In addition, RefFinder, which integrates the above-mentioned software tools, provided the overall ranking of the stability/suitability of these candidate reference genes. Among them, PRL13 and v-ATPase were the two most stable housekeeping genes across different developmental stages. This work is the first step toward establishing a standardized qRT-PCR analysis in T. urticae following the MIQE guideline. With the recent release of the T. urticae genome, results from this study provide a critical piece for the subsequent genomics and functional genomics research in this emerging model system.

  20. A new large oregoniid spider crab of the genus Pleistacantha Miers, 1879, from the Bay of Bengal, India (Crustacea, Brachyura, Majoidea

    Directory of Open Access Journals (Sweden)

    Peter K. L. Ng

    2017-11-01

    Full Text Available A new species of deep-water oregoniid spider crab of the genus Pleistacantha Miers, 1879, is described from the Indian Ocean. The species is distinct in possessing a prominently inflated carapace in which the median parts of the branchial regions almost meet. It can also be distinguished from its closest congeners, P. moseleyi (Miers, 1885, P. pungens (Wood-Mason, in Wood-Mason and Alcock 1891, and P. ori Ahyong & Ng, 2007, in its more elongate and less spinose chelipeds and ambulatory legs, shorter third maxilliped, trapezoidal male pleon and a male first gonopod which is relatively stout with a short subdistal dorsal papilla.

  1. Post-larval development and sexual dimorphism of the spider crab Maja brachydactyla (Brachyura: Majidae

    Directory of Open Access Journals (Sweden)

    Guillermo Guerao

    2009-12-01

    Full Text Available The post-larval development of the majid crab Maja brachydactyla Balss, 1922 was studied using laboratory-reared larvae obtained from adult individuals collected in the NE Atlantic. The morphology of the first juvenile stage is described in detail, while the most relevant morphological changes and sexual differentiation are highlighted for subsequent juvenile stages, until juvenile 8. The characteristic carapace spines of the adult phase are present in the first juvenile stage, though with great differences in the degree of development and relative size. The carapace shows a high length/weight ratio, which becomes similar to that of adults at stage 7-8. Males and females can be distinguished from juvenile stage 4, based on sexual dimorphism in the pleopods and the presence of gonopores. In addition, the allometric growth of the pleon is sex-dependent from juvenile stage 4, with females showing a positive allometry (b=1.23 and males an isometric allometry (b=1.02.

  2. Evaluation of airborne methyl salicylate for improved conservation biological control of two-spotted spider mite and hop aphid in Oregon hop yards

    Science.gov (United States)

    The use of synthetic herbivore-induced plant volatiles (HIPV) to attract natural enemies has received interest as a tool to enhance conservation biological control (CBC). Methyl salicylate (MeSA) is a HIPV that is attractive to several key predators of two-spotted spider mite, Tetranychus urticae K...

  3. Evaluation of airborne methyl salicylate for improved conservation biological control of two-spotted spider mites and hop aphid in Oregon hop yards

    Science.gov (United States)

    The use of synthetic herbivore-induced plant volatiles (HIPV) to attract natural enemies has received interest as a tool to enhance conservation biological control (CBC). Methyl salicylate (MeSA) is a HIPV that is attractive to several key predators of two-spotted spider mite, Tetranychus urticae K...

  4. Vitamin A deficiency modifies response of predatory mite Amblyseius potentillae to volatile kairomone of two-spotted spider mite, Tetranychus urticae.

    NARCIS (Netherlands)

    Dicke, M.; Sabelis, M.W.; Groeneveld, A.

    1986-01-01

    volatile kairomone of the two-spotted spider mite,Tetranychus urticae, elicits a searching response of the phytoseiid predatorAmblyseius potentillae, only when the predator is reared on a carotenoid-free diet. However, after addition of crystalline betta-carotene or vitamin A acetate to the

  5. Confirmation of Neozygites floridana azygospore formation in two-spotted spider mite (Tetranychus urticae) in strains from tropical and temperature regions

    Science.gov (United States)

    Neozygites floridana is an obligate fungal pathogen of mites in the family Tetranychidae and is an important natural enemy of the two-spotted spider mite (Tetranychus urticae). Until now, information about the formation of azygospores remained to be fully confirmed. In this study, we document the fo...

  6. Temperature-Dependent Fumigant Toxicity of Some Essential Oils and Their Main Constituents Against Two-Spotted Spider Mite, Tetranychus urticae

    Science.gov (United States)

    Fumigant toxicity assays of 34 commercial essential oils were conducted on female adults and eggs of the two-spotted spider mite (TSM) at 3 temperatures (5, 15, 25 deg C). Common thyme and cinnamon oils resulted in > or = 90% mortality of adults at 5 and 10 uL/L air at 25 deg C. At 15 deg C, lemongr...

  7. Fecundity of the spider crab Mithraculus forceps (Decapoda, Mithracidae from the northeastern coast of the state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Valter J. Cobo

    2008-03-01

    Full Text Available Fecundity is one of the most important parameters in studying the reproductive output of Pleocyemata decapods, especially because of its relationship to the efficiency of population replacement. Knowledge of fecundity provides basic elements for understanding the reproductive strategies, dynamics, and evolution of a given population. The present investigation provides informations on fecundity, egg size, egg loss, and the relationship between fecundity and selected environmental features, for the spider crab Mithraculus forceps (A. Milne Edwards, 1875. Ovigerous crabs were collected each month during 2000, by SCUBA diving, at Couves Island (23º25'25"S, 44º52'03"W on the northeastern coast of the state of São Paulo, Brazil. A total of 40 ovigerous females with egg in early development (initial stage and 28 final stage eggs were obtained and analyzed. Mean fecundity, from eggs of the initial stage, was 402.8 ± 240.1 eggs, ranging from 60 to 1,123 eggs. Sizes of females ranged from 9.4 to 14.0 mm carapace width. Mean egg size was 0.56 ± 0.06 mm diameter. A 20.33% rate of egg loss was estimated by comparing the fecundities of batches of eggs in early and late development (40 initial batches and 28 final stages batches. There were no significant relationships between the water temperature or salinity and variations in fecundity. As in most brachyuran species, M. forceps showed a strong conservative relationship between fecundity and body size.

  8. Histopathological and molecular insights into the ovicidal activities of two entomopathogenic fungi against two-spotted spider mite.

    Science.gov (United States)

    Zhang, Lei; Shi, Wei-Bing; Feng, Ming-Guang

    2014-03-01

    Entomopathogenic fungi can infect and kill spider mite eggs but their ovicidal activities are poorly understood. Here we gain histopathogenical and molecular insights into the ovicidal activities of Beauveria bassiana and Isaria fumosorosea against the two-spotted spider mite, Tetranychus urticae. Scanning electronic microscopy indicated successful adhesion and germination of fungal conidia on egg shell at 24h post-spray (HPS). Germ tubes of both fungi could penetrate into egg shell with penetration pegs at 48 HPS. Interestingly, the germ tubes of B. bassiana may elongate on egg surface to locate appropriate sites for penetration, acting as 'searching' hyphae. Aside from the normal penetration, the germ tubes of I. fumosorosea can be completely or partially embedded into egg shell for a distance of extension, forming shell humps. Light microscopy of ultrathin sections of infected eggs showed shrunken (affected) or disrupted embryos at 48-96 HPS despite little effect on egg cleavage at 24 HPS. However, distinguishable hyphal cells were hardly found inside the embryos lacking oxygen although fungal outgrowths were abundant on unhatched (killed) eggs. In PCR with specific probes, the 18S rDNA signals of B. bassiana (412 bp) and I. fumosorosea (454 bp) in the DNA extracts from surface-cleaned mite eggs increased at 0-96 HPS, confirming fungal colonization in the infected eggs. We consider that the colonization on shell surface and underside could rely upon extending hyphae for uptake of egg nutrition, resulting in embryo disruption. Our observations add knowledge to microbial control of spider mites. Copyright © 2014 Elsevier Inc. All rights reserved.

  9. Acaricidal and oviposition deterring effects of santalol identified in sandalwood oil against two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae)

    OpenAIRE

    Roh, Hyun Sik; Lim, Eu Gene; Kim, Jinwoo; Park, Chung Gyoo

    2011-01-01

    Thirty-four plant essential oils were screened for their acaricidal and oviposition deterrent activities against two-spotted spider mite (TSSM), Tetranychus urticae Koch (Acari: Tetranychidae), in the laboratory using a leaf-dip bioassay. From initial trials, sandalwood and common thyme oils were observed to be the most effective against TSSM adult females. Subsequent trials confirmed that only sandalwood oil was significantly active (87.2???2.9% mortality) against TSSM adult females. Sandalw...

  10. First report of predation on floral visitors by crab spiders on Croton selowii Baill. (Euphorbiaceae Primeiro registro de predação de visitantes florais por aranhas-caranguejo em Croton selowii Baill. (Euphorbiaceae

    Directory of Open Access Journals (Sweden)

    Reinaldo Rodrigo Novo

    2010-06-01

    Full Text Available In the literature it has been extensively mentioned that crab spiders (Araneae: Thomisidae prey on floral visitors of several plant species. Here we present observations of Croton selowii Baill. (Euphorbiaceae, a monoecious species harboring individuals of crab spiders in an area of coastal vegetation of Pernambuco state, Brazil. The species is visited by several invertebrate orders, and some of them were preyed upon by the spiders, mainly Diptera species. The spiders rubbed the forelimbs within the flowers, which may constitute a strategy to camouflage these structures. Croton selowii seems to represent a suitable foraging site for the spiders, because it has a generalist pollination system (thus being visited by a wide range of invertebrate species and blooms in a period of low flower resource availability in the area.Na literatura tem sido amplamente registrado que aranhas Thomisidae predam visitantes florais de várias espécies de planta. Neste estudo nós apresentamos observações de Croton selowii Baill. (Euphorbiaceae, uma espécie monóica, abrigando aranhas Thomisidae em uma área de restinga de Pernambuco, Brasil. A espécie é visitada por invertebrados de várias ordens e vários deles são predados pelas aranhas, principalmente espécies de Diptera. As aranhas apresentaram um comportamento de esfregar as pernas dianteiras dentro das flores, o que pode ser interpretado como uma estratégia de camuflagem das pernas. Croton selowii parece representar um bom sítio de forrageamento para essas aranhas, pois possui um sistema de polinização generalista, sendo visitado por ampla gama de invertebrados e floresce em um período de baixa disponibilidade de flores na área.

  11. Acaricide resistance mechanisms in the two-spotted spider mite Tetranychus urticae and other important Acari: a review.

    Science.gov (United States)

    Van Leeuwen, Thomas; Vontas, John; Tsagkarakou, Anastasia; Dermauw, Wannes; Tirry, Luc

    2010-08-01

    The two-spotted spider mite Tetranychus urticae Koch is one of the economically most important pests in a wide range of outdoor and protected crops worldwide. Its control has been and still is largely based on the use of insecticides and acaricides. However, due to its short life cycle, abundant progeny and arrhenotokous reproduction, it is able to develop resistance to these compounds very rapidly. As a consequence, it has the dubious reputation to be the"most resistant species" in terms of the total number of pesticides to which populations have become resistant, and its control has become problematic in many areas worldwide. Insecticide and acaricide resistance has also been reported in the ectoparasite Sarcoptes scabiei, the causative organism of scabies, and other economically important Acari, such as the Southern cattle tick Rhipicephalus microplus, one of the biggest arthropod threats to livestock, and the parasitic mite Varroa destructor, a major economic burden for beekeepers worldwide. Although resistance research in Acari has not kept pace with that in insects, a number of studies on the molecular mechanisms responsible for the resistant phenotype has been conducted recently. In this review, state-of-the-art information on T. urticae resistance, supplemented with data on other important Acari has been brought together. Considerable attention is given to the underlying resistance mechanisms that have been elucidated at the molecular level. The incidence of bifenazate resistance in T. urticae is expanded as an insecticide resistance evolutionary paradigm in arthropods. Copyright © 2010 Elsevier Ltd. All rights reserved.

  12. Development and characterization of bioactive edible films from spider crab (Maja crispata) chitosan incorporated with Spirulina extract.

    Science.gov (United States)

    Balti, Rafik; Mansour, Mohamed Ben; Sayari, Nadhem; Yacoubi, Lamia; Rabaoui, Lotfi; Brodu, Nicolas; Massé, Anthony

    2017-12-01

    Active food packaging films based on crab chitosan and Spirulina extract (SE) were developed. The effects of the SE incorporation at different levels on physical (color, opacity water vapor and oxygen permeability) and mechanical (tensile strength and elongation at break) properties of chitosan films were investigated. FTIR was carried out to observe the potential modifications of the chitosan films when incorporated with SE. The obtained results suggested that incorporation of SE into chitosan films improved mechanical and barrier properties. The antioxidant activity of the chitosan/SE films was characterized by means of three different analytical assays (DPPH, FRAP and FIC). Crab chitosan edible films containing SE showed higher antioxidant activity, regardless concentrations and methods assayed. Furthermore, the antioxidant activity occurred in a concentration-dependent manner. The agar disc diffusion method was used to determine the antibacterial activities of chitosan edible films against Escherichia coli, Staphylococcus aureus, Pseudomonas aeruginosa, Listeria monocytogenes, Salmonella typhimurium, Bacillus subtilis and Bacillus cereus. The chitosan/SE films were more effective (pedible films incorporated with SE showed great potential to be used for active food packaging due to its excellent antioxidant and antibacterial activities. Copyright © 2017 Elsevier B.V. All rights reserved.

  13. Effect of different temperatures on consumption of two spotted spider mite, Tetranychus urticae, eggs by the predatory thrips, Scolothrips longicornis

    DEFF Research Database (Denmark)

    Pakyari, Hajar; Enkegaard, Annie

    2012-01-01

    Environmental variables such as temperature are important factors affecting the efficacy of biological control agents. This study evaluated the predation rate of the predatory thrips Scolothrips longicornis Priesner (Thysanoptera: Thripidae) against the two-spotted spider mite Tetranychus urticae...... Koch (Acari: Tetranychidae) under laboratory conditions. Based on daily and total prey consumption of different life stages of S. longicornis on spider mite eggs at temperatures covering the range suitable for development and survival of the predator (15º C to 37º C, 60 ± 10% RH, 16:8 L......:D), there was a significant effect of temperature on prey consumption. The number of prey consumed daily by first and second instar larvae increased linearly with increasing temperature from 15 ºC to 37 ºC, whereas daily consumption of preovipositing and postovipositing females was uninfluenced by temperature. Lower...

  14. Acaricidal and quantitative structure activity relationship of monoterpenes against the two-spotted spider mite, Tetranychus urticae.

    Science.gov (United States)

    Badawy, Mohamed E I; El-Arami, Sailan A A; Abdelgaleil, Samir A M

    2010-11-01

    The acaricidal activity of 12 monoterpenes against the two-spotted spider mite, Tetranychus urticae Koch, was examined using fumigation and direct contact application methods. Cuminaldehyde and (-)-linalool showed the highest fumigant toxicity with LC(50) = 0.31 and 0.56 mg/l, respectively. The other monoterpenes exhibited a strong fumigant toxicity, the LC(50) values ranging from 1.28 to 8.09 mg/l, except camphene, which was the least effective (LC(50) = 61.45 mg/l). Based on contact activity, the results were rather different: menthol displayed the highest acaricidal activity (LC(50) = 128.53 mg/l) followed by thymol (172.0 mg/l), geraniol (219.69 mg/l) and (-)-limonene (255.44 mg/l); 1-8-cineole, cuminaldehyde and (-)-linalool showed moderate toxicity. At 125 mg/l, (-)-Limonene and (-)-carvone caused the highest egg mortality among the tested compounds (70.6 and 66.9% mortality, respectively). In addition, the effect of molecular descriptors was also analyzed using the quantitative structure activity relationship (QSAR) procedure. The QSAR model showed excellent agreement between the estimated and experimentally measured toxicity parameter (LC(50)) for the tested monoterpenes and the fumigant activity increased significantly with the vapor pressure. Comparing the results of the fumigant and contact toxicity assays of monoterpenes against T. urticae with the results of acetylcholinesterase (AChE) inhibitory effect revealed that some of the tested compounds showed a strong acaricidal activity and a potent AChE inhibitory activity, such as cuminaldehyde, (-)-linalool, (-)-limonene and menthol. However, other compounds such as (-)-carvone revealed a strong fumigant activity but a weak AChE inhibitory activity.

  15. Múltiple natural enemies do not improve two spotted spider mite and flower western thrips control in strawberry tunnels

    Directory of Open Access Journals (Sweden)

    Gemma Albendín

    2015-03-01

    Full Text Available Biological control techniques are commonly used in many horticultural crops in Spain, however the application of these techniques to Spanish strawberries are relatively recent. In this study the effectiveness of augmentative biological control techniques to control the two main strawberry (Fragaria xananassa Duchesne pest: the two-spotted spider mite (TSSM, Tetranychus urticae Koch (Acari: Tetranychidae, and the western flower thrips (WFT, Frankliniella occidentalis (Pergande (Thysanoptera: Thripidae, through releases of the predatory mites Phytoseiulus persimilis Athias-Henriot, Neoseiulus californicus (McGregor, Amblyseius swirskii Athias-Henriot (Acari: Phytoseiidae, and Orius laevigatus (Fieber (Heteroptera: Anthocoridae were tested. Two-year results on the performance of treatments using combinations of these biocontrol agents are presented. In both years, all treatments resulted in the reduction of TSSM numbers; but no treatment was better than the release of P. persimilis alone (P < 0.05. TSSM suppression varied among crop phases being greater early in the season. None of the treatments reduced significantly WFT numbers (P < 0.05, and the established economic injury level (EIL was surpassed from March to late April in both years. However, EIL was surpassed less times when treatment included O. laevigatus (2009: 20.7%; 2010: 22.7% of samples. No effect of A. swirskii was observed when this mite was released. Results corroborate that biological control techniques for TSSM and WFT are feasible for high-plastic tunnel strawberries. Under the conditions in our study no additive effects were observed, and there was not advantage in the release of multiple natural enemies.

  16. Morphology and function of the reproductive tract of the spider crab Libinia spinosa (Crustacea, Brachyura, Majoidea): pattern of sperm storage

    Science.gov (United States)

    Sal Moyano, M. P.; Gavio, M. A.; Cuartas, E. I.

    2010-09-01

    Morphology and function of the male reproductive tract, female spermatheca and patterns of sperm storage were assessed in the crab Libinia spinosa using histological methods. Testes are characterized by the presence of peripheral spermatogonia and different sequences of sperm maturity. Spermatophores begin to be packed in the last portion. The vas deferens consists of three sections: anterior, with undeveloped spermatophores and free sperm; median, with well-developed spermatophores; and posterior with granular secretions. Female spermathecae are of the ventral type, with a velum separating dorsal and ventral chambers. Live individuals were kept in the laboratory and arranged in pairs. An experiment was conducted toward the end of the reproductive season, in which males with the right gonopod excised were placed with receptive females. After mating, females were killed and the spermathecae dissected for histological study and observation of the pattern of sperm storage. Spermatozoa were found forming discrete sperm packages. New ejaculates can fill the entire spermatheca or be restricted to the ventral chamber; sperm are rounded, with a distinguishable acrosomal core. Old ejaculates are restricted to the dorsal chamber and are of irregular shape and larger size; an acrosomal core was not distinguishable. The secretions produced by the glandular epithelium of the dorsal chamber of the spermathecae are likely to have a role in the removal of dead sperm.

  17. Influence of leaf pubescence on the behavior of the two-spotted spider mite (Tetranychus urticae and the European red mite (Panonychus ulmi

    Directory of Open Access Journals (Sweden)

    Wojciech Warabieda

    2013-12-01

    Full Text Available Movement behavior of two mite species: two-spotted spider mite (Tetranychus urticae and European red mite (Panonychus ulmi on leaves of some apple cultivars (´Greensleeves´, ´Spartan' and SA 455-2 selection with different density of pubescence was analysed. Assessment of the leaf pubescence density was performed using an originally developed quick method based on digital pubescence mage analysis. For P.ulmi, both stop time and average speed did not depend on kind of leaf. In contrary. T.urticae revealed higher movement activity on slight pubescent leaves compared to leaves with high leaf hair density.

  18. Can Plant Defence Mechanisms Provide New Approaches for the Sustainable Control of the Two-Spotted Spider Mite Tetranychus urticae?

    Directory of Open Access Journals (Sweden)

    Blas Agut

    2018-02-01

    Full Text Available Tetranychus urticae (T. urticae Koch is a cosmopolitan, polyphagous mite which causes economic losses in both agricultural and ornamental plants. Some traits of T. urticae hamper its management, including a short life cycle, arrhenotokous parthenogenesis, its haplodiploid sex determination system, and its extraordinary ability to adapt to different hosts and environmental conditions. Currently, the use of chemical and biological control are the major control methods used against this mite. In recent years, some studies have focused on plant defence mechanisms against herbivores. Various families of plant compounds (such as flavonoids, glucosinolates, or acyl sugars have been shown to behave as acaricides. Plants can be induced upon appropriate stimuli to increase their resistance against spider mites. This knowledge, together with the understanding of mechanisms by which T. urticae detoxifies and adapts to pesticides, may complement the control of this pest. Herein, we describe plant volatile compounds (VOCs with repellent activity, and new findings about defence priming against spider mites, which interfere with the T. urticae performance. The use of VOCs and defence priming can be integrated into current management practices and reduce the damage caused by T. urticae in the field by implementing new, more sustainable crop management tools.

  19. Acaricidal and oviposition deterring effects of santalol identified in sandalwood oil against two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae).

    Science.gov (United States)

    Roh, Hyun Sik; Lim, Eu Gene; Kim, Jinwoo; Park, Chung Gyoo

    2011-12-01

    Thirty-four plant essential oils were screened for their acaricidal and oviposition deterrent activities against two-spotted spider mite (TSSM), Tetranychus urticae Koch (Acari: Tetranychidae), in the laboratory using a leaf-dip bioassay. From initial trials, sandalwood and common thyme oils were observed to be the most effective against TSSM adult females. Subsequent trials confirmed that only sandalwood oil was significantly active (87.2 ± 2.9% mortality) against TSSM adult females. Sandalwood oil also demonstrated oviposition deterring effects based on a 89.3% reduction of the total number of eggs on leaf disks treated with the oil. GC-MS analysis revealed that the main components of the sandalwood oil were α-santalol (45.8%), β-santalol (20.6%), β-sinensal (9.4%), and epi-β-santalol (3.3%). A mixture of α- and β-santalol (51.0:22.9, respectively) produced significantly higher mortality (85.5 ± 2.9%) and oviposition deterrent effects (94.7% reduction in the number of eggs) than the control. Phytotoxicity was not shown on rose shoots to which a 0.1% solution of sandalwood oil was applied.

  20. Checklist of spider fauna of FR Peshawar, FATA, Pakistan

    Directory of Open Access Journals (Sweden)

    F. Perveen

    2012-03-01

    Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

  1. Abundance, Genetic Diversity and Persistence of Metarhizium Spp. Fungi from Soil of Strawberry Crops and Their Potential as Biological Control Agents against the Two-Spotted Spider Mite Tetranychus urticae

    DEFF Research Database (Denmark)

    Castro, Thiago Rodriguesde

    The growing demand for strawberries has imposed challenges, especially regarding the control of pests. Many farmers report problems with reduced chemical control efficiency, probably due to selection of resistant populations of insects and mites. An alternative is the use of biological control...... using pathogenic fungi as a tool in integrated pest management. Metarhizium spp. (Hypocreales: Clavicipitaceae) are generalist entomopathogenic fungi with worldwide distribution and can cause diseases in a large number of hosts. Many studies on the development of Metarhizium as a biological control...... the two spotted spider mite, Tetranychus urticae. The applied isolates of M. anisopliae (ESALQ1037) and M. robertsii (ESALQ1426) were able to persist for up to 12 months after the application within the soil, and disperse to other plots and colonize the rhizosphere of strawberry plants. In the plots where...

  2. SPIDER SILK

    Directory of Open Access Journals (Sweden)

    PORAV Viorica

    2014-05-01

    Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

  3. On the misidentification of a common sandy beach crab belonging to ...

    African Journals Online (AJOL)

    1992-07-09

    Jul 9, 1992 ... DU PREEZ, H.H. & MCLACHLAN, A. 1984c. Biology of the three-spot swimming crab, Ovalipes puncta/us (De Haan) D. Growth and moulting. Crustaceana. 47: 113-120. DU PREFZ, H.H. & MCLACHLAN, A. 1984d. Biology of the three-spot swimming crab, Ovalipes puncta/us (De Haan) DI. Reproduction ...

  4. Learned predation risk management by spider mites

    Directory of Open Access Journals (Sweden)

    Thomas eHackl

    2014-09-01

    Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

  5. Notes on spider (Theridiidae, Salticidae) predation of the harvester ant, Pogonomyrmex salinus Olsen (Hymenoptera: Formicidae: Myrmicinae), and a possible parasitoid fly (Chloropidae)

    Energy Technology Data Exchange (ETDEWEB)

    Clark, W.H. (Albertson College of Idaho, Caldwell (United States) Univ. of Idaho, Moscow (United States)); Blom, P.E. (Univ. of Idaho, Moscow (United States))

    1992-12-01

    Spiders are known predators of ants. Pressure exerted by consistent spider predation can alter the behavior of ant colonies (MacKay 1982) and may be a selective pressure contributing to the seed-harvesting behavior of Pogonomyrmex (MacKay and MacKay 1984). The authors observed the spider Euryopis formosa Banks (Araneae: Theridiidae) capture and transport workers of the harvester ant (Pogonomyrmex salinus Olsen [Hymenoptera: Formicidae, Myrmicinae]) in southeastern Idaho. Additional observations revealed a crab spider of the genus Xysticus preying on P. salinus and the presence of a chloropid fly (Incertella) that may have been parasitizing the moribund prey subdued by the spider.

  6. Cuticular antifungals in spiders: density- and condition dependence.

    Directory of Open Access Journals (Sweden)

    Daniel González-Tokman

    Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

  7. 50 CFR Table 2 to Part 680 - Crab Species Code

    Science.gov (United States)

    2010-10-01

    ... crab Paralithodes platypus. 923 Golden (brown) king crab Lithodes aequispinus. 924 Scarlet king crab... crab Chionoecetes tanneri. 934 Triangle Tanner crab Chionoecetes angulatus. 940 Korean horsehair crab...

  8. Brown Recluse Spider

    Science.gov (United States)

    ... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

  9. Spider Bites (For Parents)

    Science.gov (United States)

    ... body rash fever and chills fatigue Of a black widow spider bite: rigid, painful muscles within 8 hours no ... child was bitten by a brown recluse or black widow spider Think Prevention! Make sure garages, attics, and woodpiles ...

  10. Crab Rationalization Permit Program

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Crab Rationalization Program (Program) allocates BSAI crab resources among harvesters, processors, and coastal communities. The North Pacific Fishery Management...

  11. Spider Bites: First Aid

    Science.gov (United States)

    ... t had one in the last five years. Black widow spider You can usually identify a black widow spider by the hourglass marking on its belly. In ... in the South. Signs and symptoms of a black widow spider bite may include: At first, slight swelling and ...

  12. Salivary proteins of spider mites suppress defenses in Nicotiana benthamiana and promote mite reproduction

    NARCIS (Netherlands)

    Villarroel, C.A.; Jonckheere, W.; Alba Cano, J.M.; Glas, J.J.; Dermauw, W.; Haring, M.A.; Van Leeuwen, T.; Schuurink, R.C.; Kant, M.R.

    2016-01-01

    Spider mites (Tetranychidae sp.) are widely occurring arthropod pests on cultivated plants. Feeding by the two-spotted spider mite T. urticae, a generalist herbivore, induces a defense response in plants that mainly depends on the phytohormones jasmonic acid and salicylic acid (SA). On tomato

  13. Funnel-web spider bite

    Science.gov (United States)

    ... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

  14. Spiders in caves.

    Science.gov (United States)

    Mammola, Stefano; Isaia, Marco

    2017-04-26

    World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

  15. The Crab Nebula

    International Nuclear Information System (INIS)

    Mitton, S.

    1979-01-01

    The subject is covered in chapters, as follows: A.D.1054, a star explodes (historical account of observations of the supernova of which the Crab Nebula is the remnant); the telescope takes over (discovery and subsequent observation of the Crab Nebula); the message of the fiery remnant (detailed structure and its interpretation); the invisible nebula (electromagnetic radiation from the Crab Nebula and its interpretation); a beacon in the night (the discovery of pulsars, with special reference to the pulsar in the Crab Nebula; observation and theory); the strange world of a neutron star (theory, prediction and observation); magnetic fields and energy flow from the pulsar (stellar magnetosphere; luminosity of the nebula); how does the pulsar pulse (observation; models to explain beaming); outburst and aftermath (types of supernovae and their evolution; nucleosynthesis); supernovae and their remnants (account of observations since early records); the Crab Nebula and modern astronomy. (U.K.)

  16. Spider bite in southern Africa: diagnosis and management

    African Journals Online (AJOL)

    older specimens the red stripes and spots may have disappeared completely. The legs are evenly black. .... Africa. (Map: Ansie Dippenaar.) Fig. 6. Brown widow spider depicting consistent orange to red hourglass .... Both cholinesterase inhibitors and α-latrotoxin give rise to an increase in acetylcholine concentration in the ...

  17. Tomato whole genome transcriptional response to Tetranychus urticae identifies divergence of spider mite-induced responses between tomato and Arabidopsis

    NARCIS (Netherlands)

    Martel, C.; Zhurov, V.; Navarro, M.; Martinez, M.; Cazaux, M.; Auger, P.; Migeon, A.; Santamaria, M.E.; Wybouw, N.; Diaz, I.; Van Leeuwen, T.; Navajas, M.; Grbic, M.; Grbic, V.

    2015-01-01

    The two-spotted spider mite Tetranychus urticae is one of the most significant mite pests in agriculture, feeding on more than 1,100 plant hosts, including model plants Arabidopsis thaliana and tomato, Solanum lycopersicum. Here, we describe timecourse tomato transcriptional responses to spider mite

  18. Bat Predation by Spiders

    Science.gov (United States)

    Nyffeler, Martin; Knörnschild, Mirjam

    2013-01-01

    In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

  19. The house spider genome reveals an ancient whole-genome duplication during arachnid evolution.

    Science.gov (United States)

    Schwager, Evelyn E; Sharma, Prashant P; Clarke, Thomas; Leite, Daniel J; Wierschin, Torsten; Pechmann, Matthias; Akiyama-Oda, Yasuko; Esposito, Lauren; Bechsgaard, Jesper; Bilde, Trine; Buffry, Alexandra D; Chao, Hsu; Dinh, Huyen; Doddapaneni, HarshaVardhan; Dugan, Shannon; Eibner, Cornelius; Extavour, Cassandra G; Funch, Peter; Garb, Jessica; Gonzalez, Luis B; Gonzalez, Vanessa L; Griffiths-Jones, Sam; Han, Yi; Hayashi, Cheryl; Hilbrant, Maarten; Hughes, Daniel S T; Janssen, Ralf; Lee, Sandra L; Maeso, Ignacio; Murali, Shwetha C; Muzny, Donna M; Nunes da Fonseca, Rodrigo; Paese, Christian L B; Qu, Jiaxin; Ronshaugen, Matthew; Schomburg, Christoph; Schönauer, Anna; Stollewerk, Angelika; Torres-Oliva, Montserrat; Turetzek, Natascha; Vanthournout, Bram; Werren, John H; Wolff, Carsten; Worley, Kim C; Bucher, Gregor; Gibbs, Richard A; Coddington, Jonathan; Oda, Hiroki; Stanke, Mario; Ayoub, Nadia A; Prpic, Nikola-Michael; Flot, Jean-François; Posnien, Nico; Richards, Stephen; McGregor, Alistair P

    2017-07-31

    The duplication of genes can occur through various mechanisms and is thought to make a major contribution to the evolutionary diversification of organisms. There is increasing evidence for a large-scale duplication of genes in some chelicerate lineages including two rounds of whole genome duplication (WGD) in horseshoe crabs. To investigate this further, we sequenced and analyzed the genome of the common house spider Parasteatoda tepidariorum. We found pervasive duplication of both coding and non-coding genes in this spider, including two clusters of Hox genes. Analysis of synteny conservation across the P. tepidariorum genome suggests that there has been an ancient WGD in spiders. Comparison with the genomes of other chelicerates, including that of the newly sequenced bark scorpion Centruroides sculpturatus, suggests that this event occurred in the common ancestor of spiders and scorpions, and is probably independent of the WGDs in horseshoe crabs. Furthermore, characterization of the sequence and expression of the Hox paralogs in P. tepidariorum suggests that many have been subject to neo-functionalization and/or sub-functionalization since their duplication. Our results reveal that spiders and scorpions are likely the descendants of a polyploid ancestor that lived more than 450 MYA. Given the extensive morphological diversity and ecological adaptations found among these animals, rivaling those of vertebrates, our study of the ancient WGD event in Arachnopulmonata provides a new comparative platform to explore common and divergent evolutionary outcomes of polyploidization events across eukaryotes.

  20. Tarantula spider bite

    Science.gov (United States)

    ... spider belongs, contains the largest number of venomous species known. This article is for information only. DO ... Wash the area with soap and water. Place ice (wrapped in a clean cloth or other covering) ...

  1. Black widow spider

    Science.gov (United States)

    ... spider belongs, contains the largest number of venomous species known. This article is for information only. DO ... Clean the area with soap and water. Wrap ice in a clean cloth and place it on ...

  2. Space spider crane

    Science.gov (United States)

    Macconochie, Ian O. (Inventor); Mikulas, Martin M., Jr. (Inventor); Pennington, Jack E. (Inventor); Kinkead, Rebecca L. (Inventor); Bryan, Charles F., Jr. (Inventor)

    1988-01-01

    A space spider crane for the movement, placement, and or assembly of various components on or in the vicinity of a space structure is described. As permanent space structures are utilized by the space program, a means will be required to transport cargo and perform various repair tasks. A space spider crane comprising a small central body with attached manipulators and legs fulfills this requirement. The manipulators may be equipped with constant pressure gripping end effectors or tools to accomplish various repair tasks. The legs are also equipped with constant pressure gripping end effectors to grip the space structure. Control of the space spider crane may be achieved either by computer software or a remotely situated human operator, who maintains visual contact via television cameras mounted on the space spider crane. One possible walking program consists of a parallel motion walking program whereby the small central body alternatively leans forward and backward relative to end effectors.

  3. Spider Spinning for Dummies

    Science.gov (United States)

    Bird, Richard S.

    Spider spinning is a snappy name for the problem of listing the ideals of a totally acyclic poset in such a way that each ideal is computed from its predecessor in constant time. Such an algorithm is said to be loopless. Our aim in these lectures is to show how to calculate a loopless algorithm for spider spinning. The calculation makes use of the fundamental laws of functional programming and the real purpose of the exercise is to show these laws in action.

  4. Company profile: Spider stories.

    Science.gov (United States)

    Giuliani, Andrea

    2008-06-01

    SpiderBiotech is a biotech company that has carried out extensive research and development on peptide-based anti-infectives, with five people involved in R&D activities and a strong network of industrial and academic partners experienced in the field of anti-infectives. SpiderBiotech has also created a proprietary library of bioactive peptides and lipopeptides (both linear and dendrimeric) active against bacterial and viral infections. At the moment they have two ongoing projects: the most advanced is focused on the development of a panel of peptide based antibiotics. The second project is related to novel antiviral drugs to treat acyclovir resistant Herpes virus infections.

  5. Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

    Directory of Open Access Journals (Sweden)

    Komposch, Christian

    2011-01-01

    Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

  6. Effects of domestic effluent discharges on mangrove crab physiology: Integrated energetic, osmoregulatory and redox balances of a key engineer species.

    Science.gov (United States)

    Theuerkauff, Dimitri; Rivera-Ingraham, Georgina A; Mercky, Yann; Lejeune, Mathilde; Lignot, Jehan-Hervé; Sucré, Elliott

    2018-03-01

    Mangroves are increasingly used as biofiltering systems of (pre-treated) domestic effluents. However, these wastewater discharges may affect local macrofauna. This laboratory study investigates the effects of wastewater exposure on the mangrove spider crab Neosarmatium meinerti, a key engineering species which is known to be affected by waste waters in effluent-impacted areas. These effects were quantified by monitoring biological markers of physiological state, namely oxygen consumption, the branchial cavity ventilation rate, gill physiology and morphology, and osmoregulatory and redox balance. Adults acclimated to clean seawater (SW, 32 ppt) and freshwater (FW, ∼0 ppt) were compared to crabs exposed to wastewater for 5 h (WW, ∼0 ppt). Spider crabs exposed to WW increased their ventilation and whole-animal respiration rates by 2- and 3-fold respectively, while isolated gill respiration increased in the animals exposed to FW (from 0.5 to 2.3 and 1.1 nmol O 2 min -1  mg DW -1 for anterior and posterior gills, respectively) but was not modified in WW-exposed individuals. WW exposure also impaired crab osmoregulatory capacity; an 80 mOsm kg -1 decrease was observed compared to FW, likely due to decreased branchial NKA activity. ROS production (DCF fluorescence in hemolymph), antioxidant defenses (superoxide dismutase and catalase activities) and oxidative damage (malondialdehyde concentration) responses varied according to animal gender. Overall, this study demonstrates that specific physiological parameters must be considered when focusing on crabs with bimodal breathing capacities. We conclude that spider crabs exposed to WW face osmoregulatory imbalances due to functional and morphological gill remodeling, which must rapidly exhaust energy reserves. These physiological disruptions could explain the ecological changes observed in the field. Copyright © 2018. Published by Elsevier B.V.

  7. Black widow spider envenomation.

    Science.gov (United States)

    Peterson, Michael E

    2006-11-01

    Black widow spiders are found throughout the continental United States and north into the southern Canadian provinces. Male black widow spiders are of little medical importance. Female black widow spiders can be 20 times larger than males. The female can be identified by the hourglass pattern, red or orange in color, on the ventral aspect of her shiny, globose black abdomen. Black widow spiders control the amount of venom they inject; an estimated 15% of bites to humans are non-envenomating. Cats are very sensitive to the venom and deaths are common. Dogs have severe clinical signs but are considered more resistant than cats. A single bite is capable of delivering a lethal dose of venom to companion animals. There are several toxic components consisting of five or six biologically active proteins. These include a potent mammalian neurotoxin called alpha-latrotoxin, which induces neurotransmitter release from nerve terminals. Acetylcholine, noradrenalin, dopamine, glutamate, and enkephalin systems are all susceptible to the toxin. Onset of clinical signs usually occurs during the first 8 hours post envenomation. The condition is extremely painful in moderate to severe envenomations. Abdominal rigidity without tenderness is a hallmark sign of Latrodectus envenomation. In cats, paralytic signs may occur early and are particularly marked. Hypertension is a significant threat. First aid is of no value in the treatment. The primary treatment for black widow spider envenomation is the administration of specific antivenin, which provides the most permanent and quickest relief of the envenomation syndrome, usually within 30 minutes of infusion. The prognosis of Latrodectus envenomation is uncertain of several days, and complete recovery may take weeks.

  8. Active optical sensor assessment of spider mite damage on greenhouse beans and cotton.

    Science.gov (United States)

    Martin, Daniel E; Latheef, Mohamed A

    2018-02-01

    The two-spotted spider mite, Tetranychus urticae Koch, is an important pest of cotton in mid-southern USA and causes yield reduction and deprivation in fiber fitness. Cotton and pinto beans grown in the greenhouse were infested with spider mites at the three-leaf and trifoliate stages, respectively. Spider mite damage on cotton and bean canopies expressed as normalized difference vegetation index indicative of changes in plant health was measured for 27 consecutive days. Plant health decreased incrementally for cotton until day 21 when complete destruction occurred. Thereafter, regrowth reversed decline in plant health. On spider mite treated beans, plant vigor plateaued until day 11 when plant health declined incrementally. Results indicate that pinto beans were better suited as a host plant than cotton for rearing T. urticae in the laboratory.

  9. 'Natural experiment' demonstrates top-down control of spiders by birds on a landscape level.

    Directory of Open Access Journals (Sweden)

    Haldre Rogers

    Full Text Available The combination of small-scale manipulative experiments and large-scale natural experiments provides a powerful approach for demonstrating the importance of top-down trophic control on the ecosystem scale. The most compelling natural experiments have come from studies examining the landscape-scale loss of apex predators like sea otters, wolves, fish and land crabs. Birds are dominant apex predators in terrestrial systems around the world, yet all studies on their role as predators have come from small-scale experiments; the top-down impact of bird loss on their arthropod prey has yet to be examined at a landscape scale. Here, we use a unique natural experiment, the extirpation of insectivorous birds from nearly all forests on the island of Guam by the invasive brown tree snake, to produce the first assessment of the impacts of bird loss on their prey. We focused on spiders because experimental studies showed a consistent top-down effect of birds on spiders. We conducted spider web surveys in native forest on Guam and three nearby islands with healthy bird populations. Spider web densities on the island of Guam were 40 times greater than densities on islands with birds during the wet season, and 2.3 times greater during the dry season. These results confirm the general trend from manipulative experiments conducted in other systems however, the effect size was much greater in this natural experiment than in most manipulative experiments. In addition, bird loss appears to have removed the seasonality of spider webs and led to larger webs in at least one spider species in the forests of Guam than on nearby islands with birds. We discuss several possible mechanisms for the observed changes. Overall, our results suggest that effect sizes from smaller-scale experimental studies may significantly underestimate the impact of bird loss on spider density as demonstrated by this large-scale natural experiment.

  10. Reversible myocarditis after spider bite.

    Science.gov (United States)

    Kara, Hasan; Ak, Ahmet; Bayir, Aysegul; Avci, Ahmet

    2013-04-08

    Black widow spiders (Latrodectus tredecimguttatus) are poisonous spiders endemic in Turkey. Latrodectus bites may cause myocarditis with increased cardiac enzymes. We treated two men (aged 20 and 33 years) who had myocarditis after black spider bites with leucocytosis and elevated levels of troponin I, creatine kinase and creatine kinase-MB fraction. Both patients had normal results on an ECG, and one patient had abnormal echocardiography with minimal left ventricular wall movement disorder. Both patients were hospitalised in the intensive care unit and treated with intravenous fluids, analgesics, spasmolytic drugs, tetanus prophylaxis and cardiac monitoring. The levels of troponin I, creatine kinase and creatine kinase-MB fraction improved, and the patients were discharged home on the third and fifth hospital day without complications. Myocarditis after a Latrodectus bite is rare, but may be associated with serious complications. Therefore, in regions endemic with Latrodectus spiders, prudent treatment of spider bites may include cardiac evaluation and monitoring.

  11. Gamma irradiation as a quarantine treatment for spider mites (Acarina: tetranychidae) in horticultural products

    International Nuclear Information System (INIS)

    Ignatowicz, S.; Banasik-Solgala, K.

    1999-01-01

    The carmine spider mite, Tetranychus cinnabarinus (Boisd.), and the two-spotted spider mite, Tetranychus urticae Koch, are closely related species of tetranychid mites (Acarina, Tetranychidae) that respond to gamma irradiation in a similar way. Eggs of both species exposed to gamma radiation early in embryonic development were considerably more susceptible to irradiation than older eggs. The tolerance of eggs to gamma radiation increased in 3-4-day-old eggs, when eye-spots were formed. Nymphs were more resistant to gamma radiation than eggs and larvae. Deteriorative effects of irradiation treatment were reflected in the immatures by their mortality in subsequent developmental stages. A positive relationship between dosage and the percent egg mortality or the mortality of subsequent stages was usually found when the immature stages were irradiated. The sex ratio of adults developed from irradiated eggs, larvae, and nymphs was affected by the irradiation treatment; the ratio was usually skewed towards males. Irradiation of females resulted in increased mortality, lowered fecundity, reduced egg viability, and sex ratio distortion in their progeny. Two-day-old females of the carmine spider mite and the two-spotted spider mite irradiated with 200 or 300 Gy lived as long as the controls. Mortality occurred after 3 weeks. The number of eggs laid by irradiated females of spider mites was considerably lower than in the control, and it decreased as the absorbed dose increased. The higher the dose of gamma radiation applied to adults of the spider mites (the parental generation, P), the higher the mortality of the F1 mites during their embryonic development. Viability of eggs laid by irradiated females of spider mites mated with irradiated males was significantly reduced. Young females treated with a dose of 0.2 kGy produced 40-50% nonviable eggs, while control mites produced only 6.0-6.6% nonviable eggs. A dose of 0.3 kGy caused high mortality of eggs; 88% and 97% nonviable

  12. Crab As A Coconut Oil Separating Agent

    OpenAIRE

    Margino, Sebastian

    2017-01-01

    The role of sterilized and nonsterilized crab extract on the separation of coconut oil was examined using grated coconut meat as substrate. Sterilized crab extract was prepared by suspension and centrifugation of crushed crab and then filtrated using Millipore Utter. Sterilized crab extract has proteolytic activity but not lipolytic one. It was found that the sterilized crab extract supported the growth of proteolytic microbes, isolated from fermentation process of coconut oil. Both sterilize...

  13. On the misidentification of a common sandy beach crab belonging to ...

    African Journals Online (AJOL)

    The three-spot swimming crab, a common intertidal resident of sandy beaches in southern Africa, has previously been misidentified as Ovalipes punctatus (De Haan, 1833). Inspection of local specimens indicates that the valid name for this species is O. trimaculatus (De Haan, 1833).

  14. Black widow spider and brown recluse spider bites in Texas from 1998 through 2002.

    Science.gov (United States)

    Forrester, Mathias B; Stanley, Sharilyn K

    2003-10-01

    Black widow spiders and brown recluse spiders are of medical importance to humans in the US. However, these spiders differ in their habits, habitat, and the clinical effects and treatment of their bite. This study used data from human exposure calls to poison centers in Texas to compare the epidemioloy of bites from these 2 spiders. During 1998-2002, 760 black widow spider bites and 1,369 brown recluse spider bites were reported. Black widow spider bite penetrance demonstrated no secular trend during this time period while the penetrance of brown recluse spider bites increased. A higher percentage of black widow spider bites occurred among males, while a higher proportion of brown recluse spider bites were reported for females. Black widow spider bites most frequently had mild outcomes while brown recluse spider bites most often had moderate outcomes. The majority of reported bites for both types of spider occurred at the patient's own residence, although the percentage was lower for black widow spiders. Seasonal trends were noted for both black widow and brown recluse spiders. The highest penetrance of black widow spider bites was observed in western Texas while the highest penetrance of brown recluse spider bites was observed in central Texas. This information is useful for identifying those populations at greatest risk for the respective spider bites.

  15. Black widow spider bite.

    Science.gov (United States)

    Kobernick, M

    1984-05-01

    Latrodectus mactans has now invaded towns and cities. The spider's venom is a neurotoxin that causes little local reaction but produces pain and spasm in large skeletal muscle groups within 30 minutes to three hours after the bite. Severe envenomation may result in respiratory failure and coma. First aid is of no value. Muscle relaxants are useful in treatment, as is calcium gluconate. Antivenin is indicated for high-risk victims, such as those with hypertension and persons younger than 16 or older than 60 years of age.

  16. Age Spots

    Science.gov (United States)

    ... for Every Season How to Choose the Best Skin Care Products In This Section Dermatologic Surgery What is dermatologic ... for Every Season How to Choose the Best Skin Care Products Age Spots Treatment Options Learn more about treatment ...

  17. What regulates crab predation on mangrove propagules?

    Science.gov (United States)

    Van Nedervelde, Fleur; Cannicci, Stefano; Koedam, Nico; Bosire, Jared; Dahdouh-Guebas, Farid

    2015-02-01

    Crabs play a major role in some ecosystems. To increase our knowledge about the factors that influence crab predation on propagules in mangrove forests, we performed experiments in Gazi Bay, Kenya in July 2009. We tested whether: (1) crab density influences propagule predation rate; (2) crab size influences food competition and predation rate; (3) crabs depredate at different rates according to propagule and canopy cover species; (4) vegetation density is correlated with crab density; (5) food preferences of herbivorous crabs are determined by size, shape and nutritional value. We found that (1) propagule predation rate was positively correlated to crab density. (2) Crab competitive abilities were unrelated to their size. (3) Avicennia marina propagules were consumed more quickly than Ceriops tagal except under C. tagal canopies. (4) Crab density was negatively correlated with the density of A. marina trees and pneumatophores. (5) Crabs prefer small items with a lower C:N ratio. Vegetation density influences crab density, and crab density affects propagule availability and hence vegetation recruitment rate. Consequently, the mutual relationships between vegetation and crab populations could be important for forest restoration success and management.

  18. Golden Crab Logbook Survey (Vessels)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In November 1995, a voluntary logbook program for the golden crab fishery in the waters under the jurisdiction of the South Atlantic Fishery Management Council...

  19. Seasonal dynamics of the density of the crab larvae (Decapoda: Brachyura et Anomura) in Minonosok Bay of Pos'eta Bay (Peter the Great Bay, Sea of Japan)

    Science.gov (United States)

    Grigoryeva, N. I.

    2013-03-01

    As the materials for this project, we used data on the distribution of the larvae of the Asian paddle crab Charybdis japonicus (A. Milne-Edwards, 1861); the spider crabs Hyas coarctatus ursinus (= Hyas ursinus) (Rathbun, 1924), Pugettia quadridens (de Haan, 1839), and Pisoides bidentatus (H. Milne-Edwards, 1873); the samurai crab Paradorippe granulata (= Dorippe granulata) (de Haan, 1841); the pea crab Pinnixa rathbuni (Sakai, 1934); and the porcelain crab Pachycheles stevensii (Stimpson, 1858) in Minonosok Bay of Pos'eta Bay obtained during 2000-2002 and in 2004. The planktonic samples were collected from the last third of May to September. The greatest density of the larvae was observed in May, mid-June, late June-early July, and late July-early August. The greatest densities of the crab larvae and the decapod larvae ranged from 20.4 to 48.2 and from 88.4 to 245.3 specimens/m3. The schedule of the crab larvae's occurrence in the plankton is provided for the first time. The distribution of the density showed pronounced patchiness.

  20. SPOT Program

    Science.gov (United States)

    Smith, Jason T.; Welsh, Sam J.; Farinetti, Antonio L.; Wegner, Tim; Blakeslee, James; Deboeck, Toni F.; Dyer, Daniel; Corley, Bryan M.; Ollivierre, Jarmaine; Kramer, Leonard; hide

    2010-01-01

    A Spacecraft Position Optimal Tracking (SPOT) program was developed to process Global Positioning System (GPS) data, sent via telemetry from a spacecraft, to generate accurate navigation estimates of the vehicle position and velocity (state vector) using a Kalman filter. This program uses the GPS onboard receiver measurements to sequentially calculate the vehicle state vectors and provide this information to ground flight controllers. It is the first real-time ground-based shuttle navigation application using onboard sensors. The program is compact, portable, self-contained, and can run on a variety of UNIX or Linux computers. The program has a modular objec-toriented design that supports application-specific plugins such as data corruption remediation pre-processing and remote graphics display. The Kalman filter is extensible to additional sensor types or force models. The Kalman filter design is also strong against data dropouts because it uses physical models from state and covariance propagation in the absence of data. The design of this program separates the functionalities of SPOT into six different executable processes. This allows for the individual processes to be connected in an a la carte manner, making the feature set and executable complexity of SPOT adaptable to the needs of the user. Also, these processes need not be executed on the same workstation. This allows for communications between SPOT processes executing on the same Local Area Network (LAN). Thus, SPOT can be executed in a distributed sense with the capability for a team of flight controllers to efficiently share the same trajectory information currently being computed by the program. SPOT is used in the Mission Control Center (MCC) for Space Shuttle Program (SSP) and International Space Station Program (ISSP) operations, and can also be used as a post -flight analysis tool. It is primarily used for situational awareness, and for contingency situations.

  1. Linking Native and Invader Traits Explains Native Spider Population Responses to Plant Invasion.

    Directory of Open Access Journals (Sweden)

    Jennifer N Smith

    Full Text Available Theoretically, the functional traits of native species should determine how natives respond to invader-driven changes. To explore this idea, we simulated a large-scale plant invasion using dead spotted knapweed (Centaurea stoebe stems to determine if native spiders' web-building behaviors could explain differences in spider population responses to structural changes arising from C. stoebe invasion. After two years, irregular web-spiders were >30 times more abundant and orb weavers were >23 times more abundant on simulated invasion plots compared to controls. Additionally, irregular web-spiders on simulated invasion plots built webs that were 4.4 times larger and 5.0 times more likely to capture prey, leading to >2-fold increases in recruitment. Orb-weavers showed no differences in web size or prey captures between treatments. Web-spider responses to simulated invasion mimicked patterns following natural invasions, confirming that C. stoebe's architecture is likely the primary attribute driving native spider responses to these invasions. Differences in spider responses were attributable to differences in web construction behaviors relative to historic web substrate constraints. Orb-weavers in this system constructed webs between multiple plants, so they were limited by the overall quantity of native substrates but not by the architecture of individual native plant species. Irregular web-spiders built their webs within individual plants and were greatly constrained by the diminutive architecture of native plant substrates, so they were limited both by quantity and quality of native substrates. Evaluating native species traits in the context of invader-driven change can explain invasion outcomes and help to identify factors limiting native populations.

  2. Susceptibility of two spotted spider mite Tetranychus urticae KOCH ...

    African Journals Online (AJOL)

    ... (GSTs) and cytochrome P450 monooxygenases and esterases as the possible mechanisms of resistance. © 2016 International Formulae Group. All rights reserved. Keywords: Tetranychus urticea, resistance, glutathione-S-tranferases, cytochrome P450 monooxygenases, esterases, piperonyl butoxide, diethyl maleate.

  3. Susceptibility of two spotted spider mite Tetranychus urticae KOCH ...

    African Journals Online (AJOL)

    The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader). If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.

  4. Dark Spots

    Science.gov (United States)

    2006-01-01

    Dark spots (left) and 'fans' appear to scribble dusty hieroglyphics on top of the Martian south polar cap in two high-resolution Mars Global Surveyor, Mars Orbiter Camera images taken in southern spring. Each image is about 3-kilometers wide (2-miles).

  5. Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

    Directory of Open Access Journals (Sweden)

    Jiang Min

    2016-01-01

    Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

  6. Spider phylogenomics: untangling the Spider Tree of Life

    Directory of Open Access Journals (Sweden)

    Nicole L. Garrison

    2016-02-01

    Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

  7. Summary statistics for fossil spider species taxonomy

    OpenAIRE

    Penney, David; Dunlop, Jason; Marusik, Yuri

    2012-01-01

    Abstract Spiders (Araneae) are one of the most species-rich orders on Earth today, and also have one of the longest geological records of any terrestrial animal groups, as demonstrated by their extensive fossil record. There are currently around 1150 described fossil spider species, representing 2.6% of all described spiders (i.e. extinct and extant). Data for numbers of fossil and living spider taxa described annually (and various other metrics for the fossil taxa) were compiled from current...

  8. Spider and burnable poison rod combinations

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1980-01-01

    An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

  9. Approach and avoidance in fear of spiders

    NARCIS (Netherlands)

    Rinck, M.; Becker, E.S.

    2007-01-01

    We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

  10. Characterization of a Freshwater Crab Sudanonautes aubryi ...

    African Journals Online (AJOL)

    SARAH

    2014-01-31

    Jan 31, 2014 ... Recently, Cumberlidge and. Reed (2004) described the freshwater crab genus. Erimetopus of Congo basin. Sudanonautes aubryi, like all others edible crabs are also poorly understood. This preliminary study was undertaken to collect and realize a biometric characterization of this common freshwater crab ...

  11. Caught in the Crab's claws

    CERN Multimedia

    2001-01-01

    'The crab', a new cryo magnet transport vehicle, starts work at CERN. Produced by the ESI group of EST division and built in Finland, it has the job of transporting LHC magnets in buildings SM18 and SMA18. If you see a huge crab scuttling around building SMA18 don't be afraid! It is the new Cryo Magnet Transport Vehicle produced by the ESI group (Engineering Support for Infrastructure, EST Division) for CERN's LHC project and built by Finnish Company ROCLA. This orange vehicle, nicknamed 'The Crab', is perhaps the strangest piece of equipment used for the construction of LHC magnets. It will start work at the end of this month. The crab will be used to transport LHC cryo-magnets and their components in the assembly and preparation building, SMA18, and test building, SM18. It has many capabilities that will allow CERN staff and contractors transport magnets between the two buildings and to locate them in the right position on the test beds. The crab in action during its first tests on 8 February. How does th...

  12. Are Crab nanoshots Schwinger sparks?

    Energy Technology Data Exchange (ETDEWEB)

    Stebbins, Albert [Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Yoo, Hojin [Univ. of Wisconsin, Madison, WI (United States); Fermi National Accelerator Lab. (FNAL), Batavia, IL (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Univ. of California, Berkeley, CA (United States)

    2015-05-21

    The highest brightness temperature ever observed are from "nanoshots" from the Crab pulsar which we argue could be the signature of bursts of vacuum e± pair production. If so this would be the first time the astronomical Schwinger effect has been observed. These "Schwinger sparks" would be an intermittent but extremely powerful, ~103 L, 10 PeV e± accelerator in the heart of the Crab. These nanosecond duration sparks are generated in a volume less than 1 m3 and the existence of such sparks has implications for the small scale structure of the magnetic field of young pulsars such as the Crab. As a result, this mechanism may also play a role in producing other enigmatic bright short radio transients such as fast radio bursts.

  13. Biphasic activity of a jumping spider

    Science.gov (United States)

    Okuyama, Toshinori

    2011-01-01

    Individual variation is a ubiquitous and important factor that affects ecological dynamics. This study examined individual variation in the nest-use pattern of the jumping spider Phidippus audax. Although the jumping spider is a diurnal species, field observations in this study revealed that the majority of individuals remained in their nests during the day. An accompanying examination of the hunger level of the spiders revealed that spiders that remained in nests were more starved than those observed outside nests. If spiders actively forage when they are starved, as has been suggested by previous studies, one would expect to see the opposite trend (i.e., spiders that remained in nests are more satiated). Thus, the pattern observed in the field contradicts the known behavioral pattern of the spiders. An individual-based model was used to investigate the behavioral mechanism of the spider and the discrepancy found in the observations. A basic assumption of the model is that spiders possess distinct inactive and active phases (biphasic activity pattern), and transitions between the two phases are regulated by the hunger level of the spider. Data from a laboratory experiment were used to examine the assumptions of the model partially. The model was able to capture patterns observed in the data, suggesting that the pattern of transitions in biphasic activity is an important trait of the foraging behavior of the jumping spider.

  14. Mongolian spots

    Directory of Open Access Journals (Sweden)

    Divya Gupta

    2013-01-01

    Full Text Available Mongolian spots (MS are birthmarks that are present at birth and their most common location is sacrococcygeal or lumbar area. Lesions may be single or multiple and usually involve < 5% total body surface area. They are macular and round, oval or irregular in shape. The color varies from blue to greenish, gray, black or a combination of any of the above. The size varies from few to more than 20 centimetres. Pigmentation is most intense at the age of one year and gradually fades thereafter. It is rarely seen after the age of 6 years. Aberrant MS over occiput, temple, mandibular area, shoulders and limbs may be confused with other dermal melanocytoses and bruises secondary to child abuse, thus necessitating documentation at birth. Although regarded as benign, recent data suggest that MS may be associated with inborn errors of metabolism and neurocristopathies. Mongolian spots usually resolve by early childhood and hence no treatment is generally needed if they are located in the sacral area. However, sometimes it may be required for extrasacral lesions for cosmesis.

  15. The toxicology of Latrodectus tredecimguttatus: the Mediterranean Black Widow spider.

    Science.gov (United States)

    Bonnet, M S

    2004-01-01

    The symptomatology of envenomation by the Mediterranean Black Widow Spider, Latrodectus tredecimguttatus, is reviewed. The results confirm the hypothesis that the homeopathic remedy, Tarentula hispanica, is derived from this spider, not from the Wolf spider, Lycosa tarentula.

  16. AFSC/RACE/SAP/Jensen: Bitter crab disease mortality in SE Alaska Tanner crab

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — These are data from a laboratory experiment in which wild caught male Tanner crab (Chionoecetes bairdi) from Stephens Passage, SE Alaska were held to evaluate crab...

  17. The Legs That Rock the Cradle: Spider Mothers

    Indian Academy of Sciences (India)

    Abstract. Spiders are excellent models to study behavioural diversityand evolutionary adaptations in the animal world. This articleexplores the strategies used by spiders to maximise thesurvival of their offspring.

  18. The evolution of sociality in spiders

    DEFF Research Database (Denmark)

    Lubin, Yael; Bilde, T.

    2007-01-01

    . Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

  19. The Crab Nebula flaring activity

    Directory of Open Access Journals (Sweden)

    G. Montani

    2014-12-01

    Full Text Available The discovery made by AGILE and Fermi of a short time scale flaring activity in the gamma-ray energy emission of the Crab Nebula is a puzzling and unexpected feature, challenging particle acceleration theory. In the present work we propose the shock-induced magnetic reconnection as a viable mechanism to explain the Crab flares. We postulate that the emitting region is located at ∼1015 cm from the central pulsar, well inside the termination shock, which is exactly the emitting region size as estimated by the overall duration of the phenomenon ∼1 day. We find that this location corresponds to the radial distance at which the shock-induced magnetic reconnection process is able to accelerate the electrons up to a Lorentz factor ∼109, as required by the spectral fit of the observed Crab flare spectrum. The main merit of the present analysis is to highlight the relation between the observational constraints to the flare emission and the radius at which the reconnection can trigger the required Lorentz factor. We also discuss different scenarios that can induce the reconnection. We conclude that the existence of a plasma instability affecting the wind itself as the Weibel instability is the privileged scenario in our framework.

  20. Tangled in a sparse spider web

    DEFF Research Database (Denmark)

    Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

    2012-01-01

    In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

  1. Particle beam and crabbing and deflecting structure

    Science.gov (United States)

    Delayen, Jean [Yorktown, VA

    2011-02-08

    A new type of structure for the deflection and crabbing of particle bunches in particle accelerators comprising a number of parallel transverse electromagnetic (TEM)-resonant) lines operating in opposite phase from each other. Such a structure is significantly more compact than conventional crabbing cavities operating the transverse magnetic TM mode, thus allowing low frequency designs.

  2. Spider phobics more easily see a spider in morphed schematic pictures

    Directory of Open Access Journals (Sweden)

    Partchev Ivailo

    2007-11-01

    Full Text Available Abstract Background Individuals with social phobia are more likely to misinterpret ambiguous social situations as more threatening, i.e. they show an interpretive bias. This study investigated whether such a bias also exists in specific phobia. Methods Individuals with spider phobia or social phobia, spider aficionados and non-phobic controls saw morphed stimuli that gradually transformed from a schematic picture of a flower into a schematic picture of a spider by shifting the outlines of the petals until they turned into spider legs. Participants' task was to decide whether each stimulus was more similar to a spider, a flower or to neither object while EEG was recorded. Results An interpretive bias was found in spider phobia on a behavioral level: with the first opening of the petals of the flower anchor, spider phobics rated the stimuli as more unpleasant and arousing than the control groups and showed an elevated latent trait to classify a stimulus as a spider and a response-time advantage for spider-like stimuli. No cortical correlates on the level of ERPs of this interpretive bias could be identified. However, consistent with previous studies, social and spider phobic persons exhibited generally enhanced visual P1 amplitudes indicative of hypervigilance in phobia. Conclusion Results suggest an interpretive bias and generalization of phobia-specific responses in specific phobia. Similar effects have been observed in other anxiety disorders, such as social phobia and posttraumatic stress disorder.

  3. Novel Geometries for the LHC CRAB Cavity

    CERN Document Server

    Hall, Ben

    2010-01-01

    In 2017 the LHC is envisioned to increase its luminosity via an upgrade. This upgrade is likely to require a large crossing angle hence a crab cavity is required to align the bunches prior to collision. There are two possible schemes for crab cavity implementation, global and local. In a global crab cavity the crab cavity is far from the IP and the bunch rotates back and forward as it traverses around the accelerator in a closed orbit. For this scheme a two-cell elliptical squashed cavity at 800 MHz is preferred. To avoid any potential beam instabilities all the parasitic modes of the cavities must be damped strongly, however crab cavities have lower order and same order modes in addition to the usual higher order modes and hence a novel damping scheme must be used to provide sufficient damping of these modes. In the local scheme two crab cavities are placed at each side of the IP two start and stop rotation of the bunches. This would require crab cavities much smaller transversely than in the global scheme b...

  4. Understanding Spider-Man: Your Everyday Superhero

    OpenAIRE

    Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

    2014-01-01

    This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

  5. A large bubble around the Crab Nebula

    Science.gov (United States)

    Romani, Roger W.; Reach, William T.; Koo, Bon Chul; Heiles, Carl

    1990-01-01

    IRAS and 21 cm observations of the interstellar medium around the Crab nebula show evidence of a large bubble surrounded by a partial shell. If located at the canonical 2 kpc distance of the Crab pulsar, the shell is estimated to have a radius of about 90 pc and to contain about 50,000 solar masses of swept-up gas. The way in which interior conditions of this bubble can have important implications for observations of the Crab are described, and the fashion in which presupernova evolution of the pulsar progenitor has affected its local environment is described.

  6. Final focus designs for crab waist colliders

    CERN Document Server

    AUTHOR|(CDS)2084369; Levichev, Evgeny; Piminov, Pavel

    2016-01-01

    The crab waist collision scheme promises significant luminosity gain. The successful upgrade of the DA$\\Phi$NE collider proved the principle of crab waist collision and increased luminosity 3 times. Therefore, several new projects try to implement the scheme. The paper reviews interaction region designs with the crab waist collision scheme for already existent collider DA$\\Phi$NE and SuperKEKB, presently undergoing commissioning, for the projects of SuperB in Italy, CTau in Novosibirsk and FCC-ee at CERN.

  7. Final focus designs for crab waist colliders

    Directory of Open Access Journals (Sweden)

    A. Bogomyagkov

    2016-12-01

    Full Text Available The crab waist collision scheme promises significant luminosity gain. The successful upgrade of the DAΦNE collider proved the principle of crab waist collision and increased luminosity 3 times. Therefore, several new projects try to implement the scheme. The paper reviews interaction region designs with the crab waist collision scheme for already existent collider DAΦNE and SuperKEKB, presently undergoing commissioning, for the projects of SuperB in Italy, CTau in Novosibirsk and FCC-ee at CERN.

  8. Design of the ILC Crab Cavity System

    Energy Technology Data Exchange (ETDEWEB)

    Adolphsen, C.; Beard, C.; Bellantoni, L.; Burt, G.; Carter, R.; Chase, B.; Church, M.; Dexter, A.; Dykes, M.; Edwards, H.; Goudket, P; Jenkins, R.; Jones, R.M.; Kalinin,; Khabiboulline, T.; Ko, K.; Latina, A.; Li, Z.; Ma, L.; McIntosh, P.; Ng, C.; /SLAC /Daresbury /Fermilab /Cockcroft Inst. Accel. Sci. Tech. /CERN

    2007-08-15

    The International Linear Collider (ILC) has a 14 mrad crossing angle in order to aid extraction of spent bunches. As a result of the bunch shape at the interaction point, this crossing angle at the collision causes a large luminosity loss which can be recovered by rotating the bunches prior to collision using a crab cavity. The ILC baseline crab cavity is a 9-cell superconducting dipole cavity operating at a frequency of 3.9 GHz. In this paper the design of the ILC crab cavity and its phase control system, as selected for the RDR in February 2007 is described in fuller detail.

  9. SpotADAPT

    DEFF Research Database (Denmark)

    Kaulakiene, Dalia; Thomsen, Christian; Pedersen, Torben Bach

    2015-01-01

    by Amazon Web Services (AWS). The users aiming for the spot market are presented with many instance types placed in multiple datacenters in the world, and thus it is difficult to choose the optimal deployment. In this paper, we propose the framework SpotADAPT (Spot-Aware (re-)Deployment of Analytical...... execution within boundaries). Moreover, during the execution of the workload, SpotADAPT suggests a redeployment if the current spot instance gets terminated by Amazon or a better deployment becomes possible due to fluctuations of the spot prices. The approach is evaluated using the actual execution times...

  10. Habitat-specific effects of climate change on a low-mobility Arctic spider species

    DEFF Research Database (Denmark)

    Bowden, Joseph James; Hansen, Rikke Reisner; Olsen, Kent

    2015-01-01

    habitats. Such differences between habitats may influence the effects of climate changes on animals and this could be especially true in low-mobility species. Suitable model systems to test this idea, however, are rare. We examined how proxies of reproductive success (body size, juvenile/female ratios......Abstract Terrestrial ecosystems are heterogeneous habitat mosaics of varying vegetation types that are differentially affected by climate change. Arctic plant communities, for example, are changing faster in moist habitats than in dry habitats and abiotic changes like snowmelt vary locally among......) and sex ratios have changed in low-mobility crab spiders collected systematically over a 17-year period (1996–2012) from two distinct habitats (mesic and arid dwarf shrub heath) at Zackenberg in northeast Greenland. We identified all adults in the collection to confirm that they represented just one...

  11. Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

    2016-03-30

    Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

  12. Modelling Crop Biocontrol by Wanderer Spiders

    Science.gov (United States)

    Venturino, Ezio; Ghersi, Andrea

    2008-09-01

    We study mathematically the effects some spiders populations have on insects living in and near agroecosystems, where woods and vineyards alternate in the landscape as in the Alta Langa, Piemonte, NW Italy.

  13. Monitoring the Crab Nebula with LOFT

    Science.gov (United States)

    Wilson-Hodge, Colleen A.

    2012-01-01

    From 2008-2010, the Crab Nebula was found to decline by 7% in the 15-50 keV band, consistently in Fermi GBM, INTEGRAL IBIS, SPI, and JEMX, RXTE PCA, and Swift BAT. From 2001-2010, the 15-50 keV flux from the Crab Nebula typically varied by about 3.5% per year. Analysis of RXTE PCA data suggests possible spectral variations correlated with the flux variations. I will present estimates of the LOFT sensitivity to these variations. Prior to 2001 and since 2010, the observed flux variations have been much smaller. Monitoring the Crab with the LOFT WFM and LAD will provide precise measurements of flux variations in the Crab Nebula if it undergoes a similarly active episode.

  14. Epizoic and ectoparasitic protozoans from crab larvae

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    A suctorian, Ephelota gemmipara Hertwig, infesting the zoea of the peacrab, Porcellana and an ectoparasitic flagellate Ellobiopsis chattoni Caullery infecting the zoea of the crab were observed from off Cape Comorin, the south-east coast of India...

  15. The anatomy of the king crab Hapalogaster mertensii Brandt, 1850 (Anomura: Paguroidea: Hapalogastridae): new insights into the evolutionary transformation of hermit crabs into king crabs

    NARCIS (Netherlands)

    Keiler, J.; Richter, S.; Wirkner, C.S.

    2015-01-01

    The emergence of king crabs from a hermit crab-like ancestor is one of the most curious events in decapod evolution. King crabs comprise two taxa, Lithodidae and Hapalogastridae, and while lithodids have formed the focus of various anatomical studies, the internal anatomy of hapalogastrids has never

  16. Spider's web inspires fibres for industry

    Science.gov (United States)

    Dacey, James

    2010-03-01

    Spiders may not be everybody's idea of natural beauty, but nobody can deny the artistry in the webs that they spin, especially when decorated with water baubles in the morning dew. Inspired by this spectacle, a group of researchers in China has mimicked the structural properties of the spider's web to create a fibre for industry that can manipulate water with the same skill and efficiency, writes James Dacey.

  17. Reversible Myocarditis after Black Widow Spider Envenomation

    OpenAIRE

    Tarek Dendane; Khalid Abidi; Naoufel Madani; Asmae Benthami; Fatima-Zohra Gueddari; Redoune Abouqal; Amine-Ali Zeggwagh

    2012-01-01

    Black widow spiders can cause variable clinical scenarios from local damage to very serious conditions including death. Acute myocardial damage is rarely observed and its prognostic significance is not known. We report a rare case of a 35-year-old man who developed an acute myocarditis with cardiogenic pulmonary edema requiring mechanical ventilation caused by black widow spider's envenomation. The patient was previously healthy. The clinical course was associated with systemic and cardiovasc...

  18. Edge effect on weevils and spiders

    OpenAIRE

    R. Horváth; T. Magura; G. Péter; B. Tóthmérész

    2002-01-01

    The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

  19. Anaphylaxis to black widow spider antivenom.

    Science.gov (United States)

    Hoyte, Christopher O; Cushing, Tracy A; Heard, Kennon J

    2012-06-01

    Black widow spider envenomation is commonly reported to poison centers. Black widow spider envenomation produces a clinical syndrome, known as latrodectism, characterized by headache, nausea, vomiting, several muscle cramping and pain, joint stiffness, hypertension, and regional diaphoresis. Black widow spider antivenom (Merck & Co, Inc, West Point, PA USA) is an effective and relatively safe treatment option. There is 1 clear case of anaphylaxis secondary to black widow spider antivenom reported in the medical literature. Here, we report a case of anaphylaxis to antivenom. A 12-year-old boy presented to the emergency department (ED) with diffuse, severe pain 2 1/2 hours after being bitten by a black widow spider on the right lower extremity. In the ED, the patient failed analgesic therapy with fentanyl and was given black widow spider antivenom. Within 45 minutes, he exhibited signs and symptoms consistent with anaphylaxis, including wheezing, chest tightness, pruritus, and urticarial rash. The patient was given standard therapy for anaphylaxis, and all of his signs and symptoms (including the pain secondary to the black widow envenomation) resolved over 6 hours of observation. Leading experts agree that the use of antivenom is indicated in cases of severe envenomation not responsive to standard therapy. Despite concern that the antivenom is an equine-derived whole IgG and can precipitate early hypersensitivity reactions, there is only 1 other reported case of anaphylaxis to the antivenom in the medical literature.

  20. Crabs

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterji, A.

    stream_size 2 stream_content_type text/plain stream_name Biodiversity_Western_Ghats_Inf_Kit_1994_3.6_1.pdf.txt stream_source_info Biodiversity_Western_Ghats_Inf_Kit_1994_3.6_1.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  1. Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

    NARCIS (Netherlands)

    Kindt, M.; Brosschot, J.F.

    1999-01-01

    Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

  2. Redescription of the poorly known crab spider Firmicus bivittatus (Araneae: Thomisidae

    Directory of Open Access Journals (Sweden)

    Deltshev, Christo

    2017-04-01

    Full Text Available Firmicus bivittatus Simon, 1895 was described from the Edough Mt, Algeria, based on one male only. Here, a redescription and new illustrations of the species based on the existing type material is presented. The female is figured for the first time.

  3. First Record of the Carmine Spider Mite, Tetranychus urticae, Infesting Withania somnifera in India

    Science.gov (United States)

    Sharma, Ashutosh; Kumar Pati, Pratap

    2012-01-01

    During April–June 2010, red two—spotted carmine spider mites Tetranychus urticae Koch (Trombidiformes: Tetranychidae) were found on aerial apical parts of Ashwagandha Withania somnifera (L.) Dunal (Solanales: Solanaceae) plants in the Amritsar District of Punjab Province in the North Indian plains. The mites fed on the leaves, making them shiny white in color, which gradually dried off and were later shed. The pest was identified as T. urticae. To best of our knowledge, this is the first record of this pest infesting W. somnifera in India. PMID:22970740

  4. Perceptions of environmental changes and Lethargic crab disease among crab harvesters in a Brazilian coastal community

    Directory of Open Access Journals (Sweden)

    Firmo Angélica MS

    2011-11-01

    Full Text Available Abstract Background Lethargic Crab Disease (LCD has caused significant mortalities in the population of Ucides cordatus crabs in the Mucuri estuary in Bahia State, Brazil, and has brought social and economic problems to many crab-harvesting communities that depend on this natural resource. The present work examined the perceptions of members of a Brazilian crab harvesting community concerning environmental changes and the Lethargic Crab Disease. Methods Field work was undertaken during the period between January and April/2009, with weekly or biweekly field excursions during which open and semi-structured interviews were held with local residents in the municipality of Mucuri, Bahia State, Brazil. A total of 23 individuals were interviewed, all of whom had at least 20 years of crab-collecting experience in the study region. Key-informants (more experienced crab harvesters were selected among the interviewees using the "native specialist" criterion. Results According to the collectors, LCD reached the Mucuri mangroves between 2004 and 2005, decimating almost all crab population in the area, and in 2007, 2008 and 2009 high mortalities of U. cordatus were again observed as a result of recurrences of this disease in the region. In addition to LCD, crabs were also suffering great stock reductions due to habitat degradation caused by deforestation, landfills, sewage effluents, domestic and industrial wastes and the introduction of exotic fish in the Mucuri River estuary. The harvesting community was found to have significant ecological knowledge about the functioning of mangrove swamp ecology, the biology of crabs, and the mass mortality that directly affected the economy of this community, and this information was largely in accordance with scientific knowledge. Conclusions The study of traditional knowledge makes it possible to better understand human interactions with the environment and aids in the elaboration of appropriate strategies for natural

  5. Hermit to king, or hermit to all: multiple transitions to crab-like forms from hermit crab ancestors.

    Science.gov (United States)

    Tsang, Ling Ming; Chan, Tin-Yam; Ahyong, Shane T; Chu, Ka Hou

    2011-10-01

    The Anomura presents the greatest degree of morphological disparity in the decapod Crustacea, with body forms ranging from the symmetrical and asymmetrical hermit crabs to squat lobsters and king crabs. The phylogeny of the anomurans has been fraught with controversy. Recent debate has focused primarily on the phenomenon of carcinization, the evolution of crab-like form from a non-crab-like ancestor, focused chiefly on derivation of king crabs from asymmetrical hermit crabs--the "hermit to king" hypothesis. We show by phylogenetic analysis of five nuclear protein-coding gene sequences that hermit crabs have a single origin, but surprisingly, that almost all other major clades and body forms within the Anomura, are derived from within the hermit crabs. The crab-like form and squat lobster form have each evolved at least twice from separate symmetrical hermit crab ancestors. In each case, a carcinization trend can be posited via a transition series from the initial symmetrical long-tailed hermit crab form, through the intermediate squat lobster or asymmetrical hermit crab form, to the final crab-like form. Adaptation to dextral shell habitation evolved at least twice, once in an exclusively deep-water clade and once in the common ancestor of all other asymmetrical hermit crabs (from which king crabs are derived). These remarkable cases of parallelism suggest considerable phenotypic flexibility within the hermit crab ground plan, with a general tendency toward carcinization. Rather than having a separate origin from other major clades, hermit crabs have given rise to most other major anomuran body types.

  6. Discovery of fossil spider remains in Tertiary soft brown coal

    Energy Technology Data Exchange (ETDEWEB)

    Manewald, U.; Heimer, S.; Volkman, N.

    1986-11-01

    A fossil spring spider (Salticidae) is described, discovered in a 1 cm/sup 3/ void of a lower Miocene brown coal seam in Bitterfeld (GDR). The spider's hair, chelicerae and legs are well preserved. A photograph of the cephalothorax is provided. In the same coal seam egg cocoons of other spiders were also found and are shown in two further microscopic photographs. Conclusions are drawn on spider fossilization, sedimentation and paleoenvironment of the Miocene coal seam 8 references.

  7. SPIDER OR NO SPIDER? NEURAL CORRELATES OF SUSTAINED AND PHASIC FEAR IN SPIDER PHOBIA.

    Science.gov (United States)

    Münsterkötter, Anna Luisa; Notzon, Swantje; Redlich, Ronny; Grotegerd, Dominik; Dohm, Katharina; Arolt, Volker; Kugel, Harald; Zwanzger, Peter; Dannlowski, Udo

    2015-09-01

    Processes of phasic fear responses to threatening stimuli are thought to be distinct from sustained, anticipatory anxiety toward an unpredicted, potential threat. There is evidence for dissociable neural correlates of phasic fear and sustained anxiety. Whereas increased amygdala activity has been associated with phasic fear, sustained anxiety has been linked with activation of the bed nucleus of stria terminalis (BNST), anterior cingulate cortex (ACC), and the insula. So far, only a few studies have focused on the dissociation of neural processes related to both phasic and sustained fear in specific phobia. We suggested that first, conditions of phasic and sustained fear would involve different neural networks and, second, that overall neural activity would be enhanced in a sample of phobic compared to nonphobic participants. Pictures of spiders and neutral stimuli under conditions of either predicted (phasic) or unpredicted (sustained) fear were presented to 28 subjects with spider phobia and 28 nonphobic control subjects during functional magnetic resonance imaging (fMRI) scanning. Phobic patients revealed significantly higher amygdala activation than controls under conditions of phasic fear. Sustained fear processing was significantly related to activation in the insula and ACC, and phobic patients showed a stronger activation than controls of the BNST and the right ACC under conditions of sustained fear. Functional connectivity analysis revealed enhanced connectivity of the BNST and the amygdala in phobic subjects. Our findings support the idea of distinct neural correlates of phasic and sustained fear processes. Increased neural activity and functional connectivity in these networks might be crucial for the development and maintenance of anxiety disorders. © 2015 Wiley Periodicals, Inc.

  8. Sex-specific kleptoparasitic foraging in ant-eating spiders

    DEFF Research Database (Denmark)

    Martisová, Martina; Bilde, T.; Pekar, Stano

    2009-01-01

    . To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes...

  9. Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

    Directory of Open Access Journals (Sweden)

    Michael Makris

    2009-01-01

    Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

  10. 50 CFR 680.21 - Crab harvesting cooperatives.

    Science.gov (United States)

    2010-10-01

    ... establishes an annual catch limit of crab that is based on the collective QS holdings of the members of the... the members of the crab harvesting cooperative. (2) Contents of application for annual crab harvesting... permit may appeal the IAD using the appeals procedures described in § 680.43. (c) Restrictions on fishing...

  11. Ghost crabs on a treadmill: Oxygen Uptake and Haemocyanin ...

    African Journals Online (AJOL)

    Ghost crabs Ocypode ceratophthalmus were exercised on a specially constructed treadmill. At a running speed of 13,3 cm s-1, most crabs ran for 2 h before getting fatigued. At this speed the oxygen consumption rate (MO2) was measured in time intervals for a total of 52 min. For exercised crabs the MO2 values are about ...

  12. Shell utilization and morphometries of the hermit crab Diogenes ...

    African Journals Online (AJOL)

    Fecundity, shell utilization, and crab and associated shell morphometries were investigated for the hermit crab Diogenes brevirostris collected from three intertidal sites in the eastern Cape. The relationship between crab fresh mass and egg number was linear. D. brevirostris was found to occupy 33 gastropod shell species ...

  13. Ghost crabs on a treadmill: Oxygen uptake and haemocyanin ...

    African Journals Online (AJOL)

    1990-04-17

    Apr 17, 1990 ... 1991,26(2). Ghost crabs on a treadmill: Oxygen uptake and haemocyanin oxygen affinity. W.J, Van Aardt ... Ghost crabs Ocypode ceratophthalmus were exercised on a specially constructed treadmill. At a running speed of 13 ...... associated exchange of respiratory gasses in the land hermit crab (Coenobila.

  14. Genetic population structure of the Japanese mitten crab Eriocheir ...

    African Journals Online (AJOL)

    Fragment of 376 bp at the mitochondrial ND2 gene was sequenced for 133 individuals of Japanese mitten crab, Eriocheir japonica from 17 localities of Japan and 30 individuals of Chinese mitten crab, E. sinensis from 2 localities of China. In Japanese mitten crab, sequence comparison of this segment revealed 23 ...

  15. Black yeast-like fungi associated with Lethargic Crab Disease (LCD) in the mangrove-land crab, Ucides cordatus (Ocypodidae)

    NARCIS (Netherlands)

    Vicente, V.A.; Orelis-Ribeiro, R.; Najafzadeh, M.J.; Sun, J.; Schier Guerra, R.; Miesch, S.; Ostrensky, A.; Meis, J.F.; Klaassen, C.H.; de Hoog, G.S.; Boeger, W.A.

    2012-01-01

    Lethargic Crab Disease (LCD) caused extensive epizootic mortality of the mangrove land crab Ucides cordatus (Brachyura: Ocypodidae) along the Brazilian coast, mainly in the Northeastern region. The disease was named after the symptoms of slow movement of infected crabs. Causative agents were

  16. Efficient Monitoring of CRAB Jobs at CMS

    Energy Technology Data Exchange (ETDEWEB)

    Silva, J. M.D. [Sao Paulo, IFT; Balcas, J. [Caltech; Belforte, S. [INFN, Trieste; Ciangottini, D. [INFN, Perugia; Mascheroni, M. [Fermilab; Rupeika, E. A. [Vilnius U.; Ivanov, T. T. [Sofiya U.; Hernandez, J. M. [Madrid, CIEMAT; Vaandering, E. [Fermilab

    2017-11-22

    CRAB is a tool used for distributed analysis of CMS data. Users can submit sets of jobs with similar requirements (tasks) with a single request. CRAB uses a client-server architecture, where a lightweight client, a server, and ancillary services work together and are maintained by CMS operators at CERN. As with most complex software, good monitoring tools are crucial for efficient use and longterm maintainability. This work gives an overview of the monitoring tools developed to ensure the CRAB server and infrastructure are functional, help operators debug user problems, and minimize overhead and operating cost. This work also illustrates the design choices and gives a report on our experience with the tools we developed and the external ones we used.

  17. Novel Geometries for the LHC Crab Cavity

    Energy Technology Data Exchange (ETDEWEB)

    B. Hall, G. Burt, C. Lingwood, R. Rimmer, H. Wang

    2010-05-23

    The planned luminosity upgrade to LHC is likely to necessitate a large crossing angle and a local crab crossing scheme. For this scheme crab cavities align bunches prior to collision. The scheme requires at least four such cavities, a pair on each beam line either side of the interaction point (IP). Upstream cavities initiate rotation and downstream cavities cancel rotation. Cancellation is usually done at a location where the optics has re-aligned the bunch. The beam line separation near the IP necessitates a more compact design than is possible with elliptical cavities such as those used at KEK. The reduction in size must be achieved without an increase in the operational frequency to maintain compatibility with the long bunch length of the LHC. This paper proposes a suitable superconducting variant of a four rod coaxial deflecting cavity (to be phased as a crab cavity), and presents analytical models and simulations of suitable designs.

  18. Novel Geometries for the LHC Crab Cavity

    Energy Technology Data Exchange (ETDEWEB)

    B. Hall,G. Burt,C. Lingwood,Robert Rimmer,Haipeng Wang; Hall, B. [CI Lancaster University (Great Britain); Burt, G. [CI Lancaster University (Great Britain); Lingwood, C. [CI Lancaster University (Great Britain); Rimmer, Robert [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States); Wang, Haipeng [Thomas Jefferson National Accelerator Facility, Newport News, VA (United States)

    2010-05-01

    The planned luminosity upgrade to LHC is likely to necessitate a large crossing angle and a local crab crossing scheme. For this scheme crab cavities align bunches prior to collision. The scheme requires at least four such cavities, a pair on each beam line either side of the interaction point (IP). Upstream cavities initiate rotation and downstream cavities cancel rotation. Cancellation is usually done at a location where the optics has re-aligned the bunch. The beam line separation near the IP necessitates a more compact design than is possible with elliptical cavities such as those used at KEK. The reduction in size must be achieved without an increase in the operational frequency to maintain compatibility with the long bunch length of the LHC. This paper proposes a suitable superconducting variant of a four rod coaxial deflecting cavity (to be phased as a crab cavity), and presents analytical models and simulations of suitable designs.

  19. Efficient monitoring of CRAB jobs at CMS

    Science.gov (United States)

    Silva, J. M. D.; Balcas, J.; Belforte, S.; Ciangottini, D.; Mascheroni, M.; Rupeika, E. A.; Ivanov, T. T.; Hernandez, J. M.; Vaandering, E.

    2017-10-01

    CRAB is a tool used for distributed analysis of CMS data. Users can submit sets of jobs with similar requirements (tasks) with a single request. CRAB uses a client-server architecture, where a lightweight client, a server, and ancillary services work together and are maintained by CMS operators at CERN. As with most complex software, good monitoring tools are crucial for efficient use and longterm maintainability. This work gives an overview of the monitoring tools developed to ensure the CRAB server and infrastructure are functional, help operators debug user problems, and minimize overhead and operating cost. This work also illustrates the design choices and gives a report on our experience with the tools we developed and the external ones we used.

  20. Spider Invasion Across the Galaxy

    Directory of Open Access Journals (Sweden)

    Chung-Yue Hui

    2014-06-01

    Full Text Available The nature of the exotic stellar corpses which reincarnate by consuming their companion is reviewed. Apart from sucking life from their partners, they are actually eating the doomed companions away by their deadly and powerful particle/radiation beams. Such situation resembles that a female “black widow” spider that eats its mate after mating. These celestial zombies are called - Millisecond pulsars (MSPs. In this review article, I will focus on the effort of Fermi Asian Network (FAN in exploring these intricating objects over the last five years. Two special classes of MSPs are particularly striking. Since Fermi Gamma-ray Space Telescope has started surveying the gamma−ray sky, the population of “black widows” has been boosted. Another dramatic class is so-called “redbacks” (Australian cousin of “black widows” which has just emerged in the last few years. These MSPs provide us with a long-sought missing link in understanding the transition between accretion-powered and rotation-powered systems. The strategy of hunting MSPs through mulitwavelength observations of the unidentified Fermi objects is also reviewed.

  1. Spider Invasion Across the Galaxy

    Science.gov (United States)

    Hui, Chung-Yue

    2014-06-01

    The nature of the exotic stellar corpses which reincarnate by consuming their companion is reviewed. Apart from sucking life from their partners, they are actually eating the doomed companions away by their deadly and powerful particle/radiation beams. Such situation resembles that a female ¡°black widow¡± spider that eats its mate after mating. These celestial zombies are called - Millisecond pulsars (MSPs). In this review article, I will focus on the effort of Fermi Asian Network (FAN) in exploring these intricating objects over the last five years. Two special classes of MSPs are particularly striking. Since Fermi Gamma-ray Space Telescope has started surveying the gamma?ray sky, the population of ¡°black widows¡± has been boosted. Another dramatic class is so-called ¡°redbacks¡± (Australian cousin of ¡°black widows¡±) which has just emerged in the last few years. These MSPs provide us with a long-sought missing link in understanding the transition between accretion-powered and rotation-powered systems. The strategy of hunting MSPs through mulitwavelength observations of the unidentified Fermi objects is also reviewed.

  2. Edge effect on weevils and spiders

    Directory of Open Access Journals (Sweden)

    R. Horváth

    2002-05-01

    Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

  3. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

    2014-01-01

    An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  4. Poisonous Spiders: Bites, Symptoms, and Treatment; an Educational Review.

    Science.gov (United States)

    Rahmani, Farzad; Banan Khojasteh, Seyed Mahdi; Ebrahimi Bakhtavar, Hanieh; Rahmani, Farnaz; Shahsavari Nia, Kavous; Faridaalaee, Gholamreza

    2014-01-01

    More than 40,000 species of spiders have been identified in the world. Spider bites is a common problem among people, however few of them are harmful but delay in treatment can cause death. Since the spider bites are risk full to human, they should be taken seriously, especially in endemic areas. Our objective in this review was to study about poisonous spiders and find out treatments of them. Therefore, we collected related articles from PubMed database and Google Scholar. Three important syndromes caused by spider bites are loxoscelism, latrodectism and funnel web spider syndrome. Many treatments are used but much more studies should have done to decrease the mortality. In this review, we describes different venomous spiders according to their appearance, symptoms after their bites and available treatments.

  5. Poisonous Spiders: Bites, Symptoms, and Treatment; an Educational Review

    Directory of Open Access Journals (Sweden)

    Farzad Rahmani

    2014-03-01

    Full Text Available More than 40,000 species of spiders have been identified in the world. Spider bites is a common problem among people, however few of them are harmful but delay in treatment can cause death. Since the spider bites are risk full to human, they should be taken seriously, especially in endemic areas. Our objective in this review was to study about poisonous spiders and find out treatments of them. Therefore we collected related articles from PubMed database and Google Scholar. Three important syndromes caused by spider bites are loxoscelism, latrodectism and funnel web spider syndrome. Many treatments are used but much more studies should have done to decrease the mortality. In this review, we describes different venomous spiders according to their appearance, symptoms after their bites and available treatments. 

  6. Uncovering the structure-function relationship in spider silk

    Science.gov (United States)

    Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

    2018-03-01

    All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

  7. Black widow spider bite: a case study.

    Science.gov (United States)

    Gaisford, Kristine; Kautz, Donald D

    2011-01-01

    This article is a case study of a patient cared for in the hours before her death. After the patient's death, we learned the patient died of a black widow spider bite. This article sheds light on the potential seriousness of this venom and allows for more rapid detection and treatment of those who are unfortunate enough to be bitten. The authors have documented the sequence of events for the patient, outlined the care the patient received, examined the pathophysiology of the body to a spider bite, and then made a passionate appeal for other nurses who work in critical care to do the same with patients in similar situations.

  8. Programming spiders, bots, and aggregators in Java

    CERN Document Server

    Heaton, Jeff

    2006-01-01

    The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

  9. Fish Predation by Semi-Aquatic Spiders: A Global Pattern

    Science.gov (United States)

    Nyffeler, Martin; Pusey, Bradley J.

    2014-01-01

    More than 80 incidences of fish predation by semi-aquatic spiders – observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens – are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2–6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the ‘swimming’ huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders’ body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance. PMID:24940885

  10. Spot market for uranium

    International Nuclear Information System (INIS)

    Colhoun, C.

    1982-01-01

    The spot market is always quoted for the price of uranium because little information is available about long-term contracts. A review of the development of spot market prices shows the same price curve swings that occur with all raw materials. Future long-term contracts will probably be lower to reflect spot market prices, which are currently in the real-value range of $30-$35. An upswing in the price of uranium could come in the next few months as utilities begin making purchases and trading from stockpiles. The US, unlike Europe and Japan, has already reached a supply and demand point where the spot market share is increasing. Forecasters cannot project the market price, they can only predict the presence of an oscillating spot or a secondary market. 5 figures

  11. Characterization of the circulating hemocytes in mud crab (Scylla olivacea) revealed phenoloxidase activity.

    Science.gov (United States)

    Mangkalanan, Seksan; Sanguanrat, Piyachat; Utairangsri, Tanatchaporn; Sritunyalucksana, Kallaya; Krittanai, Chartchai

    2014-05-01

    This study focused on an isolation and characterization of the circulating hemocytes in mud crab, Scylla olivacea. Isolation of specific cell types of hemocytes from crab hemolymph was accomplished by using 60% Percoll density gradient centrifugation. Four separated bands of the hemocytes were successfully obtained. Characterization of these isolated hemocytes by light microscope using trypan blue-rose bengal staining, rose bengal-hematoxilin staining, and phase contrast revealed four distinct types of hemocyte cells. Using their specific morphology and granularity, they were identified as hyaline cell (HC), small granular cell (SGC), large granular cell (LGC) and mixed granular cell (MGC). Transmission electron microscopy (TEM) revealed more details on specific cell size, size of cytoplasmic granule, and nuclear to cytoplasmic ratio, and confirmed the classification. Relative abundance of these cells types in the hemolymph of an adult crab were 15.50±8.22% for HC, 55.50±7.15% for SGC, 13.50±5.28% for LGC, and 15.50±3.50% for MGC. Proteomic analysis of protein expression for each specific cell types by two-dimensional electrophoresis identified two highly abundant proteins, prophenoloxidase (ProPO) and peroxinectin in LGC. Determination of phenoloxidase (PO) activity in each isolated cell types using in vitro and in situ chemical assays confirmed the presence of PO activity only in LGC. Based on an increased PO activity of crab hemolymph during the course of White Spot Syndrome Virus (WSSV) infection, these results suggest that prophenoloxidase pathway was employed for host defense mechanism against WSSV and it may link to the role of large granular hemocyte. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Dominance and population structure of freshwater crabs ...

    African Journals Online (AJOL)

    1997-02-06

    Feb 6, 1997 ... CHASE, l.D. 1974. Models of hierarchy formation in animal societies. Behav. Sct. 19: 374-382. DU PREEZ, H.H., STEENKAMP, V.E. & SCHOONBEE, HJ. 1993. Bioaccumulation of zinc and lead in selected tissues and organs of the freshwater crab. PotamonQutes warreni. Sci. Tot. Environ. Suppl.: 469-478.

  13. Ocean acidification impairs crab foraging behaviour.

    Science.gov (United States)

    Dodd, Luke F; Grabowski, Jonathan H; Piehler, Michael F; Westfield, Isaac; Ries, Justin B

    2015-07-07

    Anthropogenic elevation of atmospheric CO2 is driving global-scale ocean acidification, which consequently influences calcification rates of many marine invertebrates and potentially alters their susceptibility to predation. Ocean acidification may also impair an organism's ability to process environmental and biological cues. These counteracting impacts make it challenging to predict how acidification will alter species interactions and community structure. To examine effects of acidification on consumptive and behavioural interactions between mud crabs (Panopeus herbstii) and oysters (Crassostrea virginica), oysters were reared with and without caged crabs for 71 days at three pCO2 levels. During subsequent predation trials, acidification reduced prey consumption, handling time and duration of unsuccessful predation attempt. These negative effects of ocean acidification on crab foraging behaviour more than offset any benefit to crabs resulting from a reduction in the net rate of oyster calcification. These findings reveal that efforts to evaluate how acidification will alter marine food webs should include quantifying impacts on both calcification rates and animal behaviour. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  14. Swimming of the pea crab (Pinnotheres pisum)

    NARCIS (Netherlands)

    Versteegh, C.P.C.; Muller, M.

    2014-01-01

    Aquatic organisms have to deal with different hydrodynamic regimes, depending on their size and speed during locomotion. The pea crab swims by beating the third and fourth pereiopod on opposite sides as pairs. Using particle tracking velocimetry and high-speed video recording, we quantify the

  15. Corneal laceration caused by river crab

    Directory of Open Access Journals (Sweden)

    Vinuthinee N

    2015-01-01

    Full Text Available Naidu Vinuthinee,1,2 Anuar Azreen-Redzal,1 Jaafar Juanarita,1 Embong Zunaina2 1Department of Ophthalmology, Hospital Sultanah Bahiyah, Alor Setar, 2Department of Ophthalmology, School of Medical Sciences, Universiti Sains Malaysia, Kubang Kerian, Malaysia Abstract: A 5-year-old boy presented with right eye pain associated with tearing and photophobia of 1-day duration. He gave a history of playing with a river crab when suddenly the crab clamped his fingers. He attempted to fling the crab off, but the crab flew and hit his right eye. Ocular examination revealed a right eye corneal ulcer with clumps of fibrin located beneath the corneal ulcer and 1.6 mm level of hypopyon. At presentation, the Seidel test was negative, with a deep anterior chamber. Culture from the corneal scrapping specimen grew Citrobacter diversus and Proteus vulgaris, and the boy was treated with topical gentamicin and ceftazidime eyedrops. Fibrin clumps beneath the corneal ulcer subsequently dislodged, and revealed a full-thickness corneal laceration wound with a positive Seidel test and shallow anterior chamber. The patient underwent emergency corneal toileting and suturing. Postoperatively, he was treated with oral ciprofloxacin 250 mg 12-hourly for 1 week, topical gentamicin, ceftazidime, and dexamethasone eyedrops for 4 weeks. Right eye vision improved to 6/9 and 6/6 with pinhole at the 2-week follow-up following corneal suture removal. Keywords: corneal ulcer, pediatric trauma, ocular injury

  16. Reversible Myocarditis after Black Widow Spider Envenomation

    Directory of Open Access Journals (Sweden)

    Tarek Dendane

    2012-01-01

    Full Text Available Black widow spiders can cause variable clinical scenarios from local damage to very serious conditions including death. Acute myocardial damage is rarely observed and its prognostic significance is not known. We report a rare case of a 35-year-old man who developed an acute myocarditis with cardiogenic pulmonary edema requiring mechanical ventilation caused by black widow spider's envenomation. The patient was previously healthy. The clinical course was associated with systemic and cardiovascular complaints. His electrocardiogram revealed ST-segment elevation with T-wave amplitude. The plasma concentrations of cardiac enzymes were elevated. His first echocardiography showed hypokinesis of the left ventricle (left ventricle ejection fraction 48%. Magnetic resonance imaging showed also focal myocardial injury of the LV. There was progressive improvement in cardiac traces, biochemical and echocardiographical values (second left ventricle ejection fraction increased to 50%. Myocardial involvement after a spider bite is rare and can cause death. The exact mechanism of this myocarditis is unknown. We report a rare case of acute myocarditis with cardiogenic pulmonary edema requiring mechanical ventilation caused by black widow spider's envenomation. We objectively documented progressive clinical and electrical improvement.

  17. Reversible myocarditis after black widow spider envenomation.

    Science.gov (United States)

    Dendane, Tarek; Abidi, Khalid; Madani, Naoufel; Benthami, Asmae; Gueddari, Fatima-Zohra; Abouqal, Redoune; Zeggwagh, Amine-Ali

    2012-01-01

    Black widow spiders can cause variable clinical scenarios from local damage to very serious conditions including death. Acute myocardial damage is rarely observed and its prognostic significance is not known. We report a rare case of a 35-year-old man who developed an acute myocarditis with cardiogenic pulmonary edema requiring mechanical ventilation caused by black widow spider's envenomation. The patient was previously healthy. The clinical course was associated with systemic and cardiovascular complaints. His electrocardiogram revealed ST-segment elevation with T-wave amplitude. The plasma concentrations of cardiac enzymes were elevated. His first echocardiography showed hypokinesis of the left ventricle (left ventricle ejection fraction 48%). Magnetic resonance imaging showed also focal myocardial injury of the LV. There was progressive improvement in cardiac traces, biochemical and echocardiographical values (second left ventricle ejection fraction increased to 50%). Myocardial involvement after a spider bite is rare and can cause death. The exact mechanism of this myocarditis is unknown. We report a rare case of acute myocarditis with cardiogenic pulmonary edema requiring mechanical ventilation caused by black widow spider's envenomation. We objectively documented progressive clinical and electrical improvement.

  18. Spiders Tune Glue Viscosity to Maximize Adhesion.

    Science.gov (United States)

    Amarpuri, Gaurav; Zhang, Ci; Diaz, Candido; Opell, Brent D; Blackledge, Todd A; Dhinojwala, Ali

    2015-11-24

    Adhesion in humid conditions is a fundamental challenge to both natural and synthetic adhesives. Yet, glue from most spider species becomes stickier as humidity increases. We find the adhesion of spider glue, from five diverse spider species, maximizes at very different humidities that matches their foraging habitats. By using high-speed imaging and spreading power law, we find that the glue viscosity varies over 5 orders of magnitude with humidity for each species, yet the viscosity at maximal adhesion for each species is nearly identical, 10(5)-10(6) cP. Many natural systems take advantage of viscosity to improve functional response, but spider glue's humidity responsiveness is a novel adaptation that makes the glue stickiest in each species' preferred habitat. This tuning is achieved by a combination of proteins and hygroscopic organic salts that determines water uptake in the glue. We therefore anticipate that manipulation of polymer-salts interaction to control viscosity can provide a simple mechanism to design humidity responsive smart adhesives.

  19. Hey! A Black Widow Spider Bit Me!

    Science.gov (United States)

    ... as soon as you can because they can make you very sick. With an adult's help, wash the bite well with soap and water. Then apply an ice pack to the bite, and try to elevate the area and keep it still to help prevent the ... black widows, you'll want to make sure that's the kind of spider that bit ...

  20. The aerodynamic signature of running spiders.

    Directory of Open Access Journals (Sweden)

    Jérôme Casas

    Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

  1. Mononucleosis spot test

    Science.gov (United States)

    Monospot test; Heterophile antibody test; Heterophile agglutination test; Paul-Bunnell test; Forssman antibody test ... The mononucleosis spot test is done when symptoms of mononucleosis are ... Fatigue Fever Large spleen (possibly) Sore throat Tender ...

  2. Grooming behaviors and gill fouling in the commercially important blue crab (Callinectes sapidus and stone crab (Menippe mercenaria

    Directory of Open Access Journals (Sweden)

    Jen L. Wortham

    2017-10-01

    Full Text Available Abstract Grooming behaviors reduce fouling of body regions. In decapods, grooming time budgets, body regions groomed, and grooming appendages are known in several species; however, little data exists on brachyuran crabs. In this study, grooming behaviors of two commercially important crabs were documented (blue crabs: Callinectes sapidus Rathbun, 1896; stone crabs: Menippe mercenaria Say, 1818. These crabs are harvested by fishermen and knowing their grooming behaviors is valuable, as clean crabs are preferred by consumers and the stone crab fishery consequence of removing one cheliped to grooming behaviors is unknown. Crabs were observed individually and agonistically to determine how grooming behaviors vary in the presence of another conspecific. Both species frequently use their maxillipeds and groom, with the gills being cleaned by epipods. Respiratory and sensory structures were groomed frequently in both species. Removal of a grooming appendage resulted in higher fouling levels in the gills, indicating that grooming behaviors do remove fouling. Overall, stone crabs had a larger individual time budget for grooming, but agonistic grooming time budgets were similar. Stone crab chelipeds are used in grooming, especially cleaning the other cheliped. The chelipeds are not the main grooming appendage; however, implications of losing one cheliped may have large impacts.

  3. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Science.gov (United States)

    Zhong, Yunhua; Song, Bo; Mo, Guoxiang; Yuan, Mingwei; Li, Hongli; Wang, Ping; Yuan, Minglong; Lu, Qiumin

    2014-01-01

    Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  4. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  5. Stress/Strain Characteristics and Biochemical Correlates of Spider Silks

    Science.gov (United States)

    1999-10-18

    do aminoacid analysis on silk samples measured and collected from the same spiders. Background to reports 1 and 2: Dr Kaplan left Natick during the...properties (shown by us) as well as measurable effects on silk aminoacid compositions (C Craig pers. comm). Thus after initial samples of silks from a...variability could be the state of nutrition of the spider. Starvation has been shown to have an effect on the web- geometry in orb-weaving spiders 2; and

  6. Spider silk: a novel optical fibre for biochemical sensing

    OpenAIRE

    Hey Tow, Kenny; Chow, Desmond; Vollrath, Fritz; Dicaire, Isabelle; Gheysens, Tom; Thévenaz, Luc

    2015-01-01

    Whilst being thoroughly used in the textile industry and biomedical sector, silk has not yet been exploited for fibre optics-based sensing although silk fibres directly obtained from spiders can guide light and have shown early promises to being sensitive to some solvents. In this communication, a pioneering optical fibre sensor based on spider silk is reported, demonstrating for the first time the use of spider silk as an optical fibre sensor to detect polar solvents such as water, ammonia a...

  7. Reconstructing web evolution and spider diversification in the molecular era.

    Science.gov (United States)

    Blackledge, Todd A; Scharff, Nikolaj; Coddington, Jonathan A; Szüts, Tamas; Wenzel, John W; Hayashi, Cheryl Y; Agnarsson, Ingi

    2009-03-31

    The evolutionary diversification of spiders is attributed to spectacular innovations in silk. Spiders are unique in synthesizing many different kinds of silk, and using silk for a variety of ecological functions throughout their lives, particularly to make prey-catching webs. Here, we construct a broad higher-level phylogeny of spiders combining molecular data with traditional morphological and behavioral characters. We use this phylogeny to test the hypothesis that the spider orb web evolved only once. We then examine spider diversification in relation to different web architectures and silk use. We find strong support for a single origin of orb webs, implying a major shift in the spinning of capture silk and repeated loss or transformation of orb webs. We show that abandonment of costly cribellate capture silk correlates with the 2 major diversification events in spiders (1). Replacement of cribellate silk by aqueous silk glue may explain the greater diversity of modern orb-weaving spiders (Araneoidea) compared with cribellate orb-weaving spiders (Deinopoidea) (2). Within the "RTA clade," which is the sister group to orb-weaving spiders and contains half of all spider diversity, >90% of species richness is associated with repeated loss of cribellate silk and abandonment of prey capture webs. Accompanying cribellum loss in both groups is a release from substrate-constrained webs, whether by aerially suspended webs, or by abandoning webs altogether. These behavioral shifts in silk and web production by spiders thus likely played a key role in the dramatic evolutionary success and ecological dominance of spiders as predators of insects.

  8. Predatory blue crabs induce stronger nonconsumptive effects in eastern oysters Crassostrea virginica than scavenging blue crabs

    Directory of Open Access Journals (Sweden)

    Avery E. Scherer

    2017-02-01

    Full Text Available By influencing critical prey traits such as foraging or habitat selection, predators can affect entire ecosystems, but the nature of cues that trigger prey reactions to predators are not well understood. Predators may scavenge to supplement their energetic needs and scavenging frequency may vary among individuals within a species due to preferences and prey availability. Yet prey reactions to consumers that are primarily scavengers versus those that are active foragers have not been investigated, even though variation in prey reactions to scavengers or predators might influence cascading nonconsumptive effects in food webs. Oysters Crassostrea virginica react to crab predators by growing stronger shells. We exposed oysters to exudates from crabs fed live oysters or fed aged oyster tissue to simulate scavenging, and to controls without crab cues. Oysters grew stronger shells when exposed to either crab exudate, but their shells were significantly stronger when crabs were fed live oysters. The stronger response to predators than scavengers could be due to inherent differences in diet cues representative of reduced risk in the presence of scavengers or to degradation of conspecific alarm cues in aged treatments, which may mask risk from potential predators subsisting by scavenging.

  9. Blood Collection from the American Horseshoe Crab, Limulus Polyphemus

    OpenAIRE

    Armstrong, Peter; Conrad, Mara

    2008-01-01

    The horseshoe crab has the best-characterized immune system of any long-lived invertebrate. The study of immunity in horseshoe crabs has been facilitated by the ease in collecting large volumes of blood and from the simplicity of the blood. Horseshoe crabs show only a single cell type in the general circulation, the granular amebocyte. The plasma has the salt content of sea water and only three abundant proteins, hemocyanin, the respiratory protein, the C-reactive proteins, which function in ...

  10. The canopy spiders (Araneae of the floodplain forest in Leipzig

    Directory of Open Access Journals (Sweden)

    Otto, Stefan

    2010-10-01

    Full Text Available The canopy spiders of the floodplain forest in Leipzig have become a focus of ecological studies in recent years. In 2006 we sampled 30 tree canopies in the ‘Burgaue’ nature reserve with pyrethrum knock-down fogging, recording 502 adult spiders belonging to 48 species and 11 families. Based on these data and the results of a previous fogging study, the studied spider community was dominated by forest and forest-edge species with a preference for the shrub and canopy strata as well as by spiders of the web spider feeding guild. The community structure was typical for arboreal spider communities from northern temperate forests but very different from communities in the tropics. Species richness and evenness were similar to the old growth near-primary Białowieża Forest in Poland. The checklist of 96 canopy spider species of the floodplain forest of Leipzig includes 54 additions to the spider fauna of Leipzig and vicinity by recent canopy studies and eight first canopy records for Leipzig from our field work. The theridiid Dipoena torva (Thorell, 1875 was recorded for the first time in Saxony. The floodplain forest of Leipzig sustains a large and species-rich arboreal spider community and is thus a valuable habitat for a large proportion of endangered species (12%.

  11. Book gill development in embryos and first and second instars of the horseshoe crab Limulus polyphemus L. (Chelicerata, Xiphosura).

    Science.gov (United States)

    Farley, Roger D

    2010-09-01

    The scanning electron microscope (SEM) was used to study the development of the opisthosomal appendages and book gills of the horseshoe crab, Limulus polyphemus. Later embryonic stages were examined as well as the first and second instars. The observations are compared with a much earlier light microscopic description of book gill development in the horseshoe crab and with book lung development in scorpion embryos and first and second instars in a recent study with SEM. After the third embryonic molt in the horseshoe crab, the opisthosomal appendages are of sufficient size so they could be fractured or dissected open so internal cells and other structures could be examined. The opisthosomal appendages and book gill lamellae of first and second instars were also opened. The observations support the earlier histological report that the gill lamellae are a hypodermal outgrowth from the posterior surface of the preceding branchial appendages. The genital operculum, branchial appendages and gill lamellae are very thin and consist of external cuticle, hypodermis and space holders. The latter help hold the cuticle walls in place so hemolymph can flow through the narrow channels. The space holders are formed from cell processes that extend into the lumen from the hypodermis just inside the external cuticle. In the recent SEM study in scorpion embryos and in some histological investigations in spider embryos, the book lung lamellae are formed by alignment of cells from an invaginated sac or mass of cells. This clearly differs from the mode of formation of gill lamellae as observed in this and earlier investigations. These reports of differences in embryology refine but do not preclude hypotheses about book gill/book lung homology since addition, deletion or modification of ancestral features often occur for the benefit of the embryos and larvae. Copyright © 2010 Elsevier Ltd. All rights reserved.

  12. Role of environmental exposure to spider mites in the sensitization and the clinical manifestation of asthma and rhinitis in children and adolescents living in rural and urban areas.

    Science.gov (United States)

    Kim, Y-K; Chang, Y-S; Lee, M-H; Hong, S-C; Bae, J-M; Jee, Y-K; Chun, B-R; Cho, S-H; Min, K-U; Kim, Y-Y

    2002-09-01

    Spider mites such as the citrus red mite and the two-spotted spider mite have been demonstrated to be important allergens for fruit cultivating farmers. To evaluate the role of environmental exposure to spider mites in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in urban and rural areas. A total of 16,624 subjects (aged 7 to 18 years) living in urban (metropolitan and non-metropolitan) and rural areas (apple orchards and citrus orchards) in Korea were evaluated by questionnaire and skin prick test for 11 common aeroallergens, including citrus red mite (CRM) and two-spotted spider mite (TSM). The positive skin response rates to TSM were 4.2% of 1,563 metropolitan subjects, 3.8% of 5,568 non-metropolitan subjects and 6.5% of 1,464 subjects living nearby apple farms, and that to CRM 15.6% of 8,029 living nearby citrus farms. The prevalence of current wheeze and rhinitis as reported on a questionnaire was higher among those with a history of visiting fruit farms once or more per year than among those without it (10% vs. 7.1%, 32.8% vs. 26.7%, for wheezing and rhinitis, respectively). Among those with wheezing or rhinitis, the positive skin responses to TSM or CRM were also higher among those with a history of visiting fruit farms than among those without one (11.2% vs. 6.6%, 13.0% vs. 6.6%, respectively), although the positive skin responses to house dust mites were similar in the both groups. Spider mites are common sensitizing allergens in children and adolescents exposed to them, and environmental exposure to these mites may represent an important risk factor in the sensitization and the clinical manifestations of asthma and rhinitis in children and adolescents living in rural and urban areas.

  13. Invasive Crabs in the Barents Sea

    DEFF Research Database (Denmark)

    Kaiser, Brooks; Fernandez, Linda; Kourantidou, Melina

    compare differences in the ecology and economics of the two species to enhance understanding of the trade-offs inherent in managing these economically profitable yet risky invaders. We then expand the application by using these ongoing invasions to illustrate the anticipated disruptions (with potentially......The recent invasions of the red king crab (RKC) and the snow crab (SC) in the Barents Sea represent the sorts of integrated ecological and economic shifts we may expect as climate change affects arctic seas. Economic incentives and ecological unknowns have combined to change the current...... both positive and negative impacts) from other introductions or range expansions of commercial species and the management steps that should be taken at earlier stages, including monitoring and preventive measures, in the changing ecological processes to minimize negative impacts....

  14. Status of the ILC Crab Cavity Development

    Energy Technology Data Exchange (ETDEWEB)

    Burt, G.; Dexter, A.; /Cockcroft Inst. Accel. Sci. Tech.; Beard, C.; Goudket, P.; McIntosh, P.; /Daresbury; Bellantoni, L.; /Fermilab; Grimm, T.; Li, Z.; Xiao, L.; /SLAC

    2011-10-20

    The International Linear Collider (ILC) will require two dipole cavities to 'crab' the electron and positron bunches prior to their collision. It is proposed to use two 9 cell SCRF dipole cavities operating at a frequency of 3.9 GHz, with a transverse gradient of 3.8MV/m in order to provide the required transverse kick. Extensive numerical modelling of this cavity and its couplers has been performed. Aluminium prototypes have been manufactured and tested to measure the RF properties of the cavity and couplers. In addition single cell niobium prototypes have been manufactured and tested in a vertical cryostat. The International Collider (ILC) [1] collides bunches of electrons and positrons at a crossing angle of 14 mrad. The angle between these bunches causes a loss in luminosity due to geometric effects [2]. The luminosity lost from this geometric effect can be recovered by rotating the bunches into alignment prior to collision. One possible method of rotating the bunches is to use a crab cavity [3]. A crab cavity is a transverse defecting cavity, where the phase of the cavity is such that the head and tail of the bunch receive equal and opposite kicks. As the bunches are only 500 nm wide in the horizontal plane, the cavity phase must be strictly controlled to avoid the bunch centre being deflected too much. In order to keep the phase stability within the required limits it is required that the cavity be superconducting to avoid thermal effects in both the cavity and its RF source. At the location of the crab cavity in the ILC there is only 23 cm separation between the centre of the cavity and the extraction line, hence the cavity must be small enough to fit in this space. This, along with the difficulty of making high frequency SRF components, set the frequency of the cavity to 3.9 GHz.

  15. Multiband observations of the Crab Nebula

    International Nuclear Information System (INIS)

    Krassilchtchikov, A M; Bykov, A M; Castelletti, G M; Dubner, G M; Kargaltsev, O Yu; Pavlov, G G

    2017-01-01

    Results of simultaneous imaging of the Crab Nebula in the radio (JVLA), optical ( HST ), and X-ray ( Chandra ) bands are presented. The images show a variety of small-scale structures, including wisps mainly located to the north-west of the pulsar and knots forming a ring-like structure associated with the termination shock of the pulsar wind. The locations of the structures in different bands do not coincide with each other. (paper)

  16. Prevalence, characterization and sources of Listeria monocytogenes in blue crab (Callinectus sapidus) meat and blue crab processing plants.

    Science.gov (United States)

    Pagadala, Sivaranjani; Parveen, Salina; Rippen, Thomas; Luchansky, John B; Call, Jeffrey E; Tamplin, Mark L; Porto-Fett, Anna C S

    2012-09-01

    Seven blue crab processing plants were sampled to determine the prevalence and sources of Listeria spp. and Listeria monocytogenes for two years (2006-2007). A total of 488 raw crabs, 624 cooked crab meat (crab meat) and 624 environmental samples were tested by standard methods. Presumptive Listeria spp. were isolated from 19.5% of raw crabs, 10.8% of crab meat, and 69.5% of environmental samples. L. monocytogenes was isolated from 4.5% of raw crabs, 0.2% of crab meat, and 2.1% of environmental samples. Ninety-seven percent of the isolates were resistant to at least one of the ten antibiotics tested. Eight different serotypes were found among 76 L. monocytogenes isolates tested with the most common being 4b, 1/2b and 1/2a. Automated EcoRI ribotyping differentiated 11 ribotypes among the 106 L. monocytogenes isolates. Based on ribotyping analysis, the distribution of the ribotypes in each processing plant had a unique contamination pattern. A total of 92 ApaI and 88 AscI pulsotypes among the 106 L. monocytogenes isolates were found and distinct pulsotypes were observed in raw crab, crab meat and environmental samples. Ribotypes and serotypes recovered from crab processing plants included subtypes that have been associated with listeriosis cases in other food outbreaks. Our findings suggest that molecular methods may provide critical information about sources of L. monocytogenes in crab processing plants and will augment efforts to improve food safety control strategies such as targeting specific sources of contamination and use of aggressive detergents prior to sanitizing. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Araneae Sloveniae: a national spider species checklist

    Science.gov (United States)

    Kostanjšek, Rok; Kuntner, Matjaž

    2015-01-01

    Abstract The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe. PMID:25632258

  18. Araneae Sloveniae: a national spider species checklist

    Directory of Open Access Journals (Sweden)

    Rok Kostanjšek

    2015-01-01

    Full Text Available The research of the spider fauna of Slovenia dates back to the very beginning of binomial nomenclature, and has gone through more and less prolific phases with authors concentrating on taxonomy, faunistics, ecology and zoogeographic reviews. Although the body of published works is remarkable for a small nation, the faunistic data has remained too scattered for a thorough understanding of regional biotic diversity, for comparative and ecological research, and for informed conservation purposes. A national checklist is long overdue. Here, a critical review of all published records in any language is provided. The species list currently comprises 738 species, is published online at http://www.bioportal.si/katalog/araneae.php under the title Araneae Sloveniae, and will be updated in due course. This tool will fill the void in cataloguing regional spider faunas and will facilitate further araneological research in central and southern Europe.

  19. CMS distributed data analysis with CRAB3

    Science.gov (United States)

    Mascheroni, M.; Balcas, J.; Belforte, S.; Bockelman, B. P.; Hernandez, J. M.; Ciangottini, D.; Konstantinov, P. B.; Silva, J. M. D.; Ali, M. A. B. M.; Melo, A. M.; Riahi, H.; Tanasijczuk, A. J.; Yusli, M. N. B.; Wolf, M.; Woodard, A. E.; Vaandering, E.

    2015-12-01

    The CMS Remote Analysis Builder (CRAB) is a distributed workflow management tool which facilitates analysis tasks by isolating users from the technical details of the Grid infrastructure. Throughout LHC Run 1, CRAB has been successfully employed by an average of 350 distinct users each week executing about 200,000 jobs per day. CRAB has been significantly upgraded in order to face the new challenges posed by LHC Run 2. Components of the new system include 1) a lightweight client, 2) a central primary server which communicates with the clients through a REST interface, 3) secondary servers which manage user analysis tasks and submit jobs to the CMS resource provisioning system, and 4) a central service to asynchronously move user data from temporary storage in the execution site to the desired storage location. The new system improves the robustness, scalability and sustainability of the service. Here we provide an overview of the new system, operation, and user support, report on its current status, and identify lessons learned from the commissioning phase and production roll-out.

  20. The Porcelain Crab Transcriptome and PCAD, the Porcelain Crab Microarray and Sequence Database

    Energy Technology Data Exchange (ETDEWEB)

    Tagmount, Abderrahmane; Wang, Mei; Lindquist, Erika; Tanaka, Yoshihiro; Teranishi, Kristen S.; Sunagawa, Shinichi; Wong, Mike; Stillman, Jonathon H.

    2010-01-27

    Background: With the emergence of a completed genome sequence of the freshwater crustacean Daphnia pulex, construction of genomic-scale sequence databases for additional crustacean sequences are important for comparative genomics and annotation. Porcelain crabs, genus Petrolisthes, have been powerful crustacean models for environmental and evolutionary physiology with respect to thermal adaptation and understanding responses of marine organisms to climate change. Here, we present a large-scale EST sequencing and cDNA microarray database project for the porcelain crab Petrolisthes cinctipes. Methodology/Principal Findings: A set of ~;;30K unique sequences (UniSeqs) representing ~;;19K clusters were generated from ~;;98K high quality ESTs from a set of tissue specific non-normalized and mixed-tissue normalized cDNA libraries from the porcelain crab Petrolisthes cinctipes. Homology for each UniSeq was assessed using BLAST, InterProScan, GO and KEGG database searches. Approximately 66percent of the UniSeqs had homology in at least one of the databases. All EST and UniSeq sequences along with annotation results and coordinated cDNA microarray datasets have been made publicly accessible at the Porcelain Crab Array Database (PCAD), a feature-enriched version of the Stanford and Longhorn Array Databases.Conclusions/Significance: The EST project presented here represents the third largest sequencing effort for any crustacean, and the largest effort for any crab species. Our assembly and clustering results suggest that our porcelain crab EST data set is equally diverse to the much larger EST set generated in the Daphnia pulex genome sequencing project, and thus will be an important resource to the Daphnia research community. Our homology results support the pancrustacea hypothesis and suggest that Malacostraca may be ancestral to Branchiopoda and Hexapoda. Our results also suggest that our cDNA microarrays cover as much of the transcriptome as can reasonably be captured in

  1. Cotton-wool spots.

    Science.gov (United States)

    Brown, G C; Brown, M M; Hiller, T; Fischer, D; Benson, W E; Magargal, L E

    1985-01-01

    A series of 24 consecutive patients presenting with a fundus picture characterized by a predominance of cotton-wool spots, or a single cotton-wool spot, is reported. Excluded were patients with known diabetes mellitus. Etiologic conditions found included previously undiagnosed diabetes mellitus in five patients, systemic hypertension in five patients, cardiac valvular disease in two patients, radiation retinopathy in two patients, and severe carotid artery obstruction in two patients. Dermatomyositis, systemic lupus erythematosus, polyarteritis nodosa, leukemia, AIDS, Purtscher's retinopathy, metastatic carcinoma, intravenous drug abuse, partial central retinal artery obstruction, and giant cell arteritis were each found in one patient. In only one patient did a systemic workup fail to reveal an underlying cause. The presence of even one cotton-wool spot in an otherwise normal fundus necessitates an investigation to ascertain systemic etiologic factors.

  2. Red-back spider (Latrodectus hasselti) antivenom prevents the toxicity of widow spider venoms.

    Science.gov (United States)

    Graudins, A; Padula, M; Broady, K; Nicholson, G M

    2001-02-01

    Widow spiders of the genus Latrodectus are found worldwide and produce similar clinical envenomation syndromes. In Australia, red-back spider antivenom (RBS-AV) is effective therapy for Latrodectus hasselti envenomation and it has been reported to reverse envenomation by other widow spiders. This study assessed the efficacy of RBS-AV in preventing in vitro and in vivo toxicity of widow spider venoms of North America and Europe. The binding of RBS-AV to alpha-latrotoxin and Latrodectus venoms (Latrodectus spp mactans, hesperus, lugubris, tredecimguttatus, hasselti) was assayed using Western blotting. Prevention of in vitro toxicity to alpha-latrotoxin and the same venoms was tested by pretreating an isolated chick biventer cervicis nerve-muscle preparation with RBS-AV. Prevention of in vivo toxicity was determined by a lethality study in male Balb/c mice (2.5 to 5x median lethal dose [LD50]) or alpha-latrotoxin (10x LD50) preincubated with antivenom or without RBS-AV (control). In Western blots, RBS-AV bound to alpha-latrotoxin and similar widow spider proteins in all venoms tested, indicating antigenic similarity with proteins found in RBS venom. Antivenom prevented the typical in vitro muscle contracture and loss of twitch tension seen with alpha-latrotoxin and the venoms tested. Control mice rapidly developed signs of envenomation, but mice treated with RBS-AV remained free of signs of envenomation. RBS-AV prevented both in vitro and in vivo toxicity from Latrodectus venoms and alpha-latrotoxin in mice. These data suggest that RBS-AV may be clinically effective in the treatment of envenomation resulting from the bite of other widow spiders.

  3. Disentangling the phylogenetic and ecological components of spider phenotypic variation.

    Directory of Open Access Journals (Sweden)

    Thiago Gonçalves-Souza

    Full Text Available An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables to the variation in spider body size and shape by comparing spiders at different scales: (i between bromeliads and dicot plants (i.e., habitat scale and (ii among bromeliads with distinct architectural features (i.e., microhabitat scale. We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species and ecological components (that express trait values independent of phylogenetic relationships. At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

  4. Black widow spider envenomation in pregnancy.

    Science.gov (United States)

    Wolfe, Michael D; Myers, Orrin; Caravati, E Martin; Rayburn, William F; Seifert, Steven A

    2011-01-01

    Little data exist regarding the optimal treatment and outcomes of pregnancies complicated by black widow spider envenomation. Our objective is to evaluate the clinical effects, medical outcomes, and treatment differences between pregnant and nonpregnant women. This observational study is based on a review of the database maintained by the American Association of Poison Control Centers from 2003 to 2007. Of the 12,640 human black widow spider envenomations reported at 61 poison centers in the United States, 3194 (25.3%) involved women of reproductive age, defined as age 15-45 years of age, with 97 (3.0% of reproductive-age women) being pregnant. Comparing pregnant and nonpregnant women, there were no significant differences in recommended or administered treatments. Pregnant women were more likely than nonpregnant women (OR: 1.84, 95% CI: 1.20-2.83) to have outcomes coded as minor, moderate, or major rather than no effect. Significantly higher percentages of pregnant patients were treated at a healthcare facility where they were either released (36.1% vs. 19.9%, p  Black widow spider envenomation is a rare occurrence in pregnant women and the short-term outcomes appear to be favorable.

  5. Host selection by a kleptobiotic spider

    Science.gov (United States)

    Hénaut, Yann; Delme, Juliette; Legal, Luc; Williams, Trevor

    2005-02-01

    Why do kleptobiotic spiders of the genus Argyrodes seem to be associated with spiders of the genus Nephila worldwide? Observations following introduction of experimental insect prey of different sizes and weights on to host webs revealed that: (1) small prey are more effectively retained on the web of Nephila clavipes than on the web of another common host, Leucauge venusta. (2) N. clavipes did not consume small prey that accumulated on the web whereas larger, heavier prey were enveloped and stored. (3) We observed clear partitioning of prey items between N. clavipes and Argyrodes spp.; diet selection by Argyrodes did not overlap with that of N. clavipes but closely overlapped with that of L. venusta. (4) L. venusta responds very quickly to prey impact whereas N. clavipes is slower, offering a temporal window of opportunity for Argyrodes foraging. (5) The ability of L. venusta to detect and respond to small items also means that it acts aggressively to Argyrodes spp., whereas N. clavipes does not. Consequently, food-acquisition behaviours of Argyrodes were clearly less risky with N. clavipes compared with L. venusta. We conclude that when a kleptobiotic organism has a choice of various host species, it will opt for the least risky host that presents the highest rate of availability of food items. The fact that Nephila species present such characteristics explains the worldwide association with Argyrodes kleptobiotic spiders.

  6. Troponin elevation after black widow spider envenomation.

    Science.gov (United States)

    Bush, Sean P; Davy, J Veeran

    2015-09-01

    Black widow spider envenomation generally results in self-limiting pain that can be treated in the emergency department (ED) with analgesics and benzodiazepines, usually with no further intervention. Occasionally, a patient has to be admitted or treated with antivenom for refractory pain or a venom-induced complication. We present the case of an 84-year-old man who presented to our ED with chest pain and dyspnea after being bitten on the foot by a western black widow spider (Lactrodectus hesperus). His initial cardiac troponin I (cTnI) was elevated at 0.07 ng/ml and continued to rise to a peak of 0.17 ng/ml. He also had rhabdomyolysis, another uncommon complication of black widow envenomation. An elevated cTnI generally signifies myocardial injury and is rarely seen after black widow envenomation. We discuss the possible etiologies for an elevated cardiac biomarker, in this context, and review potentially serious complications of widow spider envenomation presenting with chest symptoms and an elevated cardiac biomarker.

  7. Nanofibre production in spiders without electric charge.

    Science.gov (United States)

    Joel, Anna-Christin; Baumgartner, Werner

    2017-06-15

    Technical nanofibre production is linked to high voltage, because nanofibres are typically produced by electrospinning. In contrast, spiders have evolved a way to produce nanofibres without high voltage. These spiders are called cribellate spiders and produce nanofibres within their capture thread production. It is suggested that their nanofibres become frictionally charged when brushed over a continuous area on the calamistrum, a comb-like structure at the metatarsus of the fourth leg. Although there are indications that electrostatic charges are involved in the formation of the thread structure, final proof is missing. We proposed three requirements to validate this hypothesis: (1) the removal of any charge during or after thread production has an influence on the structure of the thread; (2) the characteristic structure of the thread can be regenerated by charging; and (3) the thread is attracted to or repelled from differently charged objects. None of these three requirements were proven true. Furthermore, mathematical calculations reveal that even at low charges, the calculated structural assembly of the thread does not match the observed reality. Electrostatic forces are therefore not involved in the production of cribellate capture threads. © 2017. Published by The Company of Biologists Ltd.

  8. Potential Impact of Submarine Power Cables on Crab Harvest

    Science.gov (United States)

    Bull, A. S.; Nishimoto, M.

    2016-02-01

    Offshore renewable energy installations convert wave or wind energy to electricity and transfer the power to shore through transmission cables laid on or buried beneath the seafloor. West coast commercial fishermen, who harvest the highly prized Dungeness crab (Metacarcinus magister) and the rock crab (Cancer spp.), are concerned that the interface of crabs and electromagnetic fields (EMF) from these cables will present an electrified fence on the seafloor that their target resource will not cross. Combined with the assistance of professional fishermen, submarine transmission cables that electrify island communities and offshore oil platforms in the eastern Pacific provide an opportunity to test the harvest of crab species across power transmission cables. In situ field techniques give commercial crab species a choice to decide if they will cross fully energized, EMF emitting, power transmission cables, in response to baited traps. Each independent trial is either one of two possible responses: the crab crosses the cable to enter a trap (1) or the crab does not cross the cable to enter a trap (0). Conditions vary among sample units by the following categorical, fixed factors (i.e., covariates) of cable structure (buried or unburied); direction of cable from crab position (west or east, north or south); time and season. A generalized linear model is fit to the data to determine whether any of these factors affect the probability of crabs crossing an energized cable to enter baited traps. Additionally, the experimental design, aside from the number of runs (set of sample trials) and the dates of the runs, is the same in the Santa Barbara Channel for rock crab and Puget Sound for Dungeness crab, and allows us to compare the capture rates of the two species in the two areas. We present preliminary results from field testing in 2015.

  9. Comparative analysis of the proximate and elemental composition of the blue crab Callinectes sapidus, the warty crab Eriphia verrucosa, and the edible crab Cancer pagurus

    Directory of Open Access Journals (Sweden)

    Maurizio Zotti

    2016-02-01

    Full Text Available The proximate composition and element contents of claw muscle tissue of Atlantic blue crabs (Callinectes sapidus were compared with the native warty crab (Eriphia verrucosa and the commercially edible crab (Cancer pagurus. The scope of the analysis was to profile the chemical characteristics and nutritive value of the three crab species. Elemental fingerprints showed significant inter-specific differences, whereas non-significant variations in the moisture and ash contents were observed. In the blue crab, protein content was significantly lower than in the other two species, while its carbon content resulted lower than that characterizing only the warty crab. Among micro-elements, Ba, Cr, Cu, Li, Mn, Ni, and Pb showed extremely low concentrations and negligible among-species differences. Significant inter-specific differences were observed for Na, Sr, V, Ba, Cd and Zn; in particular, cadmium and zinc were characterized in the blue crab by concentrations significantly lower than in the other two species. The analysis of the available literature on the three species indicated a general lack of comparable information on their elemental composition. The need to implement extended elemental fingerprinting techniques for shellfish quality assessment is discussed, in view of other complementary profiling methods such as NMR-based metabolomics.

  10. Gene pyramiding of peptidase inhibitors enhances plant resistance to the spider mite Tetranychus urticae.

    Directory of Open Access Journals (Sweden)

    Maria Estrella Santamaria

    Full Text Available The two-spotted spider mite Tetranychus urticae is a damaging pest worldwide with a wide range of host plants and an extreme record of pesticide resistance. Recently, the complete T. urticae genome has been published and showed a proliferation of gene families associated with digestion and detoxification of plant secondary compounds which supports its polyphagous behaviour. To overcome spider mite adaptability a gene pyramiding approach has been developed by co-expressing two barley proteases inhibitors, the cystatin Icy6 and the trypsin inhibitor Itr1 genes in Arabidopsis plants by Agrobacterium-mediated transformation. The presence and expression of both transgenes was studied by conventional and quantitative real time RT-PCR assays and by indirect ELISA assays. The inhibitory activity of cystatin and trypsin inhibitor was in vitro analysed using specific substrates. Single and double transformants were used to assess the effects of spider mite infestation. Double transformed lines showed the lowest damaged leaf area in comparison to single transformants and non-transformed controls and different accumulation of H(2O(2 as defence response in the leaf feeding site, detected by diaminobenzidine staining. Additionally, an impact on endogenous mite cathepsin B- and L-like activities was observed after feeding on Arabidopsis lines, which correlates with a significant increase in the mortality of mites fed on transformed plants. These effects were analysed in view of the expression levels of the target mite protease genes, C1A cysteine peptidase and S1 serine peptidase, identified in the four developmental mite stages (embryo, larvae, nymphs and adults performed using the RNA-seq information available at the BOGAS T. urticae database. The potential of pyramiding different classes of plant protease inhibitors to prevent plant damage caused by mites as a new tool to prevent pest resistance and to improve pest control is discussed.

  11. Gene Pyramiding of Peptidase Inhibitors Enhances Plant Resistance to the Spider Mite Tetranychus urticae

    Science.gov (United States)

    Santamaria, Maria Estrella; Cambra, Inés; Martinez, Manuel; Pozancos, Clara; González-Melendi, Pablo; Grbic, Vojislava; Castañera, Pedro; Ortego, Felix; Diaz, Isabel

    2012-01-01

    The two-spotted spider mite Tetranychus urticae is a damaging pest worldwide with a wide range of host plants and an extreme record of pesticide resistance. Recently, the complete T. urticae genome has been published and showed a proliferation of gene families associated with digestion and detoxification of plant secondary compounds which supports its polyphagous behaviour. To overcome spider mite adaptability a gene pyramiding approach has been developed by co-expressing two barley proteases inhibitors, the cystatin Icy6 and the trypsin inhibitor Itr1 genes in Arabidopsis plants by Agrobacterium-mediated transformation. The presence and expression of both transgenes was studied by conventional and quantitative real time RT-PCR assays and by indirect ELISA assays. The inhibitory activity of cystatin and trypsin inhibitor was in vitro analysed using specific substrates. Single and double transformants were used to assess the effects of spider mite infestation. Double transformed lines showed the lowest damaged leaf area in comparison to single transformants and non-transformed controls and different accumulation of H2O2 as defence response in the leaf feeding site, detected by diaminobenzidine staining. Additionally, an impact on endogenous mite cathepsin B- and L-like activities was observed after feeding on Arabidopsis lines, which correlates with a significant increase in the mortality of mites fed on transformed plants. These effects were analysed in view of the expression levels of the target mite protease genes, C1A cysteine peptidase and S1 serine peptidase, identified in the four developmental mite stages (embryo, larvae, nymphs and adults) performed using the RNA-seq information available at the BOGAS T. urticae database. The potential of pyramiding different classes of plant protease inhibitors to prevent plant damage caused by mites as a new tool to prevent pest resistance and to improve pest control is discussed. PMID:22900081

  12. Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

    DEFF Research Database (Denmark)

    Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

    2014-01-01

    The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

  13. Fear of spiders: The effect of real threat on the interference caused by symbolic threat

    NARCIS (Netherlands)

    Kwakkenbos, C.M.C.; Becker, E.S.; Rinck, M.

    2010-01-01

    The effect of the presence of a real spider on attentional biases for symbolic spider stimuli was examined in 42 low-fearful and 26 high-spider-fearful participants. They completed a word colour-naming task as well as a picture orientation-judgement task, both with versus without a spider present in

  14. Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

    Directory of Open Access Journals (Sweden)

    Sue Yeon Lee

    2018-03-01

    Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

  15. Spider diversity in relation to habitat heterogeneity and an altitudinal ...

    African Journals Online (AJOL)

    Using pitfall traps, wandering spiders (Arachnida: Araneae) were sampled in a nested design from three different localities in the mountainous arid ecosystem of South Sinai at low, middle, and high altitudes. Habitat type and altitude were clearly different among the three localities. Spider diversity per trap varied spatially ...

  16. Forest floor spiders of woodlots in an agricultural landscape

    NARCIS (Netherlands)

    Mabelis, A.

    1996-01-01

    An inventory of spiders was made in woodlots, which are situated in an agricultural landscape in the eastern part of the Netherlands. Aim of the study was to test the hypotheses that good dispersers, like spiders, will be distributed randomly over habitat patches and consequently, that there will be

  17. Alleviation of oxidative stress induced by spider mite invasion ...

    African Journals Online (AJOL)

    Spider mite invasion induces oxidative stress on bean plants and increased soluble sugars, phenole, proline and peroxidase activity, but decreased catalase activity and ascorbic acid and carotenoid concentration. Application of elicitors significantly enhanced spider mite tolerance by decreasing hydrogen peroxide, ...

  18. Who is afraid of a black Spider(-Man)?

    OpenAIRE

    Ora C. McWilliams

    2013-01-01

    An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  19. Who is afraid of a black Spider(-Man?

    Directory of Open Access Journals (Sweden)

    Ora C. McWilliams

    2013-06-01

    Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

  20. Using Spider-Web Patterns To Determine Toxicity

    Science.gov (United States)

    Noever, David A.; Cronise, Raymond J.; Relwani, Rachna A.

    1995-01-01

    Method of determining toxicities of chemicals involves recording and analysis of spider-web patterns. Based on observation spiders exposed to various chemicals spin webs that differ, in various ways, from normal webs. Potential alternative to toxicity testing on higher animals.

  1. Brain systems underlying encounter expectancy bias in spider phobia.

    Science.gov (United States)

    Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

    2015-06-01

    Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

  2. Time-dependent motor properties of multipedal molecular spiders.

    Science.gov (United States)

    Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

    2011-09-01

    Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

  3. Evidence for competition between carnivorous plants and spiders.

    Science.gov (United States)

    Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

    2010-10-07

    Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

  4. Land crabs as key drivers in tropical coastal forest recruitment

    Science.gov (United States)

    Lindquist, E.S.; Krauss, K.W.; Green, P.T.; O'Dowd, D. J.; Sherman, P.M.; Smith, T. J.

    2009-01-01

    Plant populations are regulated by a diverse assortment of abiotic and biotic factors that influence seed dispersal and viability, and seedling establishment and growth at the microsite. Rarely does one animal guild exert as significant an influence on different plant assemblages as land crabs. We review three tropical coastal ecosystems-mangroves, island maritime forests, and mainland coastal terrestrial forests-where land crabs directly influence forest composition by limiting tree establishment and recruitment. Land crabs differentially prey on seeds, propagules and seedlings along nutrient, chemical and physical environmental gradients. In all of these ecosystems, but especially mangroves, abiotic gradients are well studied, strong and influence plant species distributions. However, we suggest that crab predation has primacy over many of these environmental factors by acting as the first limiting factor of tropical tree recruitment to drive the potential structural and compositional organisation of coastal forests. We show that the influence of crabs varies relative to tidal gradient, shoreline distance, canopy position, time, season, tree species and fruiting periodicity. Crabs also facilitate forest growth and development through such activities as excavation of burrows, creation of soil mounds, aeration of soils, removal of leaf litter into burrows and creation of carbon-rich soil microhabitats. For all three systems, land crabs influence the distribution, density and size-class structure of tree populations. Indeed, crabs are among the major drivers of tree recruitment in tropical coastal forest ecosystems, and their conservation should be included in management plans of these forests. ?? 2009 Cambridge Philosophical Society.

  5. Effect of Mudflat Trampling on Activity of Intertidal Crabs

    Science.gov (United States)

    Kim, Tae Won; Kim, Sanha; Lee, Jung-Ah

    2018-03-01

    Many people visit intertidal mudflats to collect bait and seafood, or for eco-tourism and recreation, and as a consequence trample on the mudflats frequently. Trampling would not be life threatening to most animals in the intertidal flats as they have evolved hiding behavior to escape predation. However, what is the effect of trampling on the behavior of intertidal animals? In this study, the effect of mudflat trampling on the activity of crabs (e.g. fiddler crabs, sentinel crabs) living on the mudflat was explored. The number of crabs active on the mudflat surface in experimental plots (1.5 × 1.5 m2) before and after (10 min. and 30 min.) trampling of three different intensities (Heavy trampling = 60 steps; Moderate trampling = 20 steps; and No trampling) was compared in two different mudflat systems. After trampling, the number of crabs active on the surface decreased and was significantly lower than that of control plots. The more intensively trampled the mudflat was, the fewer crabs were active on the mudflat surface. Surprisingly, the number of active crabs did not recover even 30 min. after trampling. The results clearly support the hypothesis that trampling can severely interfere with the behavior of crabs living on intertidal mudflats.

  6. Porcelain crabs from Brazil (Crustacea: Decapoda: Anomura: Porcellanidae).

    Science.gov (United States)

    Ferreira, Luciane Augusto De Azevedo; De Melo, Gustavo Augusto Schmidt

    2016-03-15

    Twenty species of porcelain crabs are reported on the basis of material collected from Brazilian coasts. Considering the lack of systematic studies comprehending the Brazilian porcellanids, the present work presents a review of the regional species based on the current taxonomic information. New records, information about variation between specimens and a taxonomic discussion are given for porcellanid crabs from Brazil.

  7. Land crabs as key drivers in tropical coastal forest recruitment.

    Science.gov (United States)

    Lindquist, Erin Stewart; Krauss, Ken W; Green, Peter T; O'Dowd, Dennis J; Sherman, Peter M; Smith, Thomas J

    2009-05-01

    Plant populations are regulated by a diverse assortment of abiotic and biotic factors that influence seed dispersal and viability, and seedling establishment and growth at the microsite. Rarely does one animal guild exert as significant an influence on different plant assemblages as land crabs. We review three tropical coastal ecosystems-mangroves, island maritime forests, and mainland coastal terrestrial forests-where land crabs directly influence forest composition by limiting tree establishment and recruitment. Land crabs differentially prey on seeds, propagules and seedlings along nutrient, chemical and physical environmental gradients. In all of these ecosystems, but especially mangroves, abiotic gradients are well studied, strong and influence plant species distributions. However, we suggest that crab predation has primacy over many of these environmental factors by acting as the first limiting factor of tropical tree recruitment to drive the potential structural and compositional organisation of coastal forests. We show that the influence of crabs varies relative to tidal gradient, shoreline distance, canopy position, time, season, tree species and fruiting periodicity. Crabs also facilitate forest growth and development through such activities as excavation of burrows, creation of soil mounds, aeration of soils, removal of leaf litter into burrows and creation of carbon-rich soil microhabitats. For all three systems, land crabs influence the distribution, density and size-class structure of tree populations. Indeed, crabs are among the major drivers of tree recruitment in tropical coastal forest ecosystems, and their conservation should be included in management plans of these forests.

  8. 50 CFR 680.6 - Crab economic data report (EDR).

    Science.gov (United States)

    2010-10-01

    ... salaries for foremen, managers, and other employees not included in direct labor costs; and other vessel... employees not included in direct labor costs; and other vessel-specific costs (specify). (xii) BSAI crab...; food and provisions; other costs for direct crab labor; insurance deductible fees; re-packing costs...

  9. Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2015-12-01

    Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

  10. Nutrient regulation in a predator, the wolf spider Pardosa prativaga

    DEFF Research Database (Denmark)

    Jensen, Kim; Mayntz, David; Toft, Søren

    2011-01-01

    Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

  11. SPIDER: CMB Polarimetry from the Edge of Space

    Energy Technology Data Exchange (ETDEWEB)

    Gualtieri, R.; et al.

    2017-11-28

    SPIDER is a balloon-borne instrument designed to map the polarization of the millimeter-wave sky at large angular scales. SPIDER targets the B-mode signature of primordial gravitational waves in the cosmic microwave background (CMB), with a focus on mapping a large sky area with high fidelity at multiple frequencies. SPIDER's first longduration balloon (LDB) flight in January 2015 deployed a total of 2400 antenna-coupled Transition Edge Sensors (TESs) at 90 GHz and 150 GHz. In this work we review the design and in-flight performance of the SPIDER instrument, with a particular focus on the measured performance of the detectors and instrument in a space-like loading and radiation environment. SPIDER's second flight in December 2018 will incorporate payload upgrades and new receivers to map the sky at 285 GHz, providing valuable information for cleaning polarized dust emission from CMB maps.

  12. Mitigating by-catch of diamondback terrapins in crab pots

    Science.gov (United States)

    Hart, Kristen M.; Crowder, Larry B.

    2011-01-01

    Chronic by-catch of diamondback terrapins (Malaclemys terrapin) in blue crab (Callinectes sapidus) pots is a concern for terrapin conservation along the United States Atlantic and Gulf of Mexico coasts. Despite the availability of by-catch reduction devices (BRDs) for crab pots, adoption of BRDs has not been mandated and by-catch of terrapins continues. We conducted experimental fishing studies in North Carolina's year-round blue crab fishery from 2000 to 2004 to evaluate the ability of various BRDs to reduce terrapin by-catch without a concomitant reduction in the catch of blue crabs. In 4,822 crab pot days fished, we recorded only 21 terrapin captures. Estimated capture rates were 0.003 terrapins/pot per day in hard crab experimental fishing and 0.008 terrapins/pot per day in peeler experimental fishing. All terrapin captures occurred from April to mid-May within 321.4 m of the shoreline. Longer soak times produced more dead terrapins, with 4 live and 4 dead during hard crab experimental fishing and 11 live and 2 dead during peeler experimental fishing. The 4.0-cm BRDs in fall and 4.5-cm and 5.0-cm BRDs in spring reduced the catch of legal-sized male hard crabs by 26.6%, 21.2%, and 5.7%, respectively. Only the 5.0-cm BRDs did not significantly affect the catch of legal-sized hard male crabs. However, BRDs had no measurable effect on catch of target crabs in the peeler crab fishery. Our results identify 3 complementary and economically feasible tools for blue crab fishery managers to exclude terrapins from commercially fished crab pots in North Carolina: 1) gear modifications (e.g., BRDs); 2) distance-to-shore restrictions; and 3) time-of-year regulations. These measures combined could provide a reduction in terrapin by-catch of up to 95% without a significant reduction in target crab catch.

  13. Morphological evolution of spiders predicted by pendulum mechanics.

    Directory of Open Access Journals (Sweden)

    Jordi Moya-Laraño

    Full Text Available BACKGROUND: Animals have been hypothesized to benefit from pendulum mechanics during suspensory locomotion, in which the potential energy of gravity is converted into kinetic energy according to the energy-conservation principle. However, no convincing evidence has been found so far. Demonstrating that morphological evolution follows pendulum mechanics is important from a biomechanical point of view because during suspensory locomotion some morphological traits could be decoupled from gravity, thus allowing independent adaptive morphological evolution of these two traits when compared to animals that move standing on their legs; i.e., as inverted pendulums. If the evolution of body shape matches simple pendulum mechanics, animals that move suspending their bodies should evolve relatively longer legs which must confer high moving capabilities. METHODOLOGY/PRINCIPAL FINDINGS: We tested this hypothesis in spiders, a group of diverse terrestrial generalist predators in which suspensory locomotion has been lost and gained a few times independently during their evolutionary history. In spiders that hang upside-down from their webs, their legs have evolved disproportionately longer relative to their body sizes when compared to spiders that move standing on their legs. In addition, we show how disproportionately longer legs allow spiders to run faster during suspensory locomotion and how these same spiders run at a slower speed on the ground (i.e., as inverted pendulums. Finally, when suspensory spiders are induced to run on the ground, there is a clear trend in which larger suspensory spiders tend to run much more slowly than similar-size spiders that normally move as inverted pendulums (i.e., wandering spiders. CONCLUSIONS/SIGNIFICANCE: Several lines of evidence support the hypothesis that spiders have evolved according to the predictions of pendulum mechanics. These findings have potentially important ecological and evolutionary implications since

  14. Switching skeletons: hydrostatic support in molting crabs

    Science.gov (United States)

    Taylor, Jennifer R A.; Kier, William M.; Walker, I. D. (Principal Investigator)

    2003-01-01

    Skeletal support systems are essential for support, movement, muscular antagonism, and locomotion. Crustaceans shed their rigid exoskeleton at each molt yet are still capable of forceful movement. We hypothesize that the soft water-inflated body of newly molted crabs may rely on a hydrostatic skeleton, similar to that of worms and polyps. We measured internal hydrostatic pressure and the force exerted during claw adduction and observed a strong correlation between force and hydrostatic pressure, consistent with hydrostatic skeletal support. This alternation between the two basic skeletal types may be widespread among arthropods.

  15. Identification of irradiated crab using EPR

    Energy Technology Data Exchange (ETDEWEB)

    Maghraby, A. [Radiation Dosimetry Department, National Institute for Standards (NIS), Ministry of Scientific Research, Haram, 12211- Giza, P.O. Box: 136 (Egypt)]. E-mail: maghrabism@yahoo.com

    2007-02-15

    EPR spectroscopy is a fast and powerful technique for the identification of irradiated food. Crab exoskeleton was divided into six parts: dactyl, cheliped, carapace, apron, swimming legs, and walking legs. Samples of the exoskeleton were prepared and irradiated to Cs-137 gamma radiation in the range (1.156-5.365 kGy). EPR spectra of unirradiated as well as irradiated samples were recorded and analyzed. Response to gamma radiation was plotted for each part of the exoskeleton, dactyl was found to be the most sensitive part, followed by the apron (38%), cheliped (37%), walking legs (30%), swimming legs (24%), and carapace (21%) relative to the dactyl response.

  16. ELEMENT MASSES IN THE CRAB NEBULA

    Energy Technology Data Exchange (ETDEWEB)

    Sibley, Adam R.; Katz, Andrea M.; Satterfield, Timothy J.; Vanderveer, Steven J.; MacAlpine, Gordon M. [Department of Physics and Astronomy, Trinity University, San Antonio, TX 78212 (United States)

    2016-10-01

    Using our previously published element abundance or mass-fraction distributions in the Crab Nebula, we derived actual mass distributions and estimates for overall nebular masses of hydrogen, helium, carbon, nitrogen, oxygen and sulfur. As with the previous work, computations were carried out for photoionization models involving constant hydrogen density and also constant nuclear density. In addition, employing new flux measurements for [Ni ii]  λ 7378, along with combined photoionization models and analytic computations, a nickel abundance distribution was mapped and a nebular stable nickel mass estimate was derived.

  17. Chocolate spot of Eucalyptus

    OpenAIRE

    Cheewangkoon, R.; Groenewald, J.Z.; Hyde, K.D.; To-anun, C.; Crous, P.W.

    2012-01-01

    Chocolate Spot leaf disease of Eucalyptus is associated with several Heteroconium-like species of hyphomycetes that resemble Heteroconium s.str. in morphology. They differ, however, in their ecology, with the former being plant pathogenic, while Heteroconium s.str. is a genus of sooty moulds. Results of molecular analyses, inferred from DNA sequences of the large subunit (LSU) and internal transcribed spacers (ITS) region of nrDNA, delineated four Heteroconium-like species on Eucalyptus, name...

  18. Brown spider dermonecrotic toxin directly induces nephrotoxicity

    International Nuclear Information System (INIS)

    Chaim, Olga Meiri; Sade, Youssef Bacila; Bertoni da Silveira, Rafael; Toma, Leny; Kalapothakis, Evanguedes; Chavez-Olortegui, Carlos; Mangili, Oldemir Carlos; Gremski, Waldemiro; Dietrich, Carl Peter von; Nader, Helena B.; Sanches Veiga, Silvio

    2006-01-01

    Brown spider (Loxosceles genus) venom can induce dermonecrotic lesions at the bite site and systemic manifestations including fever, vomiting, convulsions, disseminated intravascular coagulation, hemolytic anemia and acute renal failure. The venom is composed of a mixture of proteins with several molecules biochemically and biologically well characterized. The mechanism by which the venom induces renal damage is unknown. By using mice exposed to Loxosceles intermedia recombinant dermonecrotic toxin (LiRecDT), we showed direct induction of renal injuries. Microscopic analysis of renal biopsies from dermonecrotic toxin-treated mice showed histological alterations including glomerular edema and tubular necrosis. Hyalinization of tubules with deposition of proteinaceous material in the tubule lumen, tubule epithelial cell vacuoles, tubular edema and epithelial cell lysis was also observed. Leukocytic infiltration was neither observed in the glomerulus nor the tubules. Renal vessels showed no sign of inflammatory response. Additionally, biochemical analyses showed such toxin-induced changes in renal function as urine alkalinization, hematuria and azotemia with elevation of blood urea nitrogen levels. Immunofluorescence with dermonecrotic toxin antibodies and confocal microscopy analysis showed deposition and direct binding of this toxin to renal intrinsic structures. By immunoblotting with a hyperimmune dermonecrotic toxin antiserum on renal lysates from toxin-treated mice, we detected a positive signal at the region of 33-35 kDa, which strengthens the idea that renal failure is directly induced by dermonecrotic toxin. Immunofluorescence reaction with dermonecrotic toxin antibodies revealed deposition and binding of this toxin directly in MDCK epithelial cells in culture. Similarly, dermonecrotic toxin treatment caused morphological alterations of MDCK cells including cytoplasmic vacuoles, blebs, evoked impaired spreading and detached cells from each other and from

  19. Checklist of the spiders (Araneae) of Israel.

    Science.gov (United States)

    Zonstein, Sergei; Marusik, Yuri M

    2013-01-01

    This checklist records 631 spider species and subspecies belonging to 49 families in Israel. Species distributions are given in both generalised (by main geographic areas of the country) and detailed (by localities) form. Twenty-seven records are considered as doubtful and another ten are based on misidentifications. A historical survey is provided. Each record is presented in its original combination. The list is dominated by members of the families Gnaphosidae and Salticidae (20.0% and 17.1% of total species, respectively). The level of regional endemism exceeds 37.0%.

  20. El spot electoral negativo

    Directory of Open Access Journals (Sweden)

    Palma Peña-Jiménez

    2011-01-01

    Full Text Available l spot político tiene durante la campaña un objetivo final inequívoco: la consecución del voto favorable. Se dirige al cuerpo electoral a través de la televisión y de Internet, y presenta, en muchos casos, un planteamiento negativo, albergando mensajes destinados a la crítica frontal contra el adversario, más que a la exposición de propuestas propias. Este artículo se centra en el análisis del spot electoral negativo, en aquellas producciones audiovisuales construidas sin más causa que la reprobación del contrincante. Se trata de vídeos que, lejos de emplearse en difundir las potencialidades de la organización y las virtudes de su candidato –además de su programa electoral–, consumen su tiempo en descalificar al oponente mediante la transmisión de mensajes, muchas veces, ad hominem. Repasamos el planteamiento negativo del spot electoral desde su primera manifestación, que en España data de 1996, año de emisión del conocido como vídeo del dóberman, sin olvidar otros ejemplos que completan el objeto de estudio.

  1. Probing the Impact of Acidification on Spider Silk Assembly Kinetics.

    Science.gov (United States)

    Xu, Dian; Guo, Chengchen; Holland, Gregory P

    2015-07-13

    Spiders utilize fine adjustment of the physicochemical conditions within its silk spinning system to regulate spidroin assembly into solid silk fibers with outstanding mechanical properties. However, the exact mechanism about which this occurs remains elusive and is still hotly debated. In this study, the effect of acidification on spider silk assembly was investigated on native spidroins from the major ampullate (MA) gland fluid excised from Latrodectus hesperus (Black Widow) spiders. Incubating the protein-rich MA silk gland fluid at acidic pH conditions results in the formation of silk fibers that are 10-100 μm in length and ∼2 μm in diameter as judged by optical and electron microscope methods. The in vitro spider silk assembly kinetics were monitored as a function of pH with a (13)C solid-state MAS NMR approach. The results confirm the importance of acidic pH in the spider silk self-assembly process with observation of a sigmoidal nucleation-elongation kinetic profile. The rates of nucleation and elongation as well as the percentage of β-sheet structure in the grown fibers depend on the pH. These results confirm the importance of an acidic pH gradient along the spinning duct for spider silk formation and provide a powerful spectroscopic approach to probe the kinetics of spider silk formation under various biochemical conditions.

  2. Mermithid parasitism of Hawaiian Tetragnatha spiders in a fragmented landscape

    Science.gov (United States)

    Vandergast, Amy; Roderick, George K.

    2003-01-01

    Hawaiian Tetragnatha spiders inhabiting small forest fragments on the Big Island of Hawaii are parasitized by mermithid nematodes. This is the first report of mermithid nematodes infecting spiders in Hawaii, and an initial attempt to characterize this host–parasite interaction. Because immature mermithids were not morphologically identifiable, a molecular identification was performed. A phylogenetic analysis based on 18S small ribosomal subunit nuclear gene sequences suggested that Hawaiian spider mermithids are more closely related to a mainland presumptive Aranimemis species that infects spiders, than to an insect-infecting mermithid collected on Oahu, HI, or to Mermis nigrescens, also a parasite of insects. Measured infection prevalence was low (ranging from 0 to 4%) but differed significantly among forest fragments. Infection prevalence was associated significantly with fragment area, but not with spider density nor spider species richness. Results suggest that mermithid populations are sensitive to habitat fragmentation, but that changes in infection prevalence do not appear to affect spider community structure.

  3. Spider Silk-CBD-Cellulose Nanocrystal Composites: Mechanism of Assembly.

    Science.gov (United States)

    Meirovitch, Sigal; Shtein, Zvi; Ben-Shalom, Tal; Lapidot, Shaul; Tamburu, Carmen; Hu, Xiao; Kluge, Jonathan A; Raviv, Uri; Kaplan, David L; Shoseyov, Oded

    2016-09-18

    The fabrication of cellulose-spider silk bio-nanocomposites comprised of cellulose nanocrystals (CNCs) and recombinant spider silk protein fused to a cellulose binding domain (CBD) is described. Silk-CBD successfully binds cellulose, and unlike recombinant silk alone, silk-CBD self-assembles into microfibrils even in the absence of CNCs. Silk-CBD-CNC composite sponges and films show changes in internal structure and CNC alignment related to the addition of silk-CBD. The silk-CBD sponges exhibit improved thermal and structural characteristics in comparison to control recombinant spider silk sponges. The glass transition temperature (Tg) of the silk-CBD sponge was higher than the control silk sponge and similar to native dragline spider silk fibers. Gel filtration analysis, dynamic light scattering (DLS), small angle X-ray scattering (SAXS) and cryo-transmission electron microscopy (TEM) indicated that silk-CBD, but not the recombinant silk control, formed a nematic liquid crystalline phase similar to that observed in native spider silk during the silk spinning process. Silk-CBD microfibrils spontaneously formed in solution upon ultrasonication. We suggest a model for silk-CBD assembly that implicates CBD in the central role of driving the dimerization of spider silk monomers, a process essential to the molecular assembly of spider-silk nanofibers and silk-CNC composites.

  4. Spider Communities and Biological Control in Native Habitats Surrounding Greenhouses

    Directory of Open Access Journals (Sweden)

    Belén Cotes

    2018-03-01

    Full Text Available The promotion of native vegetation as a habitat for natural enemies, which could increase their abundance and fitness, is especially useful in highly simplified settings such as Mediterranean greenhouse landscapes. Spiders as generalist predators may also be involved in intra-guild predation. However, the niche complementarity provided by spiders as a group means that increased spider diversity may facilitate complementary control actions. In this study, the interactions between spiders, the two major horticultural pests, Bemisia tabaci and Frankliniella occidentalis, and their naturally occurring predators and parasitoids were evaluated in a mix of 21 newly planted shrubs selected for habitat management in a highly disturbed horticultural system. The effects of all factors were evaluated using redundancy analysis (RDA and the generalized additive model (GAM to assess the statistical significance of abundance of spiders and pests. The GAM showed that the abundance of both pests had a significant effect on hunter spider’s abundance, whereas the abundance of B. tabaci, but not F. occidentalis, affected web-weavers’ abundance. Ordination analysis showed that spider abundance closely correlated with that of B. tabaci but not with that of F. occidentalis, suggesting that complementarity occurs, and thereby probability of biocontrol, with respect to the targeted pest B. tabaci, although the temporal patterns of the spiders differed from those of F. occidentalis. Conservation strategies involving the establishment of these native plants around greenhouses could be an effective way to reduce pest populations outdoors.

  5. The porcelain crab transcriptome and PCAD, the porcelain crab microarray and sequence database.

    Directory of Open Access Journals (Sweden)

    Abderrahmane Tagmount

    Full Text Available BACKGROUND: With the emergence of a completed genome sequence of the freshwater crustacean Daphnia pulex, construction of genomic-scale sequence databases for additional crustacean sequences are important for comparative genomics and annotation. Porcelain crabs, genus Petrolisthes, have been powerful crustacean models for environmental and evolutionary physiology with respect to thermal adaptation and understanding responses of marine organisms to climate change. Here, we present a large-scale EST sequencing and cDNA microarray database project for the porcelain crab Petrolisthes cinctipes. METHODOLOGY/PRINCIPAL FINDINGS: A set of approximately 30K unique sequences (UniSeqs representing approximately 19K clusters were generated from approximately 98K high quality ESTs from a set of tissue specific non-normalized and mixed-tissue normalized cDNA libraries from the porcelain crab Petrolisthes cinctipes. Homology for each UniSeq was assessed using BLAST, InterProScan, GO and KEGG database searches. Approximately 66% of the UniSeqs had homology in at least one of the databases. All EST and UniSeq sequences along with annotation results and coordinated cDNA microarray datasets have been made publicly accessible at the Porcelain Crab Array Database (PCAD, a feature-enriched version of the Stanford and Longhorn Array Databases. CONCLUSIONS/SIGNIFICANCE: The EST project presented here represents the third largest sequencing effort for any crustacean, and the largest effort for any crab species. Our assembly and clustering results suggest that our porcelain crab EST data set is equally diverse to the much larger EST set generated in the Daphnia pulex genome sequencing project, and thus will be an important resource to the Daphnia research community. Our homology results support the pancrustacea hypothesis and suggest that Malacostraca may be ancestral to Branchiopoda and Hexapoda. Our results also suggest that our cDNA microarrays cover as much of the

  6. Biological control of two-spotted spider mites using phytoseiid predators

    NARCIS (Netherlands)

    Sabelis, M.W.

    1982-01-01

    The searching behaviour of individual predators of four phytoseiid species ( Phytoseiulus persimilis , Amblyseius p o tentillae , Amblyseius bibens , Metaseiulus occidentalis ) is investigated in

  7. Physicochemical and nutritional alterations induced by two-spotted spider mite infestation on strawberry plants

    Directory of Open Access Journals (Sweden)

    Emanuele Livinali

    2014-09-01

    Conclusions: Our results suggest that TSSM infestation decreases fruit quality and that the biological control of TSSM using a predatory mite is a suitable alternative to organic production, since the presence of predatory mite does not affect fruit quality and development.

  8. Fundamental aspects of genetic control of the two-spotted spider mite Tetranychus urticae (Acari: Tetranychidae)

    International Nuclear Information System (INIS)

    Feldmann, A.M.

    1979-01-01

    Radiobiological properties of Tetranychus urticae and other topics of genetic control have been evaluated. The induction by X-rays or fast neutrons of dominant lethals in mature sperm and of dominant lethals and recessive lethals in prophase-1 oocytes and the induction by both radiation types of chromosome mutations, recessive lethals and factors causing F 1 -infertility in sperm and oocytes, have been studied. From the results the optimal dose, radiation type and germ cell type could be chosen for obtaining either fully sterile males or substerile males, producing fully infertile F 1 -females. Also the most favourable conditions were determined for the induction of chromosome mutations with the lowest frequency of linked recessive lethals. The radiobiological properties of holokinetic chromosomes are extensively discussed. The successful displacement of the standard karyotype by a radiation arranged karyotype is presented and discussed in its relevance for practical application. (Auth./C.F.)

  9. Functional response of predatory thrips to two-spotted spider mite - influence of pesticides

    DEFF Research Database (Denmark)

    Pakyari, Hajar; Enkegaard, Annie

    2013-01-01

    A leaf disc bioassay was used to investigate the effects of abamectin and fenpropathrin on the functional response of an acarophagous thrips, Scolothrips longicornis Priesner, to eggs of Tetranychus urticae Koch at 25 ± 1°C, 60 ± 10% RH, 16:8 h (L:D). The type of the functional response differed....... The theoretical maximum number of prey attacked by the thrips was 49.67 and 23.67 eggs per day for females and males, respectively; both maxima were attained in the control treatment. These values were reduced for males exposed to full doses of either pesticide and for females exposed to both half and full doses...

  10. Inhibition of the spider heartbeat by gravity and vibration

    Science.gov (United States)

    Finck, A.

    1984-01-01

    The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

  11. Spider silk reinforced by graphene or carbon nanotubes

    Science.gov (United States)

    Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

    2017-09-01

    Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

  12. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...

  13. AFSC/RACE/SAP/Long: Data from: Effects of Ocean Acidification on Juvenile Red King Crab (Paralithodes camtschaticus) and Tanner Crab (Chionoecetes bairdi) Growth, Condition, Calcification, and Survival

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is the results of a laboratory experiment. Juvenile red king crab and Tanner crab were reared in individual containers for nearly 200 days in flowing...

  14. The Effects of Season and Sex on the Nutritional Quality of Muscle Types of Blue Crab Callinectes sapidus and Swimming Crab Portunus segnis

    Directory of Open Access Journals (Sweden)

    Deniz Ayas

    2016-05-01

    Full Text Available The effects of season and sex on the nutritional quality of muscle types (lump crab meatLCM, claw crab meat-CCM of swimming crab (Portunus segnis and blue crab (Callinectes sapidus were investigated. Carapace width, carapace length and total weight of both crab species were measured. High protein content in spring and low protein content in autumn were observed for both crab species. The levels of lipid content of both crab species were found to be similar. Higher lipid contents in spring and winter, lower lipid contents in summer and autumn for both sexes were found. Although both crab species contain small amounts of fat, they are good sources of n-3 PUFA content (especially EPA and DHA for all seasons regardless of sex and muscle types.

  15. Myocarditis after black widow spider envenomation.

    Science.gov (United States)

    Sari, Ibrahim; Zengin, Suat; Davutoglu, Vedat; Yildirim, Cuma; Gunay, Nurullah

    2008-06-01

    The black widow spider (BWS), which is a member of the arthropod family, is widely distributed on earth. Black widow spider bites can cause a wide variety of signs or symptoms in humans, but the cardiovascular manifestations are relatively rare except hypertension/hypotension and bradycardia/tachycardia. We report on a 65-year-old man who experienced myocarditis after BWS envenomation, which is extremely rare. He complained of chest pain after the BWS bite, and electrocardiography (ECG) was consistent with a 0.5-mm ST-segment elevation in leads II, aVF, and V3 through V6 and accompanying augmentation in T-wave amplitude in leads V3 through V6 without reciprocal changes. Creatine kinase-MB, troponin-I, and aspartate aminotransferase levels peaked at 98 IU/L, 6.1 ng/mL, and 62 U/L, respectively. His ECG readings and cardiac enzymes returned to normal with supportive treatment, and he was discharged with complete recovery. To the best of our knowledge, the present case is the third in the literature reporting myocarditis and the first reporting ST-segment elevation and accompanying augmentation in T-wave amplitude after BWS envenomation. In addition to usual measures, we recommend ECG and cardiac-specific enzyme followup for every patient envenomated by BWS for potentially fatal cardiac involvement.

  16. Intracellular recording from a spider vibration receptor.

    Science.gov (United States)

    Gingl, Ewald; Burger, Anna-M; Barth, Friedrich G

    2006-05-01

    The present study introduces a new preparation of a spider vibration receptor that allows intracellular recording of responses to natural mechanical or electrical stimulation of the associated mechanoreceptor cells. The spider vibration receptor is a lyriform slit sense organ made up of 21 cuticular slits located on the distal end of the metatarsus of each walking leg. The organ is stimulated when the tarsus receives substrate vibrations, which it transmits to the organ's cuticular structures, reducing the displacement to about one tenth due to geometrical reasons. Current clamp recording was used to record action potentials generated by electrical or mechanical stimuli. Square pulse stimulation identified two groups of sensory cells, the first being single-spike cells which generated only one or two action potentials and the second being multi-spike cells which produced bursts of action potentials. When the more natural mechanical sinusoidal stimulation was applied, differences in adaptation rate between the two cell types remained. In agreement with prior extracellular recordings, both cell types showed a decrease in the threshold tarsus deflection with increasing stimulus frequency. Off-responses to mechanical stimuli have also been seen in the metatarsal organ for the first time.

  17. Microcirculation abnormalities provoked by Loxosceles spiders' envenomation.

    Science.gov (United States)

    Cristina de Oliveira-Lima, Kátia; Farsky, Sandra Helena P; Lopes, Priscila Hess; de Andrade, Rute Maria Gonçalves; van den Berg, Carmen W; Tambourgi, Denise V

    2016-06-15

    Loxoscelism is caused by envenomation by spiders from Loxosceles genus. Clinical symptoms only appear a few hours after envenomation and can evolve in local reactions, such as dermonecrosis, and systemic reactions, including intravascular haemolysis, intravascular coagulation and renal failure. Considering that alterations in the microcirculatory network are involved in the pathogenesis of different diseases, including the inflammatory process, the aim of this study was to investigate the action of venoms of males and females of Loxosceles intermedia and Loxosceles laeta on the microcirculatory network and examine the systemic production of inflammatory mediators in a murine model of loxoscelism. We observed that during systemic envenomation, the alterations in the microcirculation include increase in the number of rolling cells, which was more intense in animals injected with female Loxosceles spider venoms. This positively correlated with increase in TNF-α and NO serum levels, induction of which was higher by female venoms when compared with male venoms. The increase of leukocytes rolling was not accompanied by increase of cell adhesion. The absence of leukocyte extravasation may explain why in mice, in contrast to humans, no cutaneous loxoscelism occurs. Thus, targeting the neutrophil adhesion and extravasation in Loxosceles envenomed patients may prevent cutaneous pathology. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

    Science.gov (United States)

    Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

    2014-08-04

    Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. The Spotting Distribution of Wildfires

    Directory of Open Access Journals (Sweden)

    Jonathan Martin

    2016-06-01

    Full Text Available In wildfire science, spotting refers to non-local creation of new fires, due to downwind ignition of brands launched from a primary fire. Spotting is often mentioned as being one of the most difficult problems for wildfire management, because of its unpredictable nature. Since spotting is a stochastic process, it makes sense to talk about a probability distribution for spotting, which we call the spotting distribution. Given a location ahead of the fire front, we would like to know how likely is it to observe a spot fire at that location in the next few minutes. The aim of this paper is to introduce a detailed procedure to find the spotting distribution. Most prior modelling has focused on the maximum spotting distance, or on physical subprocesses. We will use mathematical modelling, which is based on detailed physical processes, to derive a spotting distribution. We discuss the use and measurement of this spotting distribution in fire spread, fire management and fire breaching. The appendix of this paper contains a comprehensive review of the relevant underlying physical sub-processes of fire plumes, launching fire brands, wind transport, falling and terminal velocity, combustion during transport, and ignition upon landing.

  20. Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

    Science.gov (United States)

    Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

    2012-03-01

    Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

  1. Biomimetic calcium phosphate coatings on recombinant spider silk fibres

    NARCIS (Netherlands)

    Yang, Liang; Hedhammar, My; Blom, Tobias; Leifer, Klaus; Johansson, Jan; Habibovic, Pamela; van Blitterswijk, Clemens

    2010-01-01

    Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently,

  2. Peculiar torsion dynamical response of spider dragline silk

    Science.gov (United States)

    Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

    2017-07-01

    The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

  3. [Effectiveness of a repellent paint against the spider Loxosceles laeta].

    Science.gov (United States)

    Catalán, Alejandro; Araya, Jorge E; Varela, Héctor; Cortés, William; Sagua, Hernán; González Cortés, Jorge

    2009-02-01

    Loxoscelism is a severe reaction to the bite of the spider Loxosceles laeta. In recent years, a paint with repellent properties has been promoted in the commerce. However, there are no reports of experiments evaluating its effectiveness. To evaluate experimentally the repellent properties of a paint against Loxosceles laeta. Males, females and nymphs of L laeta were deposited in cockpits that allow the free displacement of the spider. Half of the cockpit was covered with repellent paint. Daily observations during one week, determined how frequently the spiders occupied the space covered with repellent paint. The experiments were run in triplicate. No statistical differences in the occupancy of spaces covered with repellent paint or not covered with it were observed for nymphs (87% and 67%, respectively), males (72% and 77%, respectively) or females (91% and 84%, respectively). The tested paint does not have a repellent action against the spider Loxosceles laeta.

  4. Aggression and food resource competition between sympatric hermit crab species.

    Science.gov (United States)

    Tran, Mark V; O'Grady, Matthew; Colborn, Jeremiah; Van Ness, Kimberly; Hill, Richard W

    2014-01-01

    The vertical zonation patterns of intertidal organisms have been topics of interest to marine ecologists for many years, with interspecific food competition being implicated as a contributing factor to intertidal community organization. In this study, we used behavioral bioassays to examine the potential roles that interspecific aggression and food competition have on the structuring of intertidal hermit crab assemblages. We studied two ecologically similar, sympatric hermit crab species, Clibanarius digueti [1] and Paguristes perrieri [2], which occupy adjacent zones within the intertidal region of the Gulf of California. During the search phase of foraging, C. digueti showed higher frequencies of aggressive behaviors than P. perrieri. In competition assays, C. digueti gained increased access to food resources compared to P. perrieri. The results suggest that food competition may play an important role in structuring intertidal hermit crab assemblages, and that the zonation patterns of Gulf of California hermit crab species may be the result of geographical displacement by the dominant food competitor (C. digueti).

  5. The surprising Crab pulsar and its nebula: a review.

    Science.gov (United States)

    Bühler, R; Blandford, R

    2014-06-01

    The Crab nebula and its pulsar (referred to together as 'the Crab') have historically played a central role in astrophysics. True to this legacy, several unique discoveries have been made recently. The Crab was found to emit gamma-ray pulsations up to energies of 400 GeV, beyond what was previously expected from pulsars. Strong gamma-ray flares, of durations of a few days, were discovered from within the nebula, while the source was previously expected to be stable in flux on these time scales. Here we review these intriguing and suggestive developments. In this context we give an overview of the observational properties of the Crab and our current understanding of pulsars and their nebulae.

  6. AFSC/RACE/SAP/Urban: Golden King Crab tagging

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data is comprised of the records of individual male golden king crab (GKC) tagged at the Kodiak Laboratory. Initial size, shell condition and missing limbs was...

  7. Crab cavities: Past, present, and future of a challenging device

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Q. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2015-05-03

    In two-ring facilities operating with a crossing-angle collision scheme, luminosity can be limited due to an incomplete overlapping of the colliding bunches. Crab cavities then are introduced to restore head-on collisions by providing the destined opposite deflection to the head and tail of the bunch. An increase in luminosity was demonstrated at KEKB with global crab-crossing, while the Large Hardron Collider (LHC) at CERN currently is designing local crab crossing for the Hi-Lumi upgrade. Future colliders may investigate both approaches. In this paper, we review the challenges in the technology, and the implementation of crab cavities, while discussing experience in earlier colliders, ongoing R&D, and proposed implementations for future facilities, such as HiLumi-LHC, CERN’s compact linear collider (CLIC), the international linear collider (ILC), and the electron-ion collider under design at BNL (eRHIC).

  8. Morphometric characteristics in the horseshoe crab Tachypleus gigas (Arthropoda: Merostomata)

    Digital Repository Service at National Institute of Oceanography (India)

    Vijayakumar, R.; Das, S.; Chatterji, A.; Parulekar, A.H.

    The relationships observed between total carapace length with carapace width, carapace weight, telson length, body weight were found statistically significant (p < 0.05) in the male and female horseshoe crab, Tachypleus gigas (Muller). In females...

  9. Crab cavities: Past, present, and future of a challenging device

    International Nuclear Information System (INIS)

    Wu, Q.

    2015-01-01

    In two-ring facilities operating with a crossing-angle collision scheme, luminosity can be limited due to an incomplete overlapping of the colliding bunches. Crab cavities then are introduced to restore head-on collisions by providing the destined opposite deflection to the head and tail of the bunch. An increase in luminosity was demonstrated at KEKB with global crab-crossing, while the Large Hardron Collider (LHC) at CERN currently is designing local crab crossing for the Hi-Lumi upgrade. Future colliders may investigate both approaches. In this paper, we review the challenges in the technology, and the implementation of crab cavities, while discussing experience in earlier colliders, ongoing R&D, and proposed implementations for future facilities, such as HiLumi-LHC, CERN@@@s compact linear collider (CLIC), the international linear collider (ILC), and the electron-ion collider under design at BNL (eRHIC).

  10. AFSC/REFM: BSAI Crab Economic Data Report

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Economic data collected for years 1998, 2001, 2004, and 2005 and onward for the BSAI Crab Economic Data Report (EDR). Reporting is required of any owner or...

  11. SPIDERS (ARANEI) OF VOLGOGRAD SITY AND ITS ENVIRONS

    OpenAIRE

    A. V. Ponomarev; A. S. Khnykin

    2013-01-01

    Abstract. Aim. Fauna of spiders of Volgograd Region is researched uncompletely. Only 149 species of 19 families were listed in previous references. Complete listing of spiders of this large region was the aim of our investigation.Location. Volgograd Region, Russia.Methods. Material was collected in Volgograd City with environs and Volga-Don area in 2009–2013. Areas with minimum of anthropogenic influence within the city, artificial ecosystem of park type, plots of native vegetation along the ...

  12. Benefits of cooperation with genetic kin in a subsocial spider

    DEFF Research Database (Denmark)

    Schneider, J.M.; Bilde, T.

    2008-01-01

    used a cross-fostering design to control for genetic relatedness and group membership. Our study animal was the periodic social spider Stegodyphus lineatus, a transitional species that belongs to a genus containing both permanent social and periodic social species. In S. lineatus, the young cooperate....... Hence, in communally feeding spiders, nepotism favors group retention and reduces the conflict between selfish interests and the interests of the group....

  13. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  14. Spiders of the Vine Plants in Southern Moravia

    OpenAIRE

    Lucie Havlová; Vladimír Hula; Jana Niedobová

    2015-01-01

    Araneofauna of vineyards is relatively known in Central Europe but we have a lack of knowledge about araneofauna which occur directly on the vine plants. Our investigation was focused on spiders which live on vine plants, especially on the vine plants trunks. We investigated spiders in six vineyards in southern Moravia (Šatov, Mikulov, Popice, Morkůvky, Nosislav and Blučina). Vineyards were under different soil management, traps were placed on different parts of particular locality (terraced ...

  15. Rapid Characterization of Spider Silk Genes via Exon Capture

    Science.gov (United States)

    2015-03-28

    argentata (silver garden spider ), Latrodectus hesperus (Western black widow ), and Nephila clavipes (golden silk orb- weaver). A. diadematus and N...in light of sequence divergence, we also studied Parasteatoda tepidariorum (common house spider ) and Steatoda grossa (false black widow ). P...could determine the minimum number of spidroin gene copies in a black widow genome. In less well-characterized species, such as A. diadematus, our data

  16. Early events in the evolution of spider silk genes.

    Science.gov (United States)

    Starrett, James; Garb, Jessica E; Kuelbs, Amanda; Azubuike, Ugochi O; Hayashi, Cheryl Y

    2012-01-01

    Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers), from the suborder Araneomorphae ('true spiders'). Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs), is known only from the orbicularian species, Lactrodectus hesperus (Western black widow). In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders), which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders) and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae). We use the spidroin gene tree to reconstruct the evolution of amino acid compositions of

  17. Latrodectism—Effects of the Black Widow Spider Bite

    OpenAIRE

    Timms, Patrick K.; Gibbons, Robert B.

    1986-01-01

    Latrodectism—envenomation by the black widow spider, Latrodectus mactans—has been reported in virtually every state. The spider is particularly prevalent in the Southwest, Southeast and California, and symptoms from its bite are painful and may be confusing to clinicians. Prompt improvement can be expected in most cases with administration of calcium and muscle relaxant, but some patients may require treatment with antivenin. No deaths occurred in our series of 11 patients, although one case ...

  18. Spider silk as a blueprint for greener materials : a review

    OpenAIRE

    Lefèvre, Thierry; Auger, Michèle

    2016-01-01

    Spider silk exhibits remarkable properties, especially its well-known tensile performances. They rely on a complex nanostructured hierarchical organisation that studies progressively elucidate. Spider silk encompasses a vast range of fibres that exhibit diverse and captivating physical and biological characteristics. The full understanding of the relation between structure and properties may lead in the future to the design of a variety of high-performance, tailored materials and ...

  19. Small Molecules from Spiders Used as Chemical Probes

    DEFF Research Database (Denmark)

    Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

    2011-01-01

    Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however, o...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

  20. New compact TEM-type deflecting and crabbing rf structure

    Directory of Open Access Journals (Sweden)

    J. R. Delayen

    2009-06-01

    Full Text Available A new type of rf structure for the deflection and crabbing of particle beams is presented. The structure is comprised of a number of parallel TEM resonant lines operating in opposing phase from each other. One of its advantages is its compactness compared to conventional crabbing cavities operating in the TM_{110} mode, thus allowing low frequency designs. This geometry would also be effective for the deflection of beams propagating at velocities substantially less than that of light.

  1. Visual Discrimination Learning in the Jumping Spider Phidippus regius

    Directory of Open Access Journals (Sweden)

    Massimo De Agrò

    2017-11-01

    Full Text Available Over the past decade, research in comparative psychology has increasingly focused on non-vertebrate models of cognition. Jumping spiders provide excellent models for the study of visually mediated behaviors, such as associative learning or the navigation of complex environments. Here, we tested visual and memory abilities of Phidippus regius to discriminate between artificial geometrical stimuli and to generalize the learned discrimination to illusory stimuli, using the amodal completion mechanism. Spiders were first trained to associate one shape (‘X’ or ‘O’ with a reward (sugar water, whilst the other shape was associated with an aversive taste (acidic water. Spiders were then asked to choose between the two shapes in the absence of any reward or punishment. They were then presented with an occluded version of the previously rewarded shape to test for the presence of amodal completion. Spiders were able to learn the discrimination task, although the association was not transferred to the illusory stimulus. This study provides the first demonstration of shape discrimination learning in a jumping spider. The results of the test on the illusory shape are discussed considering that either the spiders' visual system may not require amodal completion or they could have the tendency to learn the shape associated with the aversive taste rather than that associated with the reward.

  2. Burrowing and foraging activity of marsh crabs under different ...

    Science.gov (United States)

    New England salt marshes are susceptible to degradation and habitat loss as a result of increased periods of inundation as sea levels rise. Increased inundation may exacerbate marsh degradation that can result from crab burrowing and foraging. Most studies to date have focused on how crab burrowing and foraging can impact the dominant low marsh plant species, Spartina alterniflora. Here we used a mesocosm experiment to examine the relationship of foraging and burrowing activity in two dominant New England crab species, Sesarma reticulatum and Uca pugilator, and the combined effect of inundation, on the dominant high marsh plant species Spartina patens using a 3 × 2 factorial design with three crab treatments (Sesarma, Uca, control) at two levels of inundation (low, high). Plants were labeled with a nitrogen (N) stable isotope tracer to estimate plant consumption by the two crab species. At both levels of inundation, we found that S. reticulatum had a significant negative impact on both above- and below-ground biomass by physically clipping and uprooting the plants, whereas U. pugilator had no significant impact. Low inundation treatments for both crab species had significantly greater aboveground biomass than high inundation. Stable N isotope tracer levels were roughly the same for both S. reticulatum and U. pugilator tissue, suggesting that the impact of S. reticulatum on S. patens was not through consumption of the plants. Overall, our results suggest the pot

  3. A remarkable new crab-like hermit crab (Decapoda: Paguridae) from French Polynesia, with comments on carcinization in the Anomura.

    Science.gov (United States)

    Anker, Arthur; Paulay, Gustav

    2013-01-01

    Patagurus rex gen. et sp. nov., a deep-water pagurid hermit crab, is described and illustrated based on a single specimen dredged from 400 m off Moorea, Society Islands, French Polynesia. Patagurus is characterized by a subtriangular, vaulted, calcified carapace, with large, wing-like lateral processes, and is closely related to two other atypical pagurid genera, Porcellanopagurus Filhol, 1885 and Solitariopagurus Türkay, 1986. The broad, fully calcified carapace, calcified branchiostegites, as well as broad and rigidly articulated thoracic sternites make this remarkable animal one of the most crab-like hermit crabs. Patagurus rex carries small bivalve shells to protect its greatly reduced pleon. Carcinization pathways among asymmetrical hermit crabs and other anomurans are briefly reviewed and discussed.

  4. The phylogeny of fossil whip spiders.

    Science.gov (United States)

    Garwood, Russell J; Dunlop, Jason A; Knecht, Brian J; Hegna, Thomas A

    2017-04-21

    Arachnids are a highly successful group of land-dwelling arthropods. They are major contributors to modern terrestrial ecosystems, and have a deep evolutionary history. Whip spiders (Arachnida, Amblypygi), are one of the smaller arachnid orders with ca. 190 living species. Here we restudy one of the oldest fossil representatives of the group, Graeophonus anglicus Pocock, 1911 from the Late Carboniferous (Duckmantian, ca. 315 Ma) British Middle Coal Measures of the West Midlands, UK. Using X-ray microtomography, our principal aim was to resolve details of the limbs and mouthparts which would allow us to test whether this fossil belongs in the extant, relict family Paracharontidae; represented today by a single, blind species Paracharon caecus Hansen, 1921. Tomography reveals several novel and significant character states for G. anglicus; most notably in the chelicerae, pedipalps and walking legs. These allowed it to be scored into a phylogenetic analysis together with the recently described Paracharonopsis cambayensis Engel & Grimaldi, 2014 from the Eocene (ca. 52 Ma) Cambay amber, and Kronocharon prendinii Engel & Grimaldi, 2014 from Cretaceous (ca. 99 Ma) Burmese amber. We recovered relationships of the form ((Graeophonus (Paracharonopsis + Paracharon)) + (Charinus (Stygophrynus (Kronocharon (Charon (Musicodamon + Paraphrynus)))))). This tree largely reflects Peter Weygoldt's 1996 classification with its basic split into Paleoamblypygi and Euamblypygi lineages; we were able to score several of his characters for the first time in fossils. Our analysis draws into question the monophyly of the family Charontidae. Our data suggest that Graeophonus is a crown group amblypygid, and falls within a monophyletic Paleoamblypgi clade, but outside the family Paracharontidae (= Paracharonopsis + Paracharon). Our results also suggest a new placement for the Burmese amber genus Kronocharon, a node further down from its original position. Overall, we offer a

  5. Ultrastructure of spermatozoa of spider crabs, family Mithracidae (Crustacea, Decapoda, Brachyura): Integrative analyses based on morphological and molecular data.

    Science.gov (United States)

    Assugeni, Camila de O; Magalhães, Tatiana; Bolaños, Juan A; Tudge, Christopher C; Mantelatto, Fernando L; Zara, Fernando J

    2017-12-01

    Recent studies based on morphological and molecular data provide a new perspective concerning taxonomic aspects of the brachyuran family Mithracidae. These studies proposed a series of nominal changes and indicated that the family is actually represented by a different number and representatives of genera than previously thought. Here, we provide a comparative description of the ultrastructure of spermatozoa and spermatophores of some species of Mithracidae in a phylogenetic context. The ultrastructure of the spermatozoa and spermatophore was observed by scanning and transmission electron microscopy. The most informative morphological characters analysed were thickness of the operculum, shape of the perforatorial chamber and shape and thickness of the inner acrosomal zone. As a framework, we used a topology based on a phylogenetic analysis using mitochondrial data obtained here and from previous studies. Our results indicate that closely related species share a series of morphological characteristics of the spermatozoa. A thick operculum, for example, is a feature observed in species of the genera Amphithrax, Teleophrys, and Omalacantha in contrast to the slender operculum observed in Mithraculus and Mithrax. Amphithrax and Teleophrys have a rhomboid perforatorial chamber, while Mithraculus, Mithrax, and Omalacantha show a wider, deltoid morphology. Furthermore, our results are in agreement with recently proposed taxonomic changes including the separation of the genera Mithrax (previously Damithrax), Amphithrax (previously Mithrax) and Mithraculus, and the synonymy of Mithrax caribbaeus with Mithrax hispidus. Overall, the spermiotaxonomy of these species of Mithracidae represent a novel set of data that corroborates the most recent taxonomic revision of the family and can be used in future taxonomic and phylogenetic studies within this family. © 2017 Wiley Periodicals, Inc.

  6. Occurrence of the spider crab Acanthonyx euryseroche, a seaweed associate along the central west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Joshi, S.A.; Savant, S.B.; Kulkarni, V.A.; Shenai-Tirodkar, P.; Emparanza, E.J.M.; Jagtap, T.G.

    , T. J. and Koteeswaran, R., Ploidy induction and sex con- trol in fish. Hydrobiologia, 1998, 384, 167–243. 11. Rao, G. R., Tripathi, S. D. and Sahu, A. K., Breeding and seed production of the Asian catfish Clarias batrachus (Lin.). Central..., directed forward, lateral margin of eave concave. Eyestalk was short, slender, cornea con- cealed under eye, eave completely covering eye when apposed against carapace. Hepatic margin was produced to triangular, flat, broad, with blunt tip, posterior...

  7. Microdissection of black widow spider silk-producing glands.

    Science.gov (United States)

    Jeffery, Felicia; La Mattina, Coby; Tuton-Blasingame, Tiffany; Hsia, Yang; Gnesa, Eric; Zhao, Liang; Franz, Andreas; Vierra, Craig

    2011-01-11

    Modern spiders spin high-performance silk fibers with a broad range of biological functions, including locomotion, prey capture and protection of developing offspring. Spiders accomplish these tasks by spinning several distinct fiber types that have diverse mechanical properties. Such specialization of fiber types has occurred through the evolution of different silk-producing glands, which function as small biofactories. These biofactories manufacture and store large quantities of silk proteins for fiber production. Through a complex series of biochemical events, these silk proteins are converted from a liquid into a solid material upon extrusion. Mechanical studies have demonstrated that spider silks are stronger than high-tensile steel. Analyses to understand the relationship between the structure and function of spider silk threads have revealed that spider silk consists largely of proteins, or fibroins, that have block repeats within their protein sequences. Common molecular signatures that contribute to the incredible tensile strength and extensibility of spider silks are being unraveled through the analyses of translated silk cDNAs. Given the extraordinary material properties of spider silks, research labs across the globe are racing to understand and mimic the spinning process to produce synthetic silk fibers for commercial, military and industrial applications. One of the main challenges to spinning artificial spider silk in the research lab involves a complete understanding of the biochemical processes that occur during extrusion of the fibers from the silk-producing glands. Here we present a method for the isolation of the seven different silk-producing glands from the cobweaving black widow spider, which includes the major and minor ampullate glands [manufactures dragline and scaffolding silk], tubuliform [synthesizes egg case silk], flagelliform [unknown function in cob-weavers], aggregate [makes glue silk], aciniform [synthesizes prey wrapping and egg

  8. Molecular cloning and expression of the C-terminus of spider ...

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    . Among the types of spider silks, draglines from Nephila clavipes and Araneus diadematus have been the most intensely studied. However, the entirety of a spider silk gene has not been cloned yet, and sequence data from. Molecular cloning ...

  9. Spider Web DNA: A New Spin on Noninvasive Genetics of Predator and Prey.

    Directory of Open Access Journals (Sweden)

    Charles C Y Xu

    Full Text Available Noninvasive genetic sampling enables biomonitoring without the need to directly observe or disturb target organisms. This paper describes a novel and promising source of noninvasive spider and insect DNA from spider webs. Using black widow spiders (Latrodectus spp. fed with house crickets (Acheta domesticus, we successfully extracted, amplified, and sequenced mitochondrial DNA from spider web samples that identified both spider and prey to species. Detectability of spider DNA did not differ between assays with amplicon sizes from 135 to 497 base pairs. Spider and prey DNA remained detectable at least 88 days after living organisms were no longer present on the web. Spider web DNA as a proof-of-concept may open doors to other practical applications in conservation research, pest management, biogeography studies, and biodiversity assessments.

  10. Spider Web DNA: A New Spin on Noninvasive Genetics of Predator and Prey.

    Science.gov (United States)

    Xu, Charles C Y; Yen, Ivy J; Bowman, Dean; Turner, Cameron R

    2015-01-01

    Noninvasive genetic sampling enables biomonitoring without the need to directly observe or disturb target organisms. This paper describes a novel and promising source of noninvasive spider and insect DNA from spider webs. Using black widow spiders (Latrodectus spp.) fed with house crickets (Acheta domesticus), we successfully extracted, amplified, and sequenced mitochondrial DNA from spider web samples that identified both spider and prey to species. Detectability of spider DNA did not differ between assays with amplicon sizes from 135 to 497 base pairs. Spider and prey DNA remained detectable at least 88 days after living organisms were no longer present on the web. Spider web DNA as a proof-of-concept may open doors to other practical applications in conservation research, pest management, biogeography studies, and biodiversity assessments.

  11. Riparian spiders as sentinels of PCB contamination across heterogeneous aquatic ecosystems

    Science.gov (United States)

    Riparian spiders are being used increasingly to track spatial patterns of contaminants in and fluxing from aquatic ecosystems. However, our understanding of the circumstances under which spiders are effective sentinels of aquatic pollution is limited. The present study tests the ...

  12. Spider Web DNA: A New Spin on Noninvasive Genetics of Predator and Prey

    Science.gov (United States)

    Xu, Charles C. Y.; Yen, Ivy J.; Bowman, Dean; Turner, Cameron R.

    2015-01-01

    Noninvasive genetic sampling enables biomonitoring without the need to directly observe or disturb target organisms. This paper describes a novel and promising source of noninvasive spider and insect DNA from spider webs. Using black widow spiders (Latrodectus spp.) fed with house crickets (Acheta domesticus), we successfully extracted, amplified, and sequenced mitochondrial DNA from spider web samples that identified both spider and prey to species. Detectability of spider DNA did not differ between assays with amplicon sizes from 135 to 497 base pairs. Spider and prey DNA remained detectable at least 88 days after living organisms were no longer present on the web. Spider web DNA as a proof-of-concept may open doors to other practical applications in conservation research, pest management, biogeography studies, and biodiversity assessments. PMID:26606730

  13. Advances in spot curing technology

    International Nuclear Information System (INIS)

    Burga, R.

    1999-01-01

    A brief review of spot curing technology was presented. The process which a spot of energy of a specific wavelength bandwidth and irradiance is used to cause a coating, encapsulant or adhesive to change from a liquid to a solid state

  14. AFSC/RACE/SAP/Long: Data from: Embryo development in golden king crab, Lithodes aequispina.

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data from this study, describes embryo development in Golden king crab, Lithodes aequispinus. Six female multiparous golden king crab were captured from the...

  15. 78 FR 21912 - Proposed Information Collection; Comment Request; Crab Rationalization (CR) Program: Annual Report

    Science.gov (United States)

    2013-04-12

    ... DEPARTMENT OF COMMERCE National Oceanic and Atmospheric Administration Proposed Information Collection; Comment Request; Crab Rationalization (CR) Program: Annual Report AGENCY: National Oceanic and... for a new information collection. Since implementation of the Crab Rationalization (CR) Program (prior...

  16. Acute toxicity of sodium metabisulphite on mangrove crab Ucides cordatus (Decapoda, Ucididae

    Directory of Open Access Journals (Sweden)

    Adriana B. Pedale

    2012-12-01

    Full Text Available The sodium metabisulphite salt is usually used in shrimp culture to prevent black spot. Unfortunately the toxicological effect of this xenobiotic in decapod crabs is unknown. Thus, the present study aims to investigate the sodium metabisulphite LC50 - 96 h in the mangrove species Ucides cordatus. Crabs were collected in the tidal creek margins in Bragança estuarine and were submitted to preliminary test (screening and posterior definitive test. Crabs were exposed in five different concentrations and a control group in five replicates, two crabs per recipient (5 L during 96 hours. A negative correlation was observed to sodium metabisulphite concentration in relation to dissolved oxygen and pH. At the end of the experiment were obtained the following mortality index in relation to sodium metabisulphite concentrations: 100% in 86.0 mg.L-1, 74% in 62.0 mg.L-1, 52% in 52.0 mg.L-1, 44% in 38.0 mg.L-1. The value of LC50 - 96 h for U. cordatus was determinate at 42.58 mg.L-1/Na2S2O5. The results strongly indicate that sodium metabisulphite is toxic for U. cordatus, and this crab could be used for biomonitoring the environmental impact.O metabissulfito de sódio é um sal habitualmente usado no cultivo de camarão a fim de se evitar a melanose. Infelizmente o efeito toxicológico deste xenobiótico em caranguejos decápodes é desconhecido. O presente estudo objetiva investigar o LC50 - 96 h do metabissulfito de sódio na espécie Ucides cordatus em manguezal. A coleta dos caranguejos foi realizada nas margens do canal de maré estuarino em Bragança/PA. Os caranguejos foram submetidos a um teste preliminar (screening e posteriormente ao teste definitivo, e foram expostos a cinco concentrações diferentes e um grupo controle com cinco repetições, com dois caranguejos por recipiente (5 L durante 96 horas. Houve correlação negativa no aumento da concentração de metabissulfito de sódio com o oxigênio dissolvido e pH. No final do experimento foram

  17. First report of clinical presentation of a bite by a running spider ...

    African Journals Online (AJOL)

    This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

  18. Processing and products quality assessment lyophilized mangrove crab(Ucides cordatus)

    OpenAIRE

    LucÃlia KÃtia de Lima

    2015-01-01

    The mangrove crab, Ucides cordatus is one of the most shellfish produced in Brazil, but his consumption becomes scarce during closed season. This study aimed development of freezedried products of the mangrove crab stored at ambient temperature and analyze the effect of lyophilization in relation to physicalchemical, microbiological, nutritional and sensory characteristics. Two products were developed: a "freeze-dried crab meat" and "freeze-dried crab cone". The product quality wa...

  19. Design and prototyping of HL-LHC double quarter wave crab cavities for SPS test

    Energy Technology Data Exchange (ETDEWEB)

    Verdu-Andres, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Skaritka, J. [Brookhaven National Lab. (BNL), Upton, NY (United States); Wu, Q. [Brookhaven National Lab. (BNL), Upton, NY (United States); Xiao, B. [Brookhaven National Lab. (BNL), Upton, NY (United States); Belomestnykh, S. [Brookhaven National Lab. (BNL), Upton, NY (United States); Stony Brook Univ., NY (United States); Ben-Zvi, I. [Brookhaven National Lab. (BNL), Upton, NY (United States); Stony Brook Univ., NY (United States); Alberty, L. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Artoos, K. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Calaga, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Capatina, O. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Capelli, T. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Carra, F. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Leuxe, R. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Kuder, N. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Zanoni, C. [European Organization for Nuclear Research (CERN), Geneva (Switzerland); Li, Z. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Ratti, A. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-05-03

    The LHC high luminosity project envisages the use of the crabbing technique for increasing and levelling the LHC luminosity. Double Quarter Wave (DQW) resonators are compact cavities especially designed to meet the technical and performance requirements for LHC beam crabbing. Two DQW crab cavities are under fabrication and will be tested with beam in the Super Proton Synchrotron (SPS) at CERN by 2017. This paper describes the design and prototyping of the DQW crab cavities for the SPS test.

  20. Reciprocal Responses in the Interaction between Arabidopsis and the Cell-Content-Feeding Chelicerate Herbivore Spider Mite1[W][OPEN

    Science.gov (United States)

    Zhurov, Vladimir; Navarro, Marie; Bruinsma, Kristie A.; Arbona, Vicent; Santamaria, M. Estrella; Cazaux, Marc; Wybouw, Nicky; Osborne, Edward J.; Ens, Cherise; Rioja, Cristina; Vermeirssen, Vanessa; Rubio-Somoza, Ignacio; Krishna, Priti; Diaz, Isabel; Schmid, Markus; Gómez-Cadenas, Aurelio; Van de Peer, Yves; Grbić, Miodrag; Clark, Richard M.; Van Leeuwen, Thomas; Grbić, Vojislava

    2014-01-01

    Most molecular-genetic studies of plant defense responses to arthropod herbivores have focused on insects. However, plant-feeding mites are also pests of diverse plants, and mites induce different patterns of damage to plant tissues than do well-studied insects (e.g. lepidopteran larvae or aphids). The two-spotted spider mite (Tetranychus urticae) is among the most significant mite pests in agriculture, feeding on a staggering number of plant hosts. To understand the interactions between spider mite and a plant at the molecular level, we examined reciprocal genome-wide responses of mites and its host Arabidopsis (Arabidopsis thaliana). Despite differences in feeding guilds, we found that transcriptional responses of Arabidopsis to mite herbivory resembled those observed for lepidopteran herbivores. Mutant analysis of induced plant defense pathways showed functionally that only a subset of induced programs, including jasmonic acid signaling and biosynthesis of indole glucosinolates, are central to Arabidopsis’s defense to mite herbivory. On the herbivore side, indole glucosinolates dramatically increased mite mortality and development times. We identified an indole glucosinolate dose-dependent increase in the number of differentially expressed mite genes belonging to pathways associated with detoxification of xenobiotics. This demonstrates that spider mite is sensitive to Arabidopsis defenses that have also been associated with the deterrence of insect herbivores that are very distantly related to chelicerates. Our findings provide molecular insights into the nature of, and response to, herbivory for a representative of a major class of arthropod herbivores. PMID:24285850

  1. [Distribution of Paragonimus (Digenea: Troglotrematidae) in Antioquia Province, Colombia, based on metacercariae counts in freshwater crabs].

    Science.gov (United States)

    Uruburu, Mónica; Granada, Mabel; Velásquez, Luz Elena

    2008-12-01

    Paragonimosis or lung fluke disease courses with signs similar to those seen in tuberculosis. The causative agent is a parasite of the genus Paragonimus (Digenea: Troglotrematidae). People become infected by ingesting raw or partially cooked crabs containing metacercariae. The first focus of human paragonimosis in Colombia was recorded in the county of Urrao, where two species of crabs infected with Paragonimus were found. In 2005, crabs with Paragonimus' metacercariae were captured near Medellín, western Colombia. This prompted a search for the parasite in other locations through its presence in the crabs. To establish the distribution of Paragonimus in Antioquia, we evaluated the presence of metacercaria in freshwater brachyuran crabs. From 2005 to 2007, crabs were captured in 13 counties of Antioquia. The crabs were relaxed and dissected to determine presence of trematodes and then to make the taxonomic identifications. From 52 crabs captured in 9 counties, 42 (80.8%) were found with Paragonimus metacercariae. The crabs were identified as Pseudothelphusidae in 2 genera--Hypolobocera and Strengeriana--and were assigned to four species. Three of the species were recorded for the first time as hosts of Paragonimus. A Paragonimus' distribution map was constructed for Antioquia; for the first time urban zones were included. Because of the high rate of infection, the handling and consumption of raw and poorly cooked crabs pose risk factors for human infection. Because crabs are affordable and provide means of easy diagnosis, crabs are targeted as primary agents of and diagnostic tools for paragonmosis.

  2. Status of the mud crab fishery in Kenya: A review | Mirera | Western ...

    African Journals Online (AJOL)

    In Kenya, mud crabs are fished mainly by men and to a lesser extent by women and children due to the accessibility of the fishing areas by foot. This makes mud crabs a key fishery that is easily accessible for exploitation by most coastal artisanal fishers for subsistence and commercial purposes. Mud crabs have been a ...

  3. Simulating cryptic movements of a mangrove crab : Recovery phenomena after small scale fishery

    NARCIS (Netherlands)

    Piou, C.; Berger, U.; Hildenbrandt, H.; Grimm, V.; Diele, K.; D'Lima, C.

    2007-01-01

    The semi-terrestrial burrowing crab Ucides cordatus is an important ecological component and economic resource of Brazilian mangrove forests. The crab population of the Caete peninsula (the location of our study site) has been exploited for the last 40 years. Recovery of fished areas by crabs from

  4. 76 FR 25545 - Safety Zone; Blue Crab Festival Fireworks Display, Little River, Little River, SC

    Science.gov (United States)

    2011-05-05

    ...-AA00 Safety Zone; Blue Crab Festival Fireworks Display, Little River, Little River, SC AGENCY: Coast... zone on the waters of Little River in Little River, South Carolina during the Blue Crab Festival... this rule because the Coast Guard did not receive notice of the Blue Crab Festival Fireworks Display...

  5. Radiation Safety System for SPIDER Neutral Beam Accelerator

    Science.gov (United States)

    Sandri, S.; Coniglio, A.; D'Arienzo, M.; Poggi, C.

    2011-12-01

    SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

  6. SPIDER: Probing the Early Universe with a Suborbital Polarimeter

    Science.gov (United States)

    Fraisse, Aurélien A.; SPIDER Collaboration

    2012-01-01

    SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

  7. Recent Advances in Research on Widow Spider Venoms and Toxins

    Directory of Open Access Journals (Sweden)

    Shuai Yan

    2015-11-01

    Full Text Available Widow spiders have received much attention due to the frequently reported human and animal injures caused by them. Elucidation of the molecular composition and action mechanism of the venoms and toxins has vast implications in the treatment of latrodectism and in the neurobiology and pharmaceutical research. In recent years, the studies of the widow spider venoms and the venom toxins, particularly the α-latrotoxin, have achieved many new advances; however, the mechanism of action of the venom toxins has not been completely clear. The widow spider is different from many other venomous animals in that it has toxic components not only in the venom glands but also in other parts of the adult spider body, newborn spiderlings, and even the eggs. More recently, the molecular basis for the toxicity outside the venom glands has been systematically investigated, with four proteinaceous toxic components being purified and preliminarily characterized, which has expanded our understanding of the widow spider toxins. This review presents a glance at the recent advances in the study on the venoms and toxins from the Latrodectus species.

  8. Treatment effect on biases in size estimation in spider phobia.

    Science.gov (United States)

    Shiban, Youssef; Fruth, Martina B; Pauli, Paul; Kinateder, Max; Reichenberger, Jonas; Mühlberger, Andreas

    2016-12-01

    The current study investigates biases in size estimations made by spider-phobic and healthy participants before and after treatment. Forty-one spider-phobic and 20 healthy participants received virtual reality (VR) exposure treatment and were then asked to rate the size of a real spider immediately before and, on average, 15days after the treatment. During the VR exposure treatment skin conductance response was assessed. Prior to the treatment, both groups tended to overestimate the size of the spider, but this size estimation bias was significantly larger in the phobic group than in the control group. The VR exposure treatment reduced this bias, which was reflected in a significantly smaller size rating post treatment. However, the size estimation bias was unrelated to the skin conductance response. Our results confirm the hypothesis that size estimation by spider-phobic patients is biased. This bias is not stable over time and can be decreased with adequate treatment. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. Systematics and biogeography of Cuban porcelain crabs (Decapoda: Anomura: Porcellanidae).

    Science.gov (United States)

    Diez, Yander L; Lira, Carlos

    2017-01-10

    Marine crustaceans are a well-known invertebrates group in Cuban waters, but some taxa are not well catalogued and the literature about them is scattered. In this work, we present the checklist of porcelain crabs of Cuban Archipelago, including the literature registers and unpublished author's data. A key to the identification of 8 genera and 23 species of the Cuban porcelain crabs is provided. Information about the local distribution of species is presented. In addition, we analyzed the porcelain crab faunal affinities between the ecoregions of the Cuban platform, Greater Antilles islands and the Tropical Northwestern Atlantic (TNA) province. For the first time, we record the presence of the monotypic genus Parapetrolisthes Haig in Cuba. On the Cuban platform, the highest similarities are between the Southcentral and Northwestern ecoregions (50%) and between Northcentral and Northeastern (40%). In the Greater Antilles, Cuba and Puerto Rico are the most similar (54%), but in general, the porcelain crab composition shows a high variation (e. g. 19% between Hispaniola and Puerto Rico). In the Tropical Northwestern Atlantic, five homogeneous groups of porcelain crab species are distinguished. Cuban fauna is most similar to that of Floridian, Western Caribbean and Southern Gulf of Mexico ecoregions. The decrease in species richness is evident from south to north in the TNA Province.

  10. Habits and customs of crab catchers in southern Bahia, Brazil.

    Science.gov (United States)

    Firmo, Angélica M S; Tognella, Mônica M P; Tenório, Gabrielle D; Barboza, Raynner R D; Alves, Rômulo R N

    2017-08-23

    Brazilian mangrove forests are widely distributed along the coast and exploited by groups of people with customs and habits as diverse as the biology of the mangrove ecosystems. This study identifies different methods of extracting crabs that inhabit the mangrove belts; some of these activities, such as catching individual crabs by hand, are aimed at maintaining natural stocks of this species in Mucuri (south Bahia), Brazil. In the studied community, illegal hunting activities that violate Brazilian legislation limiting the use of tangle-netting in mangrove ecosystem were observed. According to our observations, fishermen, to catch individual crabs, use the tangle-netting technique seeking to increase income and are from families that have no tradition of extraction. This analysis leads us to conclude that catchers from economically marginalised social groups enter mangroves for purposes of survival rather than for purposes of subsistence, because the catching by tangle-netting is a predatory technique. Tangle-netting  technique increase caught but also increases their mortality rate. We emphasise that traditional catching methods are unique to Brazil and that manual capturing of crab should be preserved through public policies aimed at maintaining the crab population.

  11. Lunar occultation observations of the Crab Nebula

    International Nuclear Information System (INIS)

    Maloney, F.P.

    1977-01-01

    Three lunar of occultations of the Crab Nebula were observed, two at 114 MHz and one at 26.3 MHz, during the 1974 series of events. The higher frequency observations were deconvolved of diffraction effects to yield four strip integrated brightness profiles of the Nebula, with an effective resolution of 30 arc-seconds. These four profiles were Fourier inverted and cleaned of sidelobe structure to synthesize a two-dimensional map of the Nebula. At 114 MHz, the Nebula is composed of a broad envelope of emission which contains several smaller sources. The attenuation of the low radio frequency radiation by the thermal hydrogen in the filaments is considered as a possible mechanism to explain these new data. The 26.3 MHz observations indicate the presence of a bright, localized source containing greater than 80% of the flux of the Nebula. The position of the source is confined by the data to a narrow strip centered at the pulsar position. Both sets of data are compared with past occultation observations

  12. Spot Welding of Honeycomb Structures

    Science.gov (United States)

    Cohal, V.

    2017-08-01

    Honeycomb structures are used to prepare meals water jet cutting machines for textile. These honeycomb structures are made of stainless steel sheet thickness of 0.1-0.2 mm. Corrugated sheet metal strips are between two gears with special tooth profile. Hexagonal cells for obtaining these strips are welded points between them. Spot welding device is three electrodes in the upper part, which carries three welding points across the width of the strip of corrugated sheet metal. Spot welding device filled with press and advance mechanisms. The paper presents the values of the regime for spot welding.

  13. Recombinant Protein Containing B-Cell Epitopes of Different Loxosceles Spider Toxins Generates Neutralizing Antibodies in Immunized Rabbits

    Directory of Open Access Journals (Sweden)

    Sabrina de Almeida Lima

    2018-04-01

    Full Text Available Loxoscelism is the most important form of araneism in South America. The treatment of these accidents uses heterologous antivenoms obtained from immunization of production animals with crude loxoscelic venom. Due to the scarcity of this immunogen, new alternatives for its substitution in antivenom production are of medical interest. In the present work, three linear epitopes for Loxosceles astacin-like protease 1 (LALP-1 (SLGRGCTDFGTILHE, ENNTRTIGPFDYDSIMLYGAY, and KLYKCPPVNPYPGGIRPYVNV and two for hyaluronidase (LiHYAL (NGGIPQLGDLKAHLEKSAVDI and ILDKSATGLRIIDWEAWR from Loxosceles intermedia spider venom were identified by SPOT-synthesis technique. One formerly characterized linear epitope (DFSGPYLPSLPTLDA of sphingomyelinase D (SMase D SMase-I from Loxosceles laeta was also chosen to constitute a new recombinant multiepitopic protein. These epitopes were combined with a previously produced chimeric multiepitopic protein (rCpLi composed by linear and conformational B-cell epitopes from SMase D from L. intermedia venom, generating a new recombinant multiepitopic protein derived from loxoscelic toxins (rMEPLox. We demonstrated that rMEPLox is non-toxic and antibodies elicited in rabbits against this antigen present reactivity in ELISA and immunoblot assays with Brazilian L. intermedia, L. laeta, L. gaucho, and L. similis spider venoms. In vivo and in vitro neutralization assays showed that anti-rMEPLox antibodies can efficiently neutralize the sphingomyelinase, hyaluronidase, and metalloproteinase activity of L. intermedia venom. This study suggests that this multiepitopic protein can be a suitable candidate for experimental vaccination approaches or for antivenom production against Loxosceles spp. venoms.

  14. Interactions Between the Chilean Recluse Spider (Araneae: Sicariidae) and an Araneophagic Spitting Spider (Araneae: Scytodidae).

    Science.gov (United States)

    Canals, Mauricio; Arriagada, Nicolás; Solís, Rigoberto

    2015-03-01

    In Chile, all necrotic arachnidism is attributed to the Chilean recluse spider, Loxosceles laeta Nicolet, a species that shares the microenvironmental habitats with the spitting spider Scytodes globula Nicolet. The latter species has been proposed as a potential predator of L. laeta. For this research, we studied the interaction between both species during individual encounters to assess the possibility of population regulation of L. laeta cohorts exposed to this potential predator. We found that in most encounters S. globula prevailed. Also, S. globula preys on spiderlings of L. laeta, with a population effect on cohorts of this species. These findings suggest that S. globula may be influencing L. laeta populations in central Chile. The population regulation of L. laeta by predation would be important because this species, in the absence of predators, has a high reproductive rate, and it can maintain populations of large size. However according to our results, although S. globula may aid in the reduction of both spiderling and adult L. laeta populations, and perhaps other Loxosceles species, it is insufficient for biological control of Loxosceles species. Its presence together with other control measures such as hygiene of the rooms can help to decrease loxoscelism incidence. © The Author 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  15. Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

    Directory of Open Access Journals (Sweden)

    Wenjin Gan

    2015-10-01

    Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

  16. Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

    Science.gov (United States)

    Vetter, Richard S; Rust, Michael K

    2010-06-01

    In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

  17. How spiders practice aggressive and Batesian mimicry

    Directory of Open Access Journals (Sweden)

    Ximena J. NELSON, Robert R. JACKSON

    2012-08-01

    Full Text Available To understand communication, the interests of the sender and the receiver/s of signals should be considered separately. When our goal is to understand the adaptive significance of specific responses to specific signals by the receiver, questions about signal information are useful. However, when our goal is to understand the adaptive significance to the sender of generating a signal, it may be better to envisage the receiver’s response to signals as part of the sender’s extended phenotype. By making signals, a sender interfaces with the receiver’s model of the world and indirectly manipulates its behaviour. This is especially clear in cases of mimicry, where animals use deceptive signals that indirectly manipulate the behaviour of receivers. Many animals adopt Batesian mimicry to deceive their predators, or aggressive mimicry to deceive their prey. We review examples from the lite­rature on spiders to illustrate how these phenomena, traditionally thought of as distinct, can become entangled in a web of lies [Current Zoology 58 (4: 620–629, 2012].

  18. Multivariable control of a rolling spider drone

    Science.gov (United States)

    Lyu, Haifeng

    The research and application of Unmanned Aerial Vehicles (UAVs) has been a hot topic recently. A UAV is dened as an aircraft which is designed not to carry a human pilot or operated with remote electronic input by the flight controller. In this thesis, the design of a control system for a quadcopter named Rolling Spider Drone is conducted. The thesis work presents the design of two kinds of controllers that can control the Drone to keep it balanced and track different kinds of input trajectories. The nonlinear mathematical model for the Drone is derived by the Newton-Euler method. The rotational subsystem and translational system are derived to describe the attitude and position motion of Drone. Techniques from linear control theory are employed to linearize the highly coupled and nonlinear quadcopter plant around equilibrium points and apply the linear feedback controller to stabilize the system. The controller is a digital tracking system that deploys LQR for system stability design. Fixed gain and adaptive gain scheduled controllers are developed and compared with different LQR weights. Step references and reference trajectories involving signicant variation for the yaw angle in the xy-plane and three-dimensional spaces are tracked in the simulation. The physical implementation and an output feedback controller are considered for future work.

  19. Efficient Journaling for the Spider Storage System

    Energy Technology Data Exchange (ETDEWEB)

    Oral, H Sarp [ORNL; Wang, Feiyi [ORNL; Shipman, Galen M [ORNL; Dillow, David A [ORNL; Miller, Ross G [ORNL; Drokin, Oleg [ORNL

    2003-01-01

    Journaling is a widely used technique to increase file system robustness against meta data and/or data corruptions. While the overhead of journaling can be negligible for small-scale file systems, we found that two aspects of local back-end file system journaling significantly lower the overall performance of a large-scale parallel file system such as Lustre: extra head seeks and serialization of incoming client requests. Journal transactions reside on a separate area of the disk that the file data, and each commit of the journal requires a head seek. Incoming client requests become serialized and take a latency hit by waiting for a commit to occur before the reply is sent. In this paper we present two different approaches to increase the local back-end file system journaling efficiency, thus increasing the overall aggregate parallel file system efficiency. First, we present a hardware-based solution where a solid-state device is used as an external journaling device to minimize the disk head seek. Second, we introduce a software-based optimization to allow asynchronously commit multiple journal transactions on the local back-end file system to minimize the penalty of serialization. Both our solutions are experimentally tested on Oak Ridge National Laboratory's large-scale Spider storage system and our tests show that both methods nearly double the overall parallel write performance.

  20. Development of locomotion in a subsocial spider.

    Science.gov (United States)

    Ahn, Soon Kil; Kim, Kil Won

    2015-04-01

    Following consumption of their mother, the subsocial spider Amaurobius ferox remain together, exhibiting distinctive behaviours in response to intruders into the natal nest. We examined the ontogeny and characteristics of locomotory behaviours in A. ferox during this post-maternal social period. Locomotion of the spiderlings, elicited by the introduction of a cricket larva into the natal web, fell into two categories: 'abrupt locomotion' (AL) and 'ordinary locomotion' (OL). AL involved rapid and linear movement, whereas OL involved slower motion, not necessarily in a straight line. Both types of locomotion varied with spiderling age. AL appeared for only a limited period of time whereas the frequency of OL increased linearly over time. AL occurred more collectively than OL: the percentage of participants in a bout of locomotion was 18.67±17.71% vs. 10.22±9.33%. The collective tendency of AL increased up until the seventh day and then decreased, whereas that of OL progressively decreased. The direction of AL responses to the intruder did not vary over time; however, for OL, movements towards increased in frequency over time. Locomotory responses also varied with the intensity of intruder movement. Including transient behaviours, the chronology of different behaviours suggests that behavioural development in A. ferox involves maternal influences and weakens group cohesion and collective tendency. Copyright © 2015 Elsevier B.V. All rights reserved.

  1. 76 FR 35772 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2011-06-20

    ... Aleutian Islands Crab Rationalization Program AGENCY: National Marine Fisheries Service (NMFS), National... Tanner Crabs. Amendment 34 amends the Bering Sea and Aleutian Islands Crab Rationalization Program to... for the Crab Rationalization Program are available from the NMFS Alaska Region Web site at http...

  2. 76 FR 35781 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2011-06-20

    ... Aleutian Islands Crab Rationalization Program; Amendment 37 AGENCY: National Marine Fisheries Service (NMFS... Tanner Crabs (FMP). This action amends the Bering Sea/Aleutian Islands Crab Rationalization Program by... Assessment prepared for the Crab Rationalization Program are available from the NMFS Alaska Region Web site...

  3. 76 FR 47155 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2011-08-04

    ... the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab Rationalization Program... program for the Bering Sea/Aleutian Islands crab fisheries managed under the BSAI Crab Rationalization... Center Web site at http://www.afsc.noaa.gov/ . For further information on the Crab Rationalization...

  4. 75 FR 56485 - Groundfish Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea/Aleutian Islands Crab...

    Science.gov (United States)

    2010-09-16

    .../Aleutian Islands Crab Rationalization Program; Recordkeeping and Reporting AGENCY: National Marine... rule. SUMMARY: NMFS issues regulations to remove the Crab Rationalization Program requirements for.... Background The Crab Rationalization (CR) Program is a limited-access system that allocates crab managed under...

  5. 77 FR 44216 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2012-07-27

    ... the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab Rationalization Cost... Rationalization Program. This action is intended to provide holders of crab allocations with the fee percentage for the 2012/2013 crab fishing year. DATES: Fee liability payments made by the Crab Rationalization...

  6. 76 FR 43658 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2011-07-21

    ... the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab Rationalization Cost... Rationalization Program. This action is intended to provide holders of crab allocations with the fee percentage... that must be submitted by July 31, 2012. DATES: The Crab Rationalization Program Registered Crab...

  7. 75 FR 43147 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2010-07-23

    ... the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab Rationalization Cost... Rationalization Program. This action is intended to provide holders of crab allocations with the fee percentage... that must be submitted by July 31, 2011. DATES: The Crab Rationalization Program Registered Crab...

  8. 78 FR 46577 - Fisheries of the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab...

    Science.gov (United States)

    2013-08-01

    ... the Exclusive Economic Zone Off Alaska; Bering Sea and Aleutian Islands Crab Rationalization Cost... Rationalization Program. This action is intended to provide holders of crab allocations with the fee percentage... that must be submitted by July 31, 2014. DATES: The Crab Rationalization Program Registered Crab...

  9. Final design of thermal diagnostic system in SPIDER ion source

    Energy Technology Data Exchange (ETDEWEB)

    Brombin, M., E-mail: matteo.brombin@igi.cnr.it; Dalla Palma, M.; Pasqualotto, R.; Pomaro, N. [Consorzio RFX, Corso Stati Uniti 4, I-35127 Padova (Italy)

    2016-11-15

    The prototype radio frequency source of the ITER heating neutral beams will be first tested in SPIDER test facility to optimize H{sup −} production, cesium dynamics, and overall plasma characteristics. Several diagnostics will allow to fully characterise the beam in terms of uniformity and divergence and the source, besides supporting a safe and controlled operation. In particular, thermal measurements will be used for beam monitoring and system protection. SPIDER will be instrumented with mineral insulated cable thermocouples, both on the grids, on other components of the beam source, and on the rear side of the beam dump water cooled elements. This paper deals with the final design and the technical specification of the thermal sensor diagnostic for SPIDER. In particular the layout of the diagnostic, together with the sensors distribution in the different components, the cables routing and the conditioning and acquisition cubicles are described.

  10. Tool use in wild spider monkeys (Ateles geoffroyi).

    Science.gov (United States)

    Lindshield, Stacy M; Rodrigues, Michelle A

    2009-07-01

    Tool use has been observed in a variety of primate species, including both New and Old World monkeys. However, such reports mainly address the most prodigious tool users and frequently limit discussions of tool-using behavior to a foraging framework. Here, we present observations of novel and spontaneous tool use in wild black-handed spider monkeys (Ateles geoffroyi), where female spider monkeys used detached sticks in a self-directed manner. We introduce factors to explain Ateles tool-using abilities and limitations, and encourage the synthesis of relevant research in order to gain insight into the cognitive abilities of spider monkeys and the evolution of tool-using behaviors in primates.

  11. Adhesion modulation using glue droplet spreading in spider capture silk.

    Science.gov (United States)

    Amarpuri, Gaurav; Zhang, Ci; Blackledge, Todd A; Dhinojwala, Ali

    2017-05-01

    Orb web spiders use sticky capture spiral silk to retain prey in webs. Capture spiral silk is composed of an axial fibre of flagelliform silk covered with glue droplets that are arranged in a beads-on-a-string morphology that allows multiple droplets to simultaneously extend and resist pull off. Previous studies showed that the adhesion of capture silk is responsive to environmental humidity, increasing up to an optimum humidity that varied among different spider species. The maximum adhesion was hypothesized to occur when the viscoelasticity of the glue optimized contributions from glue spreading and bulk cohesion. In this study, we show how glue droplet shape during peeling contributes significantly to capture silk adhesion. Both overspreading and underspreading of glue droplets reduces adhesion through changes in crack propagation and failure regime. Understanding the mechanism of stimuli-responsive adhesion of spider capture silk will lead to new designs for smarter adhesives. © 2017 The Author(s).

  12. Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

    DEFF Research Database (Denmark)

    Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

    2008-01-01

    At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the nocturnal navigational performances of L. arenicola. After excluding two or three pairs of eyes, the spiders were found to be able to navigate successfully using only their lateral eyes or only their anterior median eyes. Measurement of the eyes' visual fields showed that the secondary eyes combined have...... a near full (panoramic) view of the surroundings. The visual fields of the principal eyes overlap almost completely with those of the anterior lateral eyes. Electroretinogram recordings indicate that each eye type contains a single photopigment with sensitivity peaking at approximately 525 nm...

  13. [The black widow spider--its appearance and control].

    Science.gov (United States)

    Landeka, Nediljko; Plenković, Jasminka

    2003-03-01

    Between 1995 and 2002, a massive appearance of black widow (Latrodectus mactans tredecimguttatus, Rossi 1790) was recorded along the Croatia coast. This paper gives a historical review of latrodectism and observations from Istria and Dalmatia, paying particular attention to the spider's habitat. There are several reasons for the black widow to appear in a new habitat such as the introduction of leguminous plants, watermelons and melons where crops were grown earlier. Black widow can also be found near buildings and gardens. Human contacts with the spider are usually without consequences for humans, thanks to education and a relatively good visibility of the spider. The authors describe their experience in fighting black widow and emphasise the importance of education in preventing lactrodectism.

  14. Stable isotope analyses of web-spinning spider assemblages along a headwater stream in Puerto Rico

    Directory of Open Access Journals (Sweden)

    Sean P. Kelly

    2015-10-01

    Full Text Available Web-spinning spiders that inhabit stream channels are considered specialists of aquatic ecosystems and are major consumers of emerging aquatic insects, while other spider taxa are more commonly found in riparian forests and as a result may consume more terrestrial insects. To determine if there was a difference in spider taxa abundance between riverine web-spinning spider assemblages within the stream channel and the assemblages 10 m into the riparian forest, we compared abundances for all web-spinning spiders along a headwater stream in El Yunque National Forest in northeast Puerto Rico. By using a nonmetric dimensional scaling (NMDS abundance analysis we were able to see a clear separation of the two spider assemblages. The second objective of the study was to determine if aquatic insects contributed more to the diet of the spider assemblages closest to the stream channel and therefore stable isotope analyses of δ15N and δ13C for web-spinning spiders along with their possible prey were utilized. The results of the Bayesian mixing model (SIAR however showed little difference in the diets of riverine (0 m, riparian (10 m and upland (25 m spiders. We found that aquatic insects made up ∼50% of the diet for web-spinning spiders collected at 0 m, 10 m, and 25 m from the stream. This study highlights the importance of aquatic insects as a food source for web-spinning spiders despite the taxonomic differences in assemblages at different distances from the stream.

  15. Associational resistance protects mangrove leaves from crab herbivory

    Science.gov (United States)

    Erickson, Amy A.; Bell, Susan S.; Dawes, Clinton J.

    2012-05-01

    While associational defenses have been well documented in many plant and algal ecosystems, this study is the first to document associational resistance in mangroves. Mangrove tree crab (Aratus pisonii) density and herbivory on three life-stages of the red mangrove (Rhizophora mangle) were documented in pure red versus mixed-species and predominantly non-red mangrove stands containing black (Avicennia germinans) and white (Laguncularia racemosa) mangroves in 1999-2000 in Tampa Bay, Florida. This study first established that R. mangle is the focal species in the context of associational resistance because it is damaged more than either of the other mangrove species. Next, it was hypothesized that crab density and leaf damage on R. mangle would be lower when in mixed-species and predominantly non-red versus red mangrove stands. A non-significant trend suggested that crab density varies among stands, and crab damage on R. mangle leaves was significantly lower in mixed-species and non-red stands. Mechanisms to explain associational resistance were examined. Positive Pearson correlations between the percent of adult R. mangle in a stand and both crab density and R. mangle leaf damage provided support for the resource concentration hypothesis. Limited support was found for the attractant-decoy hypothesis because the total amount of damaged leaves of all mangrove species combined typically differed among stands, suggesting that crabs were not shifting to alternative mangrove species to offset reduced availability of R. mangle leaves. Finally, while R. mangle seedlings were shorter in non-red stands compared to others, intra-specific differences in R. mangle leaf chemistry and sclerophylly among stands failed to explain associational patterns. These combined results argue for the need for additional experiments to elucidate mechanisms responsible for defensive plant associations in mangrove ecosystems and to determine whether such associations could be of use in mangrove

  16. Habitat selection and energetics of the fiddler crab ( Uca tangeri)

    Science.gov (United States)

    Klaassen, Marcel; Ens, Bruno J.

    We tried to unravel the possible links between the skewed predation risk in Uca tangeri (where large individuals are more at risk from avian predators) and size-dependent changes in the physiology and habitat choice of this fiddler crab species. Over a transect running from low to high in the tidal zone of a beach in Mauritania, the temperature profile at various depths in the substrate, the water-table level of seep water, salt concentration of seep water, depth of the aerobic level, operative temperatures on the surface, and size distribution of crabs were assessed. In addition, resting metabolic rates, Q 10 and thermal and starvation tolerances were estimated. Going from low to high in the tidal zone, crab size and burrow depth increased. At the preferred burrowing depth, microclimatological conditions appeared to be equally favourable at all sites. At the surface, conditions were more favourable low in the tidal zone, where also food availability is sufficient to enable small crabs to forage in the vicinity of their burrows. Large crabs have higher energy requirements and are thereby forced to forage in flocks low in the tidal zone where food is probably more abundant. Low in the tidal zone, digging deeply is impossible as the aerobic layer is rather thin. Large crabs prefer living high in the tidal zone as (1) deep burrows ensure better protection against predators, (2) more time is available for digging holes and (3) the substrate is better suited for reproduction. Energy reserves in late summer ensured an average of 34 days of survival. It is argued that the allotment of energy to growth must be considerable even in reproducing animals; the rewards of growth being the disproportional increase in reproductive output with size.

  17. A preliminary checklist of spiders (Araneae: Arachnida in Chinnar Wildlife Sanctuary, Western Ghats, India

    Directory of Open Access Journals (Sweden)

    C. K. Adarsh

    2016-04-01

    Full Text Available A preliminary study was conducted to document spider diversity in Chinnar Wildlife Sanctuary, Idukki District, Kerala State in southern India.  The study was conducted from October to November 2012.  A total of 101 species of spiders belonging to 65 genera from 29 families were identified from the sanctuary.  This accounted for 6.98% of Indian spider species, 17.81% of Indian spider genera and 48.33% of the spider families of India.  The dominant families were Lycosidae (11 species and Araneidae (10.  Two endemic genera of Indian spiders such as Annandaliella and Neoheterophrictus were found at Chinnar, each representing one species each, and belonging to the family Theraphosidae.  A guild structure analysis of the spiders revealed seven feeding guilds such as orb weavers, stalkers, ground runners, foliage runners, sheet web builders, space web builders and ambushers. 

  18. Preliminary survey of a nemertean crab egg predator, Carcinonemertes, on its host crab, Callinectes arcuatus (Decapoda, Portunidae) from Golfo de Nicoya, Pacific Costa Rica

    Science.gov (United States)

    Okazaki, Robert K.; Wehrtmann, Ingo S.

    2014-01-01

    Abstract The possible presence of egg predators in brood masses of portunid crabs from Pacific Central America has not been studied yet. This survey reports the finding of a nemertean crab egg predator on the portunid crab, Callinectes arcuatus, from the Golfo de Nicoya, Pacific Costa Rica. Nemerteans were found in the egg masses of 26 out of the 74 crabs for a prevalence of 35%. The intensity (mean number of worms/ infected crab) was estimated to be 18 with a variance of 1–123 worms/infected crab. No nemerteans were observed either in the 19 Callinectes arcuatus from Golfo Dulce (southern Pacific coast) and the 10 Portunus asper from Herradura-Jaco (central Pacific coast). This nemertean is a member of the genus Carcinonemertes, which has been reported from the Caribbean coast of Panama. However, the encountered Carcinonemertes sp. is the first published finding and report from Costa Rica and Pacific Central America. PMID:25561848

  19. Latrodectism—Effects of the Black Widow Spider Bite

    Science.gov (United States)

    Timms, Patrick K.; Gibbons, Robert B.

    1986-01-01

    Latrodectism—envenomation by the black widow spider, Latrodectus mactans—has been reported in virtually every state. The spider is particularly prevalent in the Southwest, Southeast and California, and symptoms from its bite are painful and may be confusing to clinicians. Prompt improvement can be expected in most cases with administration of calcium and muscle relaxant, but some patients may require treatment with antivenin. No deaths occurred in our series of 11 patients, although one case was complicated by serum sickness. PMID:3962294

  20. Learning from animal sensors: the clever "design" of spider mechanoreceptors

    Science.gov (United States)

    Barth, Friedrich G.

    2012-04-01

    Three types of spider sensors responding to different forms of mechanical energy are chosen to illustrate the power of evolutionary constraints to fine-tune the functional "design" of animal sensors to the particular roles they play in particular behavioral contexts. As demonstrated by the application of computational biomechanics and a fruitful cooperation between biologists and engineers there are remarkable "technical" tricks to be found by which spider tactile sensors, airflow sensors, and strain sensors are adjusted to their biologically relevant stimulus patterns. The application of such "tricks" to technical solutions of measuring problems similar to those animals have to cope with, seems both realistic and very promising.

  1. Preliminary study on domestication of coconut crab (Birgus latro

    Directory of Open Access Journals (Sweden)

    . Sulistiono

    2007-07-01

    Full Text Available Preliminary study on domestication of coconut crab (Birgus latro had been done since June - November 2004 and December - 2005 February 2006.  Study was carried out in two locations namely Laboratory of Sekolah Tinggi Kelautan dan Perikanan, Palu to study adult crab, and Laboratory of Ecobiology of Faculty of Fisheries and Marine Science, Bogor Agricultural University to study crab in clomang stage.  Adult crabs were collected by using some fishing gears namely trap, net and directly using bamboo stick.  Domestication was done in rearing batch sized 1x1x1 m3 with artificial nests (30x15x15 cm3, and small batch for water (7x10x10 cm3.  While for clomang stage, crabs were reared in aquarium (80x40x40 cm3 with debris and small water batch.  Result showed that adult crab had a survival rate around 12.5-0%, and mortality around 50-87.5%.  A similar result was also in clomang stage, which was 12.5% for survival rate and 87.5% for mortality.  Adult coconut crab was preferred to feed coconut than other food likely vegetable and chick. Keywords: domestication, coconut crab, Birgus latro, food habit   ABSTRAK Penelitian awal mengenai kajian awal penangkaran kepiting kelapa (Birgus latro dilakukan pada bulan Juni - November 2004 dan Desember 2005 Februari 2006.  Pelaksanaan penelitian di lakukan di dua tempat, yaitu Laboratorium Sekolah Tinggi Kelautan dan Perikanan, Palu untuk percobaan kepiting dewasa, dan Laboratorium Ekobiologi Fakultas Perikanan dan Ilmu Kelautan IPB Bogor,  untuk percobaan kepiting tahap klomang.  Kepiting dewasa ditangkap dengan menggunakan beberapa peralatan a.l. perangkap, jaring dan secara langsung dengan tongkat.  Penangkaran dilakukan di bak-bak peliharaan berukuran 1x1x1 m3 yang dilengkapi dengan tempat persembunyian (30x15x15 cm3, dan bak kecil tempat air (7x10x10 cm3.  Sedangkan kepiting tahap klomang dipelihara di akuarium (80x40x40 cm3 yang diberi daun/serasah dan tempat air.  Hasil uji coba penangkaran

  2. Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

    DEFF Research Database (Denmark)

    Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

    2013-01-01

    Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

  3. Boxer crabs induce asexual reproduction of their associated sea anemones by splitting and intraspecific theft.

    Science.gov (United States)

    Schnytzer, Yisrael; Giman, Yaniv; Karplus, Ilan; Achituv, Yair

    2017-01-01

    Crabs of the genus Lybia have the remarkable habit of holding a sea anemone in each of their claws. This partnership appears to be obligate, at least on the part of the crab. The present study focuses on Lybia leptochelis from the Red Sea holding anemones of the genus Alicia (family Aliciidae). These anemones have not been found free living, only in association with L. leptochelis . In an attempt to understand how the crabs acquire them, we conducted a series of behavioral experiments and molecular analyses. Laboratory observations showed that the removal of one anemone from a crab induces a "splitting" behavior, whereby the crab tears the remaining anemone into two similar parts, resulting in a complete anemone in each claw after regeneration. Furthermore, when two crabs, one holding anemones and one lacking them, are confronted, the crabs fight, almost always leading to the "theft" of a complete anemone or anemone fragment by the crab without them. Following this, crabs "split" their lone anemone into two. Individuals of Alicia sp. removed from freshly collected L. leptochelis were used for DNA analysis. By employing AFLP (Fluorescence Amplified Fragments Length Polymorphism) it was shown that each pair of anemones from a given crab is genetically identical. Furthermore, there is genetic identity between most pairs of anemone held by different crabs, with the others showing slight genetic differences. This is a unique case in which one animal induces asexual reproduction of another, consequently also affecting its genetic diversity.

  4. Boxer crabs induce asexual reproduction of their associated sea anemones by splitting and intraspecific theft

    Directory of Open Access Journals (Sweden)

    Yisrael Schnytzer

    2017-01-01

    Full Text Available Crabs of the genus Lybia have the remarkable habit of holding a sea anemone in each of their claws. This partnership appears to be obligate, at least on the part of the crab. The present study focuses on Lybia leptochelis from the Red Sea holding anemones of the genus Alicia (family Aliciidae. These anemones have not been found free living, only in association with L. leptochelis. In an attempt to understand how the crabs acquire them, we conducted a series of behavioral experiments and molecular analyses. Laboratory observations showed that the removal of one anemone from a crab induces a “splitting” behavior, whereby the crab tears the remaining anemone into two similar parts, resulting in a complete anemone in each claw after regeneration. Furthermore, when two crabs, one holding anemones and one lacking them, are confronted, the crabs fight, almost always leading to the “theft” of a complete anemone or anemone fragment by the crab without them. Following this, crabs “split” their lone anemone into two. Individuals of Alicia sp. removed from freshly collected L. leptochelis were used for DNA analysis. By employing AFLP (Fluorescence Amplified Fragments Length Polymorphism it was shown that each pair of anemones from a given crab is genetically identical. Furthermore, there is genetic identity between most pairs of anemone held by different crabs, with the others showing slight genetic differences. This is a unique case in which one animal induces asexual reproduction of another, consequently also affecting its genetic diversity.

  5. The use of artificial crabs for testing predatory behavior and health in the octopus.

    Science.gov (United States)

    Amodio, Piero; Andrews, Paul; Salemme, Marinella; Ponte, Giovanna; Fiorito, Graziano

    2014-01-01

    The willingness of the cephalopod mollusc Octopus vulgaris to attack a live crab is traditionally used as a method to assess the overall health and welfare of octopuses in the laboratory. This method requires placing a crab in the home tank of an animal, measuring the time (latency) taken for the octopus to initiate an attack and withdrawing the crab immediately prior to capture. The same crab is commonly used to assess multiple octopuses as part of daily welfare assessment. Growing concern for the welfare of crustaceans and a review of all laboratory practices for the care and welfare of cephalopods following the inclusion of this taxon in 2010/63/EU prompted a study of the utility of an artificial crab to replace a live crab in the assessment of octopus health. On consecutive days O. vulgaris (N=21) were presented with a live, a dead or an artificial crab, and the latency to attack measured. Despite differences in the predatory performance towards the three different crab alternatives, octopuses readily attacked the artificial (and the dead) crab, showing that they can generalize and respond appropriately towards artificial prey. Researchers should consider using an artificial crab to replace the use of a live crab as part of the routine health assessment of O. vulgaris.

  6. Quantification of the indirect effects of scallop dredge fisheries on a brown crab fishery.

    Science.gov (United States)

    Öndes, Fikret; Kaiser, Michel J; Murray, Lee G

    2016-08-01

    This study aimed to describe the characteristics of the by-catch of Cancer pagurus in king scallop dredges in the Isle of Man, and to determine the damage, immediate mortality and estimated mortality during fishing seasons associated with scallop dredges. Based on dredge surveys, spatial and seasonal variations were observed, with the highest number of crabs found off the west coast of the Isle of Man in the autumn when berried females crabs were most frequently caught. In general, female crabs comprised 84% of the catch. The damage levels of crabs was high with 45% of crabs recorded as crushed or dead or with severe damage, whilst 24% of crabs exhibited missing limbs. Estimates of the potential mortality associated with scallop dredging led to a lower and upper estimate of possible crab by-catch mortality of 15t and 24t respectively which represented 3.0-4.8% of the commercial landings of brown crab for the Isle of Man. Heaviest mortalities of crabs occurred in autumn to the west of the Isle of Man when female berried crabs move offshore into deeper water. The use of a temporary and spatially restricted scallop dredging closure could provide a simple solution to mitigate additional crab mortality in the event that scallop dredging increased beyond current levels in the future. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. The Crab Pulsar and Relativistic Wind

    Science.gov (United States)

    Coroniti, F. V.

    2017-12-01

    The possibility that the Crab pulsar produces a separated ion-dominated and pair-plasma-dominated, magnetically striped relativistic wind is assessed by rough estimates of the polar cap acceleration of the ion and electron primary beams, the pair production of secondary electrons and positrons, and a simple model of the near-magnetosphere-wind zone. For simplicity, only the orthogonal rotator is considered. Below (above) the rotational equator, ions (electrons) are accelerated in a thin sheath, of order (much less than) the width of the polar cap, to Lorentz factor {γ }i≈ (5{--}10)× {10}7({γ }e≈ {10}7). The accelerating parallel electric field is shorted out by ion-photon (curvature synchrotron) pair production. With strong, but fairly reasonable, assumptions, a set of general magnetic geometry relativistic wind equations is derived and shown to reduce to conservation relations that are similar to those of the wind from a magnetic monopole. The strength of the field-aligned currents carried by the primary beams is determined by the wind’s Alfvén critical point condition to be about eight times the Goldreich-Julian value. A simple model for the transition from the dipole region wind to the asymptotic monopole wind zone is developed. The asymptotic ratio of Poynting flux to ion (pair plasma) kinetic energy flux—the wind {σ }w∞ -parameter—is found to be of order {σ }w∞ ≈ 1/2({10}4). The far wind zone is likely to be complex, with the ion-dominated and pair-plasma-dominated magnetic stripes merging, and the oppositely directed azimuthal magnetic fields annihilating.

  8. Mechanism of diffusive transport in molecular spider models

    Science.gov (United States)

    Semenov, Oleg; Olah, Mark J.; Stefanovic, Darko

    2011-02-01

    Recent advances in single-molecule chemistry have led to designs for artificial multipedal walkers that follow tracks of chemicals. We investigate the motion of a class of walkers, called molecular spiders, which consist of a rigid chemically inert body and several flexible enzymatic legs. The legs can reversibly bind to chemical substrates on a surface and through their enzymatic action convert them to products. The legs can also reversibly bind to products, but at a different rate. Antal and Krapivsky have proposed a model for molecular spider motion over regular one-dimensional lattices [T. Antal and P. L. Krapivsky, Phys. Rev. ENATUAS1539-375510.1103/PhysRevE.76.021121 76, 021121 (2007).]. In the model the legs hop from site to site under constraints imposed by connection to a common body. The first time a leg visits a site, the site is an uncleaved substrate, and the leg hops from this site only once it has cleaved it into a product. This cleavage happens at a rate rr=1. The effect of cleavage is to slow down the hopping rate for legs that visit a site for the first time. Along with the constraints imposed on the legs, this leads to an effective bias in the direction of unvisited sites that decreases the average time needed to visit n sites. The overall motion, however, remains diffusive in the long time limit. We have reformulated the Antal-Krapivsky model as a continuous-time Markov process and simulated many traces of this process using kinetic Monte Carlo techniques. Our simulations show a previously unpredicted transient behavior wherein spiders with small r values move superdiffusively over significant distances and times. We explain this transient period of superdiffusive behavior by describing the spider process as switching between two metastates: a diffusive state D wherein the spider moves in an unbiased manner over previously visited sites, and a boundary state B wherein the spider is on the boundary between regions of visited and unvisited sites

  9. 9 CFR 149.4 - Spot audit.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Spot audit. 149.4 Section 149.4... LIVESTOCK IMPROVEMENT VOLUNTARY TRICHINAE CERTIFICATION PROGRAM § 149.4 Spot audit. (a) In addition to regularly scheduled site audits, certified production sites will be subject to spot audits. (1) Random spot...

  10. Insecticidal toxins from black widow spider venom.

    Science.gov (United States)

    Rohou, A; Nield, J; Ushkaryov, Y A

    2007-03-15

    The biological effects of Latrodectus spider venom are similar in animals from different phyla, but these symptoms are caused by distinct phylum-specific neurotoxins (collectively called latrotoxins) with molecular masses ranging from 110 to 140 kDa. To date, the venom has been found to contain five insecticidal toxins, termed alpha, beta, gamma, delta and epsilon-latroinsectotoxins (LITs). There is also a vertebrate-specific neurotoxin, alpha-latrotoxin (alpha-LTX), and one toxin affecting crustaceans, alpha-latrocrustatoxin (alpha-LCT). These toxins stimulate massive release of neurotransmitters from nerve terminals and act (1) by binding to specific receptors, some of which mediate an exocytotic signal, and (2) by inserting themselves into the membrane and forming ion-permeable pores. Specific receptors for LITs have yet to be identified, but all three classes of vertebrate receptors known to bind alpha-LTX are also present in insects. All LTXs whose structures have been elucidated (alpha-LIT, delta-LIT, alpha-LTX and alpha-LCT) are highly homologous and have a similar domain architecture, which consists of a unique N-terminal sequence and a large domain composed of 13-22 ankyrin repeats. Three-dimensional (3D) structure analysis, so far done for alpha-LTX only, has revealed its dimeric nature and an ability to form symmetrical tetramers, a feature probably common to all LTXs. Only tetramers have been observed to insert into membranes and form pores. A preliminary 3D reconstruction of a delta-LIT monomer demonstrates the spatial similarity of this toxin to the monomer of alpha-LTX.

  11. On the origin of delta spots

    International Nuclear Information System (INIS)

    Tang, F.

    1983-01-01

    Mount Wilson sunspot drawings from 1966 through 1980 were used in conjunction with Hα filtergrams from Big Bear Solar Observatory to examine the origin of delta spots, spots with bipolar umbrae within one penumbra. Of the six cases we studied, five were formed by the union of non-paired spots. They are either shoved into one another by two neighboring growing bipoles or by a new spot born piggy-back style on an existing spot of opposite polarity. Proper motions of the growing spots take on curvilinear paths around one another to avoid a collision. This is the shear motion observed in delta spots (Tanaka, 1979). In the remaining case, the delta spot was formed by spots that emerged as a pair. Our findings indicate no intrinsic differences in the formation or the behavior between delta spots of normal magnetic configuration. (orig.)

  12. Distribution patterns of the ghost crab Ocypode cursor on sandy ...

    African Journals Online (AJOL)

    The spatial distribution of the ghost crab Ocypode cursor was determined for beaches on eastern Boa Vista Island, Cabo Verde Archipelago. The main objectives were to analyse the across-shore distribution by means of burrow counts and to identify preferential zones and spatial segregation. Six beaches were investigated ...

  13. Haematological and Serum Biochemical Profile of the Blue Crab ...

    African Journals Online (AJOL)

    Haematology and serum biochemistry of the crab, Callinectes amnicola from Epe and Lagos Lagoon in southwest Nigeria were investigated from March –August, 2013. Haemocyte samples were analyzed for haematological and biochemical parameters. The Total Haemocyte count (THC) of C. amnicola from Epe and ...

  14. Macro and Trace Element Accumulation in Edible Crabs and Frogs ...

    African Journals Online (AJOL)

    The tissue accumulation of five macroelements (Na, Mg, K, Ca, Fe) and twelve trace elements (Vd, Mn, Co, Ni, Cu, Zn, As, Se, Mo, Ag, Cd, Pb) were assessed in the organs of the edible frogs; Xenopus laevis and Rana esculentus, and whole body of the crab, Callinestes caught from Alaro Stream Floodplain (Ibadan, ...

  15. The temporal behaviour of Taurus X-1 (the Crab Nebula)

    International Nuclear Information System (INIS)

    Davison, P.J.N.

    1975-01-01

    Copernicus data on Taurus X-1 and the Crab pulsar extending over a 2 1/2-yr period indicate that under normal conditions the source has a flux that is constant to within 2.5 per cent at the 90 per cent confidence level. The pulsed/total flux ratio also shows no significant changes during the same time. (author)

  16. Multibaseline Observations of the Occultation of Crab Nebula by the ...

    Indian Academy of Sciences (India)

    tribpo

    Observations of the radio source Crab Nebula were made at the time of transit during. June 1986 and 1987. The fringe amplitude V(S) for a baseline S was calibrated using the corresponding baseline fringe amplitude of radio source 3C123 or 3C134 and normalised to the preoccultation value V(O). Normalised fringe ...

  17. Size at Sexual Maturity in the Red Mangrove Crab Neosarmatium ...

    African Journals Online (AJOL)

    The sesarmid crab Neosarmatium meinertiis one of the most abundant species inhabiting the upper mangrove areas of many East African mangrove forests. However, several aspects concerning its reproduction are scarcely known. In this study, sexual maturity of N. meinerti is investigated. Samples were obtained during ...

  18. The larval development of the red mangrove crab Sesarma meinerti ...

    African Journals Online (AJOL)

    The larval stages of the red mangrove crab Sesarma meinerti de Man were reared in the laboratory. Larval development consists of five zoeal stages and one megalopa. Zoeal development lasts an average of 25 days at 25°C. The external morphology of larvae is described in detail and their relationship with larvae of ...

  19. The Crab nebula's ''wisps'' as shocked pulsar wind

    International Nuclear Information System (INIS)

    Gallant, Y.A.; Arons, J.; Langdon, A.B.

    1992-01-01

    The Crab synchrotron nebula has been successfully modelled as the post-shock region of a relativistic, magnetized wind carrying most of the spindown luminosity from the central pulsar. While the Crab is the best-studied example, most of the highest spindown luminosity pulsars are also surrounded by extended synchrotron nebulae, and several additional supernova remnants with ''plerionic'' morphologies similar to the Crab are known where the central object is not seen. All these objects have nonthermal, power-law spectra attributable to accelerated high-energy particles thought to originate in a Crab-like relativistic pulsar wind. However, proposed models have so far treated the wind shock as an infinitesimally thin discontinuity, with an arbitrarily ascribed particle acceleration efficiency. To make further progress, investigations resolving the shock structure seemed in order. Motivated by these considerations, we have performed ''particle-in-cell (PIC) simulations of perpendicularly magnetized shocks in electron-positron and electron-positron-ion plasmas. The shocks in pure electron-positron plasmas were found to produce only thermal distributions downstream, and are thus poor candidates as particle acceleration sites. When the upstream plasma flow also contained a smaller population of positive ions, however, efficient acceleration of positrons, and to a lesser extent of electrons, was observed in the simulations

  20. Breeding biology of the intertidal sand crab, Emerita (Decapoda: Anomura).

    Science.gov (United States)

    Subramoniam, T; Gunamalai, V

    2003-01-01

    Emerita is a burrowing mole crab or sand crab, adapted to life in wave-washed sandy beaches of temperate and tropical seas. The reproductive biology of this anomuran crab presents several peculiarities, all contributing to its adaptation to this harsh environmental niche. We discuss the following aspects: 1) sex ratio and size at sexual maturity, 2) neoteny and protandric hermaphroditism, 3) mating behaviour and sperm transfer strategy, 4) synchronisation of moulting and reproduction, 5) environmental impact on reproductive cycle and egg production, 6) biochemistry of yolk utilisation and energetics, 7) larval development, dispersal and settlement and 8) the value of Emerita as indicator species. These aspects are discussed in the light of the life history pattern, comprising a sedentary adult and pelagic larval phases. The successful colonisation of the physically challenging habitat of the sandy beach by Emerita is attributable largely to reproductive strategy and the larval developmental and recruitment pattern. Sensitivity to changing environmental conditions, including pollution, make this intertidal crab an indicator species for monitoring anthropogenic impact.

  1. Substrate use and selection in sympatric intertidal hermit crab species

    Directory of Open Access Journals (Sweden)

    TURRA A.

    2002-01-01

    Full Text Available Coexisting hermit crabs may competitively interact for shells and microhabitats, mainly when shell availability is habitat-related. Three species of Clibanarius (C. antillensis, C. sclopetarius, and C. vittatus coexist in the intertidal region of Pernambuco Islet, Araçá Region, São Sebastião Channel, southeastern Brazil. This study evaluated crab preferences for four substrate types used by these species in nature (rocky shore, pebbles, sand, and mud in allopatric (single species and sympatric (three species treatments in simulations of high tide and low tide. The substrate preference of the three hermit crabs did not vary between low and high tide situations. At low tide the crabs either moved into holes in the highly complex rocky substrate or buried themselves in mud. Substrate selection may explain the patterns of substrate use in nature only for C. vittatus. Clibanarius antillensis and C. sclopetarius showed closer similarities in the pattern of substrate selection in the sympatric treatment with the substrate use in nature than in allopatric treatment, indicating a positive influence (dependence of the presence of one species on the presence of another. Use of sub-optimal substrates, mainly by C. antillensis, may be caused by other factors such as its low desiccation tolerances. If competition for space takes place among these species, it would be more intense between C. sclopetarius and C. vittatus given their higher overlap in substrate preference than between them and C. antillensis.

  2. Substrate use and selection in sympatric intertidal hermit crab species

    Directory of Open Access Journals (Sweden)

    A. TURRA

    Full Text Available Coexisting hermit crabs may competitively interact for shells and microhabitats, mainly when shell availability is habitat-related. Three species of Clibanarius (C. antillensis, C. sclopetarius, and C. vittatus coexist in the intertidal region of Pernambuco Islet, Araçá Region, São Sebastião Channel, southeastern Brazil. This study evaluated crab preferences for four substrate types used by these species in nature (rocky shore, pebbles, sand, and mud in allopatric (single species and sympatric (three species treatments in simulations of high tide and low tide. The substrate preference of the three hermit crabs did not vary between low and high tide situations. At low tide the crabs either moved into holes in the highly complex rocky substrate or buried themselves in mud. Substrate selection may explain the patterns of substrate use in nature only for C. vittatus. Clibanarius antillensis and C. sclopetarius showed closer similarities in the pattern of substrate selection in the sympatric treatment with the substrate use in nature than in allopatric treatment, indicating a positive influence (dependence of the presence of one species on the presence of another. Use of sub-optimal substrates, mainly by C. antillensis, may be caused by other factors such as its low desiccation tolerances. If competition for space takes place among these species, it would be more intense between C. sclopetarius and C. vittatus given their higher overlap in substrate preference than between them and C. antillensis.

  3. Hermit Crabs (Decapoda: Anomura: Paguridea) from the Seychelles

    NARCIS (Netherlands)

    McLaughlin, P.A.; Hogarth, P.J.

    1998-01-01

    A report on the hermit crabs collected during the Netherlands Seychelles Expedition, 1992-1993, supplemented by materials collected for Enterprise Oil and examined by one of the authors. Twentyseven species, representing three families, are recognized, including one new genus and four new species.

  4. Hard X-ray Variations in the Crab Nebula

    Science.gov (United States)

    Wilson-Hodge, Colleen A.; Cherry, M. L.; Case, G. L.; Baumgartner, W. H.; Beklen, E.; Bhat, P. N.; Briggs, M. S.; Camero-Arranz, A.; Connaughton, V.; Finger, M. H.; hide

    2013-01-01

    In the first two years of science operations of the Fermi Gamma-ray Burst Monitor (GBM), August 2008 to August 2010, approximately 7% (70 mcrab) decline was discovered in the overall Crab Nebula flux in the 15 - 50 keV band, measured with the Earth occultation technique. This decline was independently confirmed with four other instruments: the RXTE/PCA, Swift/BAT, INTEGRAL/IBIS, and INTEGRAL/SPI. The pulsed flux measured with RXTE/PCA from 1999-2010 was consistent with the pulsar spin-down, indicating that the observed changes were nebular. From 2001 to 2010, the Crab nebula flux measured with RXTE/ PCA was particularly variable, changing by up to approximately 3.5% per year in the 15-50 keV band. These variations were confirmed with INTEGRAL/SPI starting in 2003, Swift/BAT starting in 2005, and Fermi GBM starting in 2008. Before 2001 and since 2010, the Crab nebula flux has appeared more stable, varying by less than 2% per year. I will present updated light curves in multiple energy bands for the Crab Nebula, including recent data from Fermi GBM, Swift/BAT, INTEGRAL and MAXI, and a 16-year long light curve from RXTE/PCA.

  5. Crab Nebula Variations in Hard X-rays

    Science.gov (United States)

    Wilson-Hodge, Colleen A.

    2012-01-01

    The Crab Nebula was surprisingly variable from 2001-2010, with less variability before 2001 and since mid-2010. We presented evidence for spectral softening from RXTE, Swift/BAT, and Fermi GBM during the mid-2008-2010 flux decline. We see no clear connections between the hard X-ray variations and the GeV flares

  6. Mud Crab (Scylla serrata) Culture: Understanding the Technology in ...

    African Journals Online (AJOL)

    Abstract—A study was conducted in Mtwapa creek on the north coast Kenya, during 2005-2007 to evaluate the viability of pens and drive-in cages for mud crab (S. serrata) culture as a mangrove management strategy and alternative source of income for local communities. Other objectives were to assess the effectiveness ...

  7. Project "Flappy Crab": An Edu-Game for Music Learning

    Science.gov (United States)

    Cardoso Gomes, Cristina Maria; Guerreiro Figueiredo, Mauro Jorge; Bidarra, José; Cardoso Gomes, José Duarte

    2014-01-01

    This paper discusses some possibilities of gamification and remixing process for music education. Analyses also the concepts of gamification, mashup, remix and presents its possible usage in education--music teaching--through the development of the project/educational game "Flappy Crab". The article begins with a brief introduction to…

  8. The abundance and composition of crabs (Decapoda) in Uta Ewa ...

    African Journals Online (AJOL)

    The results of the physicochemical parameters were within limits of the National Environmental Standards and Regulations Enforcement Agencies for aquatic life. A total of 107 crabs were collected from the two sampling stations. Goniopsis pelii was the most abundant in Station 1 accounting for 57.9%, followed by ...

  9. Genetic population structure of the Japanese mitten crab Eriocheir ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-20

    Mar 20, 2009 ... divergence between these two groups (Okinawa and main islands of Japan) is equivalent to the genetic distance between congeneric species. Our results failed to demonstrate significant geographical structure in main islands of Japan, indicating that populations of Japanese mitten crab are capable of.

  10. Occurrence and Toxicity of Hydrocarbon Residues in Crab ...

    African Journals Online (AJOL)

    To elucidate seasonal changes in hydrocarbons including polycyclic aromatic hydrocarbons (PAHs) due to oil spill, tissues of blue crab (Callinectes sapidus) were investigated. Total petroleum hydrocarbons (n-alkanes) concentrations ranged from 0.17-0.32ìg/gdw and 0.28-0.62ìg/gdw during the dry and wet seasons ...

  11. Reproduction in crabs: strategies, invasiveness and environmental influences thereon

    NARCIS (Netherlands)

    Brink, van den A.M.

    2013-01-01

    This thesis provides insights into the interconnectedness of crab reproductive biology, the selective forces leading to their development, the possible links to invasiveness and the influences of environmental factors thereon. The empirical data collected and presented in this thesis can be used

  12. The osmoregulatory ability of three grapsoid crab species in relation ...

    African Journals Online (AJOL)

    The osmoregulatory abilities of the grapsoid crabs Cyclograpsus punctata, Sesarma catenata and Sesarma eulimene were studied comparatively in an attempt to explain, at least in part, their distribution in estuaries. Both survival and haemorymph osmotic pressure were used as indices of hyperosmotic regulatory ability.

  13. Food Habits of the Blue Swimming Crab Portunus pelagicus along ...

    African Journals Online (AJOL)

    43: 225–240. Sumpton, W.D. & Smith, G.S. (1990) Effect of temperature on the emergence, activity and feeding of male and female sand crabs (Portunus pelagicus). Aust. J. Mar. Freshwat. Res. 41: 545–. 550. Underwood, A.J. (1981) Techniques of analysis of variance in experimental marine biology and ecology. Oceanogr.

  14. Antimicrobial lipids from the hemolymph of brachyuran crabs

    Digital Repository Service at National Institute of Oceanography (India)

    Ravichandran, S.; Wahidullah, S.; DeSouza, L.; Rameshkumar, G.

    or therapeutic drugs against bacterial infections. A lectin from the Scylla serrata crab hemolymph has been isolated and purified by affinity column chromatography and preparative electrophoresis [7]. Based on studies of the health-promoting activities... bacterial, fungal and multi drug resistant bacterial strains viz, Escherichia coli, Pseudomonas aeruginosa, Staphylococcus aureus, Salmonella typhi, Shigella flexineri, Klebsiella sp., Vibrio cholerae, Aspergillus fumigatus, Rhodotorula sp., Candida...

  15. Spider Silk Processing for Spidroin Recovery from Crossopriza Lyoni Web

    Science.gov (United States)

    Mohtar, J. A.; Ooi, W. L.; Yusuf, F.

    2018-03-01

    Spider silk is a potential biomaterial that can be used in various applications for its outstanding physicomechanical properties attributed by the spidroin composition. Efforts for commercializing spider silks have been mainly focused on the characterization of spidroins from the Entelegyne spiders for exceptional fibre construction. Hence, studies on silk proteins from the Haplogyne species remain neglected. The aim of this study is to isolate spidroin from Crossopriza lyoni web. Silk processing involved the pretreatment of fibres for the shell layer removal from the surface. A screening study was conducted to analyze the effect of temperature, incubation time and agitation speed on spidroin extraction using Ajisawa’s reagent by OFAT analysis followed by statistical optimization of the extraction process via RSM for maximal protein recovery. All parameters exerted significant effect on spidroin recovery (p<0.05) in which the maximum protein concentration (451.78 ± 0.110 µg/ml) was obtained at optimal condition of 70°C, 350 rpm and 1.25 hours. The discovery of spidroin from this study provides a basic platform for engineering spider silk to meet the demand for a variety of silk-based products in the near future.

  16. variability in condensed tannins and bitterness in spider plant ...

    African Journals Online (AJOL)

    ACSS

    Spider plant (Cleome gynandra L.) contributes considerably to the nutrition and medicines of communities in southern Africa. However, its utilisation is limited by its bitterness caused by condensed tannins. Unfortunately, processing options that reduce the bitterness also remove nutritionally and medicinally useful ...

  17. Biotechnological Trends in Spider and Scorpion Antivenom Development

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

    2016-01-01

    Spiders and scorpions are notorious for their fearful dispositions and their ability to inject venom into prey and predators, causing symptoms such as necrosis, paralysis, and excruciating pain. Information on venom composition and the toxins present in these species is growing due to an interest...

  18. Preservice Teachers' Conceptions about Animals and Particularly about Spiders

    Science.gov (United States)

    Jambrina, Carmen Urones; Vacas, Jose Manuel; Sanchez-Barbudo, Miguel

    2010-01-01

    Introduction: This article explores the scientific ideas and alternative conceptions that pre-service teachers have regarding animal classification and spiders in particular. Method: The study involved 40 pre-service teachers of elementary education in Spain and the data was collected by means of questionnaires, descriptions and drawings. The…

  19. Ant-Mimicking Spiders: Strategies for Living with Social Insects

    Directory of Open Access Journals (Sweden)

    Fadia Sara Ceccarelli

    2013-01-01

    Full Text Available Mimicry is a fascinating topic, in particular when viewed in terms of selective forces and evolutionary strategies. Mimicry is a system involving a signaller, a signal receiver, and a model and has evolved independently many times in plants and animals. There are several ways of classifying mimicry based on the interactions and cost-benefit scenarios of the parties involved. In this review, I briefly outline the dynamics of the most common types of mimicry to then apply it to some of the spider-ant associative systems known to date. In addition, this review expands on the strategies that ant-associating (in particular ant-mimicking spiders have developed to minimise the costs of living close to colonies of potentially dangerous models. The main strategy that has been noted to date is either chemical mimicry or actively avoiding contact with ants. If these strategies warrant protection for the spider (living close to potentially dangerous models, then the benefits of ant associations would outweigh the costs, and the association will prevail.

  20. Determination of PCDDs in spider webs: preliminary studies

    Directory of Open Access Journals (Sweden)

    Rybak Justyna

    2018-01-01

    Full Text Available The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

  1. Trial by fire: Social spider colony demographics in periodically ...

    African Journals Online (AJOL)

    Nests of social spiders of the genus Stegodyphus (Eresidae) are a prominent feature of African savannas and their size and visibility make them potentially good indicators of ecological consequences of fire. The colonies are sedentary and their nests may persist for several years, although individuals have an annual life ...

  2. Central European habitats inhabited by spiders with disjunctive distributions

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil

    2011-01-01

    Roč. 59, č. 2 (2011), s. 367-380 ISSN 1505-2249 Institutional research plan: CEZ:AV0Z50070508 Keywords : spider s * glacial relicts * boreomontane species Subject RIV: EH - Ecology , Behaviour Impact factor: 0.506, year: 2011

  3. Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

    Directory of Open Access Journals (Sweden)

    Vanessa M.J. Lee

    2015-01-01

    Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

  4. Spiders of the Vine Plants in Southern Moravia

    Directory of Open Access Journals (Sweden)

    Lucie Havlová

    2015-01-01

    Full Text Available Araneofauna of vineyards is relatively known in Central Europe but we have a lack of knowledge about araneofauna which occur directly on the vine plants. Our investigation was focused on spiders which live on vine plants, especially on the vine plants trunks. We investigated spiders in six vineyards in southern Moravia (Šatov, Mikulov, Popice, Morkůvky, Nosislav and Blučina. Vineyards were under different soil management, traps were placed on different parts of particular locality (terraced and plain and all localities were under integrated pest management. We employed two types of cardboard traps for spider collecting during whole vegetation season. Altogether, we collected 21 spider species which belong to seven families. The most important species was Marpissa nivoyi (Lucas, 1836, which is mentioned in the Red List as vulnerable (VU and Sibianor tantulus (Simon, 1868 which had unknown distribution in the Czech Republic. The other very interesting result is that the most common species is myrmecomorph Synageles venator (Lucas, 1836, which is scarcely recorded in such huge numbers as we documented in our study.

  5. Spiders (Araneae) as polyphagous natural enemies in orchards

    NARCIS (Netherlands)

    Bogya, S.

    1999-01-01

    Spiders (Araneae) occur in high abundance in all terrestrial ecosystems including agro-ecosystems. They are a very heterogeneous group of animals with different hunting tactics and therefore they play very different ecological roles. At family level these tactics are rather similar thus

  6. Effects of Packaging and Storage Conditions on Quality of Spider ...

    African Journals Online (AJOL)

    The purpose of this research was to increase insight into how the seed quality of spider plant is affected by different packaging containers, seed moisture content and storage temperatures, with a view to finding out the optimal method of packaging and storing of these seeds. This study was carried out using seeds dried ...

  7. Female mating strategy during precopulatory mate guarding in spider mites

    NARCIS (Netherlands)

    Oku, K.

    2009-01-01

    In some taxa, females choose their mates indirectly by using male combat. In the Kanzawa spider mite, Tetranychus kanzawai, adult males guard prereproductive quiescent females. In a dual choice experiment, more males first approached females already guarded by a conspecific male than approached

  8. The Spider's Web: Creativity and Survival in Dynamic Balance.

    Science.gov (United States)

    Cohen, Bill

    2001-01-01

    The spider's web is presented as a model for Indigenous education and community transformation, grounded in Okanagan philosophy. Children are at the center and benefit from the influence of extended family and community. The model's relevance for language revitalization, cultural maintenance, and educational planning and assessment is discussed.…

  9. The sejugal furrow in camel spiders and acariform mites

    Directory of Open Access Journals (Sweden)

    Dunlop, Jason A.

    2012-07-01

    Full Text Available Camel spiders (Arachnida: Solifugae are one of the arachnid groups characterised by a prosomal dorsal shield composed of three distinct elements: the pro-, meso- and metapeltidium. These are associated respectively with prosomal appendages one to four, five, and six. What is less well known, although noted in the historical literature, is that the coxae of the 4th and 5th prosomal segments (i.e. walking legs 2 and 3 of camel spiders are also separated ventrally by a distinct membranous region, which is absent between the coxae of the other legs. We suggest that this essentially ventral division of the prosoma specifically between coxae 2 and 3 is homologous with the so-called sejugal furrow (the sejugal interval sensu van der Hammen. This division constitutes a fundamental part of the body plan in acariform mites (Arachnida: Acariformes. If homologous, this sejugal furrow could represent a further potential synapomorphy for (Solifugae + Acariformes; a relationship with increasing morphological and molecular support. Alternatively, outgroup comparison with sea spiders (Pycnogonida and certain early Palaeozoic fossils could imply that the sejugal furrow defines an older tagma, derived from a more basal grade of organisation. In this scenario the (still divided prosoma of acariform mites and camel spiders would be plesiomorphic. This interpretation challenges the textbook arachnid character of a peltidium (or ‘carapace’ covering an undivided prosoma.

  10. Czech Republic – the type material of spiders (Araneae)

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Kůrka, A.; Buchar, J.; Řezáč, M.

    2005-01-01

    Roč. 174, 1-4 (2005), s. 13-64 ISSN 0139-9543 R&D Projects: GA AV ČR(CZ) IAA6007401 Institutional research plan: CEZ:AV0Z50070508 Keywords : spiders * type material * Czech Republic Subject RIV: EG - Zoology

  11. Shedding light on the optical properties of spider silk fiber

    OpenAIRE

    Chow, Desmond M.; Tow, Kenny Hey; Vollrath, Fritz; Dicaire, Isabelle; Gheysens, Tom; Thevenaz, Luc

    2015-01-01

    Optical characterisation of a Nephila edulis spider dragline silk is performed. The silk fiber transmits light up to 1400 nm with a propagation loss of ∼9 dB/cm and birefringence of 8×10−3 measured at 1302 nm.

  12. 46 SPIDER WEBS AS INDICATORS OF COBALT AND LEAD ...

    African Journals Online (AJOL)

    Spider webs were collected from the indoor and outdoor of 120 sampling sites of 10 zones of Kano. Municipality. The samples were analysed for .... from 120 sampling sites in 10 sampling zones of. Kano municipality. Each sampling zone ... London (Fergusson and Ryan, 1984); New Zealand. (Fergusson et al., 1986); Kano ...

  13. Infrared and Raman Study of the Recluse Spider Silk

    Science.gov (United States)

    Wang, S. L.; Wang, Qijue; Xing, Zhen; Schniepp, H. C.; Qazilbash, M. M.

    Spider silk exhibits remarkable mechanical properties, such as high tensile strength and toughness. We want to gain insight into the composition and structure of spider silk to discover the origin of these properties. We are especially interested in the organization of the crystalline beta sheets that are expected to contribute to the high strength of the silk from the recluse spider, Loxosceles laeta. The recluse spider produces a silk that has a unique geometry amongst arachnids. We measure the silk's optical properties, particularly the infrared-active and Raman-active vibrations. Broadband infrared transmission spectra were collected in the spectral range between 600 cm-1 and 4000 cm-1, with light polarized parallel and perpendicular to the long axis of the silk. Raman micro-spectroscopy was performed in the spectral range 500 cm-1 and 4000 cm- 1 with a 514 nm laser. The infrared and Raman vibrational modes are fit with Lorentzian and pseudo-Voigt functions. The vibrational modes are assigned to specific structures and electronic bonds in the silk. This work was supported by NASA/ Virginia Space Grant Consortium.

  14. Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Khan Perveen

    2015-12-01

    Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

  15. Evaluating Stem Cell Response to a Spider Silk Scaffold

    Science.gov (United States)

    Hafner, Katherine Lee

    Micropatterning on a surface using fibers, channels, and troughs, can act as an effective means of inducing cell attachment and alignment. These morphological and pattern changes as a response to physical cues can impact the potential that a cell has to differentiate into a different cell line. This thesis evaluated the response of human dental pulp stem cells (DPSCs), and other cell types, to spider dragline silk fibers, a potential scaffold material for tissue regeneration, and further observed the effects of morphology, orientation, and composition of silk on the adherence of cells. Several cell lines were studied in this thesis, including adipose derived stem cells (ADSCs), osteoblasts (7F2s), and fibroblasts (3T3s), but DPSCs were the main cell type of interest. This is due to the fact that DPSCs are a proposed source of stem cells for nerve regeneration based on their close embryonic origin to neurons and the ease with which DPSCs can be obtained from a donor. The cells' morphologies and spread patterns were characterized after they were plated onto Nephila clavipes dragline fibers in media. The inclusion of 3T3s and 7F2s in this study allowed for both direct comparisons to prior published work and a qualitative comparison to the morphology of the DPSCs. After twelve days, the DPSCs exhibited greater relative alignment and adherence to the spider dragline fibers than the 3T3s and 7F2s when silk was wrapped in an aligned orientation rather than a random orientation. The impact of a common sterilization method (ultraviolet light) on the spider dragline fiber surface and subsequent cell response to this modified surface was also characterized. Exposure of the silk to ultraviolet light did not have a measureable effect on cell alignment, but it did eliminate bacterial growth and changed fiber surface roughness. Spiders' exposure to stressful environments did not have an effect on silk to impair cell alignment or adhesion, and synthetic recombinant protein silk

  16. Laser based spot weld characterization

    Science.gov (United States)

    Jonietz, Florian; Myrach, Philipp; Rethmeier, Michael; Suwala, Hubert; Ziegler, Mathias

    2016-02-01

    Spot welding is one of the most important joining technologies, especially in the automotive industry. Hitherto, the quality of spot welded joints is tested mainly by random destructive tests. A nondestructive testing technique offers the benefit of cost reduction of the testing procedure and optimization of the fabrication process, because every joint could be examined. This would lead to a reduced number of spot welded joints, as redundancies could be avoided. In the procedure described here, the spot welded joint between two zinc-coated steel sheets (HX340LAD+Z100MB or HC340LA+ZE 50/50) is heated optically on one side. Laser radiation and flash light are used as heat sources. The melted zone, the so called "weld nugget" provides the mechanical stability of the connection, but also constitutes a thermal bridge between the sheets. Due to the better thermal contact, the spot welded joint reveals a thermal behavior different from the surrounding material, where the heat transfer between the two sheets is much lower. The difference in the transient thermal behavior is measured with time resolved thermography. Hence, the size of the thermal contact between the two sheets is determined, which is directly correlated to the size of the weld nugget, indicating the quality of the spot weld. The method performs well in transmission with laser radiation and flash light. With laser radiation, it works even in reflection geometry, thus offering the possibility of testing with just one-sided accessibility. By using heating with collimated laser radiation, not only contact-free, but also remote testing is feasible. A further convenience compared to similar thermographic approaches is the applicability on bare steel sheets without any optical coating for emissivity correction. For this purpose, a proper way of emissivity correction was established.

  17. Global patterns of guild composition and functional diversity of spiders.

    Directory of Open Access Journals (Sweden)

    Pedro Cardoso

    Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

  18. SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

    Directory of Open Access Journals (Sweden)

    Alexander V. Ponomarev

    2015-01-01

    Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

  19. Global Patterns of Guild Composition and Functional Diversity of Spiders

    Science.gov (United States)

    Cardoso, Pedro; Pekár, Stano; Jocqué, Rudy; Coddington, Jonathan A.

    2011-01-01

    The objectives of this work are: (1) to define spider guilds for all extant families worldwide; (2) test if guilds defined at family level are good surrogates of species guilds; (3) compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4) compare the taxonomic and functional diversity of spider assemblages and; (5) relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1) sensing, (2) sheet, (3) space, and (4) orb web weavers; (5) specialists; (6) ambush, (7) ground, and (8) other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also influenced by

  20. Synthetic Spider Silk Production on a Laboratory Scale

    Science.gov (United States)

    Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

    2012-01-01

    As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

  1. Brown Spider (Loxosceles genus Venom Toxins: Tools for Biological Purposes

    Directory of Open Access Journals (Sweden)

    Andrea Senff-Ribeiro

    2011-03-01

    Full Text Available Venomous animals use their venoms as tools for defense or predation. These venoms are complex mixtures, mainly enriched of proteic toxins or peptides with several, and different, biological activities. In general, spider venom is rich in biologically active molecules that are useful in experimental protocols for pharmacology, biochemistry, cell biology and immunology, as well as putative tools for biotechnology and industries. Spider venoms have recently garnered much attention from several research groups worldwide. Brown spider (Loxosceles genus venom is enriched in low molecular mass proteins (5–40 kDa. Although their venom is produced in minute volumes (a few microliters, and contain only tens of micrograms of protein, the use of techniques based on molecular biology and proteomic analysis has afforded rational projects in the area and permitted the discovery and identification of a great number of novel toxins. The brown spider phospholipase-D family is undoubtedly the most investigated and characterized, although other important toxins, such as low molecular mass insecticidal peptides, metalloproteases and hyaluronidases have also been identified and featured in literature. The molecular pathways of the action of these toxins have been reported and brought new insights in the field of biotechnology. Herein, we shall see how recent reports describing discoveries in the area of brown spider venom have expanded biotechnological uses of molecules identified in these venoms, with special emphasis on the construction of a cDNA library for venom glands, transcriptome analysis, proteomic projects, recombinant expression of different proteic toxins, and finally structural descriptions based on crystallography of toxins.

  2. Estimated Entrainment of Dungeness Crab During Dredging For The Columbia River Channel Improvement Project

    Energy Technology Data Exchange (ETDEWEB)

    Pearson, Walter H.; Williams, Greg D.; Skalski, John R.

    2002-12-01

    The studies reported here focus on issues regarding the entrainment of Dungeness crab related to the proposed Columbia River Channel Improvement Project and provided direct measurements of crab entrainment rates at three locations (Desdomona Shoals, Upper Sands, and Miller Sands) from RM4 to RM24 during summer 2002. Entrainment rates for all age classes of crabs ranged from zero at Miller Sands to 0.224 crabs per cy at Desdemona Shoals in June 2002. The overall entrainment rate at Desdomona Shoals in September was 0.120 crabs per cy. A modified Dredge Impact Model (DIM) used the summer 2002 entrainment rates to project crab entrainment and adult equivalent loss and loss to the fishery for the Channel Improvement Project. To improve the projections, entrainment data from Flavel Bar is needed. The literature, analyses of salinity intrusion scenarios, and the summer 2002 site-specific data on entrainment and salinity all indicate that bottom salinity influences crab distribution and entrainment, especially at lower salinities. It is now clear from field measurements of entrainment rates and salinity during a period of low river flow (90-150 Kcfs) and high salinity intrusion that entrainment rates are zero where bottom salinity is less than 16 o/oo most of the time. Further, entrainment rates of 2+ and older crab fall with decreasing salinity in a clear and consistent manner. More elaboration of the crab distribution- salinity model, especially concerning salinity and the movements of 1+ crab, is needed.

  3. Distribution and shell selection by two hermit crabs in different habitats on Egyptian Red Sea Coast

    Science.gov (United States)

    El-Kareem Ismail, Tarek Gad

    2010-05-01

    The present work aims to assess the spatial distribution, analyze shell utilization, shell fitness and determine the effect of coexistence of two hermit crabs Calcinus latens and Clibanarius signatus on used shell resources in various habitats on the Red Sea Coast. Also, to determine the choice of shells and investigate the shell species preference of C. latens and C. signatus in the laboratory. The hermit crabs C. latens and C. signatus were found to occupy shells of 39 gastropod species. The most commonly occupied gastropod shells are those belonging to genera Strombus, Nerita, Cerithium and Planaxis. The results showed that crab individuals utilized mainly the shell with elongate aperture. Laboratory experiments showed that two crab species preferred shells of Strombus followed by Cerithium and Nerita when offered shells of nearly similar size (optimal). Crab individuals showed a significant preference for optimal sized shells when given suboptimal shells as an alternative choice. Also, the hermit crabs avoid damaged shells when given a choice of optimal sized damaged shell and optimal sized intact one. In addition, two hermit crab species chose shells of smaller than optimal size when given a choice of damaged optimal sized shells and smaller intact ones. On the other hand, field observations showed that most crab individuals lived in adequate sized shells. The present data conclude that shell selection by hermit crabs C. latens and C. signatus depends mostly on shell internal volume, shell quality and shell aperture size than other factors, because they provide a maximum protection for hermit crabs.

  4. Is this Red Spot the Blue Spot (locus ceruleum)?

    Energy Technology Data Exchange (ETDEWEB)

    Choe, Won Sick; Lee, Yu Kyung; Lee, Min Kyung; Hwang, Kyung Hoon [Gachon University Gil Hospital, Incheon (Korea, Republic of)

    2010-06-15

    The authors report brain images of 18F-FDG-PET in a case of schizophrenia. The images showed strikingly increased bilateral uptake in the locus ceruleum. The locus ceruleum is called the blue spot and known to be a center of the norepinephrinergic system.

  5. Deep insight into white spot syndrome virus vaccines: A review

    Directory of Open Access Journals (Sweden)

    MA Badhul Haq

    2012-02-01

    Full Text Available White spot syndrome virus (WSSV, the causative virus of the disease, is found in most shrimp farming areas of the world, where it causes large economic losses to the shrimp farming industry. The potentially fatal virus has been found to be a threat not only to all shrimp species, but also to other marine and freshwater crustaceans, such as crab and crayfish. To date, no effective prophylactic treatment measures are available for viral infections in shrimp and other crustaceans. Due to current aquaculture practices and the broad host range of WSSV, intervention strategies including vaccination against this virus would be pivotal to save and protect shrimp farming. Several achievements have been attained in the search of novel vaccines for WSSV. DNA vaccination, recombinant vaccines, oral vaccination techniques and gene therapy are some of the thrust areas of focus for scientists and researchers. This review article highlights the recent trends in the development of WSSV vaccines either as DNA vaccines or recombinant vaccines and their functioning strategies as suggested by the researchers worldwide.

  6. Comparative brain architecture of the European shore crab Carcinus maenas (Brachyura) and the common hermit crab Pagurus bernhardus (Anomura) with notes on other marine hermit crabs.

    Science.gov (United States)

    Krieger, Jakob; Sombke, Andy; Seefluth, Florian; Kenning, Matthes; Hansson, Bill S; Harzsch, Steffen

    2012-04-01

    The European shore crab Carcinus maenas and the common hermit crab Pagurus bernhardus are members of the sister taxa Brachyura and Anomura (together forming the taxon Meiura) respectively. Both species share similar coastal marine habitats and thus are confronted with similar environmental conditions. This study sets out to explore variations of general brain architecture of species that live in seemingly similar habitats but belong to different major malacostracan taxa and to understand possible differences of sensory systems and related brain compartments. We examined the brains of Carcinus maenas, Pagurus bernhardus, and three other hermit crab species with immunohistochemistry against tyrosinated tubulin, f-actin, synaptic proteins, RF-amides and allatostatin. Our comparison showed that their optic neuropils within the eyestalks display strong resemblance in gross morphology as well as in detailed organization, suggesting a rather similar potential of processing visual input. Besides the well-developed visual system, the olfactory neuropils are distinct components in the brain of both C. maenas and P. bernhardus as well as the other hermit crabs, suggesting that close integration of olfactory and visual information may be useful in turbid marine environments with low visibility, as is typical for many habitats such as, e.g., the Baltic and the North Sea. Comparing the shape of the olfactory glomeruli in the anomurans showed some variations, ranging from a wedge shape to an elongate morphology. Furthermore, the tritocerebrum and the organization of the second antennae associated with the tritocerebrum seem to differ markedly in C. maenas and P. bernhardus, indicating better mechanosensory abilities in the latter close to those of other Decapoda with long second antennae, such as Astacida, Homarida, or Achelata. This aspect may also represent an adaptation to the "hermit lifestyle" in which competition for shells is a major aspect of their life history. The shore

  7. Effect of daily chlorhexidine bathing on acquisition of carbapenem-resistant Acinetobacter baumannii (CRAB) in the medical intensive care unit with CRAB endemicity.

    Science.gov (United States)

    Chung, Yun Kyung; Kim, Jae-Seok; Lee, Seung Soon; Lee, Jeong-A; Kim, Han-Sung; Shin, Kyong-Sok; Park, Eun Young; Kang, Bog Soun; Lee, Hee Jung; Kang, Hyun Joo

    2015-11-01

    There is insufficient evidence for daily chlorhexidine bathing to reduce nosocomial spread of carbapenem-resistant Acinetobacter baumannii (CRAB) in endemic situations. An interrupted time series study was performed to evaluate the effect of daily chlorhexidine bathing on the acquisition of CRAB in a medical intensive care unit (ICU) with CRAB endemicity. There was a 14-month control period and 12-month chlorhexidine bathing period. Segmented Poisson regression analysis was performed to assess the impact of chlorhexidine bathing on the level and trend of the series of prevalence rates and incidence density. Also, chlorhexidine susceptibility testing was performed on CRAB isolates collected during the chlorhexidine bathing period. There was a 51.8% reduction of CRAB acquisition rates after an introduction of daily chlorhexidine bathing (44.0 vs 21.2 cases/1,000 at-risk patient days, P chlorhexidine against a total of 98 CRAB isolates ranged from 8-64 μg/mL. Daily chlorhexidine bathing significantly reduces the acquisition of CRAB in a medical ICU with CRAB endemicity. Copyright © 2015 Association for Professionals in Infection Control and Epidemiology, Inc. Published by Elsevier Inc. All rights reserved.

  8. CRABS IN CRISIS:BIOGEOGRAPHIC DISTRIBUTIONS, ABUNDANCES, AND VULNERABILITIES TO CLIMATE CHANGE OF BRACHYURAN AND LITHODID CRABS FROM THE GULF OF CALIFORNIA TO THE BEAUFORT SEA

    Science.gov (United States)

    To predict the relative vulnerability of near-coastal species to climate change we analyzed the biogeographic and abundance patterns of the brachyuran or ‘True’ crabs (n=368) and lithodid or ‘King’ crabs (n=20) that are found in the twelve MEOW (“Mar...

  9. Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Jun Wang

    2018-01-01

    Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

  10. Loss of legs: is it or not a handicap for an orb-weaving spider?

    Science.gov (United States)

    Pasquet, Alain; Anotaux, Mylène; Leborgne, Raymond

    2011-07-01

    Leg loss is a common phenomenon in spiders, and according to the species 5% to 40% of the adults can present at least one missing leg. There is no possibility of regeneration after adult moult and the animal must manage with its missing appendages until its death. With the loss of one or more legs, female orb-weaving spiders can be penalized twice: firstly, because the legs are necessary for web construction and secondly, the legs are essential for the control of the prey after its interception by the web. During development, spiders may be also penalized because regeneration has energetic costs that take away resources for survival, growth and reproduction. All these consequences should influence negatively the development of the spider and thus its fitness. We investigated the impact of leg loss in the orb-weaving spider, Zygiella x-notata by studying its frequency in a natural population and web building and prey capture behaviours in laboratory. In field populations, 9.5% to 13%, of the adult females presented the loss of one or more legs; the majority of individuals had lost only one leg (in 48% of cases, a first one). Leg loss seems to affect all the adult spiders, as there is no difference of mass between intact spiders and those with missing leg. Data obtained with laboratory-reared spiders, showed that the loss of legs due to the moult is rare (less than 1%). Considering changes in web design, spiders with missing legs decreased their silk investment, increased the distance between spiral turns but did not change the capture surface of the web. Under our laboratory experimental conditions, spiders with one or two lost legs did not present any difference in prey capture efficiency. In laboratory conditions, spiders with lost leg(s) did not show any difference in egg sac production or in longevity (adult lifespan) compared to intact spiders.

  11. Evaluation of fixative solutions for ultrastructural analysis of brown spider Loxosceles intermedia (araneae: sicariidae) tissues

    OpenAIRE

    Costa-Ayub,C. L. S.; Faraco,C. D.; Freire,C. A.

    2006-01-01

    In view of the widely varying compositions of fixative solutions used for studying spiders, five different fixative formulas were tested for fixing male brown-spider (Loxosceles intermedia) gonad tissues. The brown spider represents a public health problem in Curitiba (Paraná State, Brazil). Morphological study of its gonads may aid in understanding the reproductive strategies of this species, and possibly in developing a reproduction control program. The fixatives tested contained glutaralde...

  12. On the predation of fly, Chrysomya rufifacies (Macquart) by a spider, Oxyopes sp. Latreille (Oxyopidae).

    Science.gov (United States)

    Heo, C C; Mohamad, A M; John, J; Baharudin, O

    2008-04-01

    During a forensic entomological study conducted in a palm oil plantation in Tg.Sepat, Selangor in September 2007, a spider (Arachnida), Oxyopes sp. (Oxyopidae) was found to predate on a calliphorid fly (Chrysomya rufifacies). The female spider laid a silk thread, or "drag line", behind it as it moved. This spider bites its prey by using a pairs of chelicerae, and injecting venom into the fly. The fly was moving its wing trying to escape, however, it succumbed to the deadly bite.

  13. Exploring of the first recorded spider (Arachenida: Aranae) species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    OpenAIRE

    Farzana Perveen; Numan Khan

    2015-01-01

    The spiders (Arthropoada: Arachenida) are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75) of Sheringal, Dir Upper (DU), Khyber Pakhtunkhwa (KP), Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, th...

  14. Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

    Directory of Open Access Journals (Sweden)

    Farzana Perveen

    2015-09-01

    Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

  15. Case report: compartment syndrome after a suspected black widow spider bite.

    Science.gov (United States)

    Cohen, Jennifer; Bush, Sean

    2005-04-01

    Widow spider envenomations generally produce systemic neurologic syndromes without significant local injury. We report a patient who sustained a black widow spider bite to the left forearm and presented to the emergency department with rhabdomyolysis and compartment syndrome. We documented a decrease in symptoms and compartment pressure after administration of antivenom. No surgical intervention was performed. We believe this report to be the first documenting compartment syndrome associated with black widow spider bite.

  16. Ontogenesis, gender, and molting influence the venom yield in the spider Coremiocnemis tropix (Araneae, Theraphosidae)

    OpenAIRE

    Herzig, Volker

    2010-01-01

    The demand for spider venom increases along with the growing popularity of venoms-based research. A deeper understanding of factors that influence the venom yield in spiders would therefore be of interest to both commercial venom suppliers and research facilities. The present study addresses the influence of several factors on the venom yield by systematically analyzing the data obtained from 1773 electrical milkings of the Australian theraphosid spider Coremiocnemis tropix. Gender and ontoge...

  17. Diet-dependent fecundity of the spiders Atypena formosana and Pardosa pseudoannulata, predators in irrigated rice

    DEFF Research Database (Denmark)

    Sigsgaard, Lene; Toft, Søren; Villareal, Sylvia

    2001-01-01

    of Collembola and D. melanogaster had the highest quality for both spiders, the BPH-GLH-Collembola and the full mixed diets were intermediate in quality, the quality of the BPH diet was intermediate to low and quality of the GLH and BPH-GLH diets was low. There need not be a contradiction between low dietary...... value of hoppers and successful natural biological control provided that the nutritional needs of the spiders are met by sufficient alternative prey. The hopper-spider relationship is comparable to that of aphids and spiders in temperate cereals, suggesting that low dietary quality of Homopterans...

  18. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Edwards, G.T.; Schluderberg, D.C.

    1981-01-01

    A technique is provided for engaging and disengaging burnable poison rods from a spider in a nuclear reactor fuel assembly. A cap on the end of each of the burnable poison rods is provided with a shank or stem that is received in a respective bore formed in the spider. A frangible flange secures the shank and rod to the spider. Pressing the shank in the direction of the bore axis by means, e.g., of a plate ruptures the frangible flange to release the rod from the spider. (author)

  19. Functional Group of Spiders in Cultivated Landscape Dominated by Paddy Fields in West Java, Indonesia

    Directory of Open Access Journals (Sweden)

    I WAYAN SUANA

    2009-03-01

    Full Text Available Distribution of spiders in all colonized environments is limited by biotic and abiotic factors requiring adaptations with respect to, for example microhabitat choice and hunting behavior. These two factors were frequently used to group spiders into functional groups. In this study our objectives were to (i group of genera of spiders into functional group based on their microhabitat specificity, hunting behavior, and daily activity; and (ii compare the number and composition of functional group of spider at each habitat type and period of paddy growth. The study was conducted at a landscape dominated by paddy fields in Cianjur Watershed for a period of 9 months. Four different habitat types (paddy, vegetable, non-crop, and mixed garden, were sampled using five trapping techniques (pitfall traps, farmcop suction, sweep netting, yellow-pan traps, and sticky traps. The Unweighted Pair-Group Average and the Euclidean Distances were used to generate dendrogram of functional group of spider. We found 14 functional groups of spider at genus level. The number of functional group of spider at four habitat types was differing, but the composition was similar, because all habitats were closed to each other. Habitat structure diversity and disturbance level influenced the number of functional group of spider. Different architecture of vegetation and availability of differ prey during paddy growth, causing the composition of functional group of spider in each period of paddy growth was changed, although its number was unchanged.

  20. Spider Transcriptomes Identify Ancient Large-Scale Gene Duplication Event Potentially Important in Silk Gland Evolution.

    Science.gov (United States)

    Clarke, Thomas H; Garb, Jessica E; Hayashi, Cheryl Y; Arensburger, Peter; Ayoub, Nadia A

    2015-06-08

    The evolution of specialized tissues with novel functions, such as the silk synthesizing glands in spiders, is likely an influential driver of adaptive success. Large-scale gene duplication events and subsequent paralog divergence are thought to be required for generating evolutionary novelty. Such an event has been proposed for spiders, but not tested. We de novo assembled transcriptomes from three cobweb weaving spider species. Based on phylogenetic analyses of gene families with representatives from each of the three species, we found numerous duplication events indicative of a whole genome or segmental duplication. We estimated the age of the gene duplications relative to several speciation events within spiders and arachnids and found that the duplications likely occurred after the divergence of scorpions (order Scorpionida) and spiders (order Araneae), but before the divergence of the spider suborders Mygalomorphae and Araneomorphae, near the evolutionary origin of spider silk glands. Transcripts that are expressed exclusively or primarily within black widow silk glands are more likely to have a paralog descended from the ancient duplication event and have elevated amino acid replacement rates compared with other transcripts. Thus, an ancient large-scale gene duplication event within the spider lineage was likely an important source of molecular novelty during the evolution of silk gland-specific expression. This duplication event may have provided genetic material for subsequent silk gland diversification in the true spiders (Araneomorphae). © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  1. Latrodectism: case report of a katipo spider (Latrodectus katipo) bite and review of the literature.

    Science.gov (United States)

    Thatcher, Lucinda; Janes, Ron

    2012-03-09

    We describe the case of a 29-year-old man who was bitten on the leg by a katipo spider, a relative of the Australian redback and American black widow spiders, while camping in sand dunes at Mahanga Beach, Mahia (North Island of New Zealand). Symptoms of latrodectism developed within hours, and were not diminished until two doses of the antivenom had been administered. This is only the second case report of a katipo spider bite in the recent literature. The katipo spider bite produces significant symptoms, however an antivenom is available in some hospital pharmacies.

  2. Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

    Science.gov (United States)

    He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

    2014-09-10

    It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

  3. Magnetic Axis Drift and Magnetic Spot Formation in Neutron Stars with Toroidal Fields

    Science.gov (United States)

    Gourgouliatos, Konstantinos N.; Hollerbach, Rainer

    2018-01-01

    We explore magnetic field configurations that lead to the formation of magnetic spots on the surface of neutron stars and the displacement of the magnetic dipole axis. We find that a toroidally dominated magnetic field is essential for the generation of a single spot with a strong magnetic field. Once a spot forms, it survives for several million years, even after the total magnetic field has decayed significantly. We find that the dipole axis is not stationary with respect to the neutron star’s surface and does not in general coincide with the location of the magnetic spot. This is due to non-axisymmetric instabilities of the toroidal field that displace the poloidal dipole axis at rates that may reach 0.°4 per century. A misaligned poloidal dipole axis with the toroidal field leads to more significant displacement of the dipole axis than the fully aligned case. Finally we discuss the evolution of neutron stars with such magnetic fields on the P{--}\\dot{P} diagram and the observational implications. We find that neutron stars spend a very short time before they cross the Death Line of the P{--}\\dot{P} diagram, compared to their characteristic ages. Moreover, the maximum intensity of their surface magnetic field is substantially higher than the dipole component of the field. We argue that SGR 0418+5729 could be an example of this type of behavior, having a weak dipole field, yet hosting a magnetic spot responsible for its magnetar behavior. The evolution on the pulse profile and braking index of the Crab pulsar, which are attributed to an increase of its obliquity, are compatible with the anticipated drift of the magnetic axis.

  4. Dressing percentage in Romanian spotted breed

    Directory of Open Access Journals (Sweden)

    eleonora nistor

    2013-05-01

    Full Text Available The purpose of this research was to determine whether there are significant differences in terms of carcass weight, forequarters, hindquarters and the dressing percentage among Romanian Spotted breed steers and first generation crossbreed obtained between Romanian Spotted and Holstein at slaughter age of 12 and 17 months respectively. Study was done on Romanian Spotted breed steer aged 12 months (36 heads and 17 months (19 heads; Romanian Spotted x Holstein first generation crossbreed of aged 12 months (29 heads and 17 months (20 heads. The Romanian Spotted breed steer, show superiority in terms of carcass weight compared to crossbreed of Romanian Spotted x Holstein, therefore this breed has a better suitability for fattening for meat. Regarding dressing percentage is higher in crossbreed of Romanian Spotted x Holstein compared with Romanian Spotted breed steers, but the difference is insignificant.

  5. Crabs mediate interactions between native and invasive salt marsh plants: a mesocosm study.

    Science.gov (United States)

    Zhang, Xiao-Dong; Jia, Xin; Chen, Yang-Yun; Shao, Jun-Jiong; Wu, Xin-Ru; Shang, Lei; Li, Bo

    2013-01-01

    Soil disturbance has been widely recognized as an important factor influencing the structure and dynamics of plant communities. Although soil reworkers were shown to increase habitat complexity and raise the risk of plant invasion, their role in regulating the interactions between native and invasive species remains unclear. We proposed that crab activities, via improving soil nitrogen availability, may indirectly affect the interactions between invasive Spartina alterniflora and native Phragmites australis and Scirpus mariqueter in salt marsh ecosystems. We conducted a two-year mesocosm experiment consisting of five species combinations, i.e., monocultures of three species and pair-wise mixtures of invasive and native species, with crabs being either present or absent for each combination. We found that crabs could mitigate soil nitrogen depletion in the mesocosm over the two years. Plant performance of all species, at both the ramet-level (height and biomass per ramet) and plot-level (density, total above- and belowground biomass), were promoted by crab activities. These plants responded to crab disturbance primarily by clonal propagation, as plot-level performance was more sensitive to crabs than ramet-level. Moreover, crab activities altered the competition between Spartina and native plants in favor of the former, since Spartina was more promoted than native plants by crab activities. Our results suggested that crab activities may increase the competition ability of Spartina over native Phragmites and Scirpus through alleviating soil nitrogen limitation.

  6. Edible crabs "go west": migrations and incubation cycle of Cancer pagurus revealed by electronic tags.

    Directory of Open Access Journals (Sweden)

    Ewan Hunter

    Full Text Available Crustaceans are key components of marine ecosystems which, like other exploited marine taxa, show seasonable patterns of distribution and activity, with consequences for their availability to capture by targeted fisheries. Despite concerns over the sustainability of crab fisheries worldwide, difficulties in observing crabs' behaviour over their annual cycles, and the timings and durations of reproduction, remain poorly understood. From the release of 128 mature female edible crabs tagged with electronic data storage tags (DSTs, we demonstrate predominantly westward migration in the English Channel. Eastern Channel crabs migrated further than western Channel crabs, while crabs released outside the Channel showed little or no migration. Individual migrations were punctuated by a 7-month hiatus, when crabs remained stationary, coincident with the main period of crab spawning and egg incubation. Incubation commenced earlier in the west, from late October onwards, and brooding locations, determined using tidal geolocation, occurred throughout the species range. With an overall return rate of 34%, our results demonstrate that previous reluctance to tag crabs with relatively high-cost DSTs for fear of loss following moulting is unfounded, and that DSTs can generate precise information with regards life-history metrics that would be unachievable using other conventional means.

  7. Diet selectivity of juvenile blue crabs (Callinectes sapidus) in Chesapeake Bay.

    Science.gov (United States)

    Seitz, Rochelle D; Knick, Kathleen E; Westphal, Miranda

    2011-10-01

    Shallow coves in Chesapeake Bay have abundant food and serve as nursery grounds for juvenile blue crabs. In this study, we examined the relationships between the diet of very small (4-40 mm CW) juvenile blue crabs and the benthic infauna in shallow, unvegetated nursery coves. We compared infauna in benthic samples with gut contents of juvenile blue crabs from six shallow coves in each of two sub-estuaries (Rappahannock and York Rivers) in Chesapeake Bay, Virginia, USA. Benthic communities differed depending on river and location, with abundant clams in upriver regions and abundant polychaetes in downriver regions. Juvenile crabs, like adults, appeared to be opportunistic feeders, with gut contents including clams, amphipods, polychaetes, small crustaceans, plant matter, and detritus. There was a positive relationship between polychaetes in the benthic samples and in crab guts, suggesting that juvenile crabs are opportunistic feeders on polychaetes in the benthos. Moreover, Ivlev's electivity index and foraging ratio showed that clams and polychaetes were selectively eaten at all locations. Alternatively, crabs selectively rejected amphipods. Crab densities corresponded positively with polychaete densities, which suggests that there may be bottom-up control of crab distributions and that food resources are important in nursery habitats.

  8. Oxygen and carbon dioxide sensitivity of ventilation in amphibious crabs, Cardisoma guanhumi, breathing air and water.

    Science.gov (United States)

    Gannon, Andrew T; Henry, Raymond P

    2004-05-01

    Amphibious crabs, Cardisoma guanhumi, were acclimated to breathing either air or water and exposed to altered levels of oxygen and/or carbon dioxide in the medium. Hypercapnia (22, 36 and 73 torr CO(2)) stimulated a significant hypercapnic ventilatory response (HCVR) in both groups of crabs, with a much greater effect on scaphognathite frequency (Deltaf(SC)=+700%) in air-breathing crabs than water-breathing crabs (Deltaf(SC)=+100%). In contrast, hyperoxia induced significant hypoventilation in both sets of crabs. However, simultaneous hyperoxia and hypercapnia triggered a greater than 10-fold increase in f(SC) in air-breathing crabs but no change in water-breathing crabs. For water-breathing crabs hypoxia simultaneous with hypercapnia triggered the same response as hypoxia alone-bradycardia (-50%), and a significant increase in f(SC) at moderate exposures but not at the more extreme levels. The response of air-breathing crabs to hypoxia concurrent with hypercapnia was proportionally closer to the response to hypercapnia alone than to hypoxia. Thus, C. guanhumi were more sensitive to ambient CO(2) than O(2) when breathing air, characteristic of fully terrestrial species, and more sensitive to ambient O(2) when breathing water, characteristic of fully aquatic species. C. guanhumi possesses both an O(2)- and a CO(2)-based ventilatory drive whether breathing air or water, but the relative importance switches when the respiratory medium is altered.

  9. Crabs mediate interactions between native and invasive salt marsh plants: a mesocosm study.

    Directory of Open Access Journals (Sweden)

    Xiao-Dong Zhang

    Full Text Available Soil disturbance has been widely recognized as an important factor influencing the structure and dynamics of plant communities. Although soil reworkers were shown to increase habitat complexity and raise the risk of plant invasion, their role in regulating the interactions between native and invasive species remains unclear. We proposed that crab activities, via improving soil nitrogen availability, may indirectly affect the interactions between invasive Spartina alterniflora and native Phragmites australis and Scirpus mariqueter in salt marsh ecosystems. We conducted a two-year mesocosm experiment consisting of five species combinations, i.e., monocultures of three species and pair-wise mixtures of invasive and native species, with crabs being either present or absent for each combination. We found that crabs could mitigate soil nitrogen depletion in the mesocosm over the two years. Plant performance of all species, at both the ramet-level (height and biomass per ramet and plot-level (density, total above- and belowground biomass, were promoted by crab activities. These plants responded to crab disturbance primarily by clonal propagation, as plot-level performance was more sensitive to crabs than ramet-level. Moreover, crab activities altered the competition between Spartina and native plants in favor of the former, since Spartina was more promoted than native plants by crab activities. Our results suggested that crab activities may increase the competition ability of Spartina over native Phragmites and Scirpus through alleviating soil nitrogen limitation.

  10. Infestation of parasitic rhizocephalan barnacles Sacculina beauforti (Cirripedia, Rhizocephala in edible mud crab, Scylla olivacea

    Directory of Open Access Journals (Sweden)

    Khor Waiho

    2017-06-01

    Full Text Available Screening of mud crab genus Scylla was conducted in four locations (Marudu Bay, Lundu, Taiping, Setiu representing Malaysia. Scylla olivacea with abnormal primary and secondary sexual characters were prevalent (approximately 42.27% of the local screened S. olivacea population in Marudu Bay, Sabah. A total of six different types of abnormalities were described. Crabs with type 1 and type 3 were immature males, type 2 and type 4 were mature males, type 5 were immature females and type 6 were mature females. The abdomen of all crabs with abnormalities were dented on both sides along the abdomen’s middle line. Abnormal crabs showed significant variation in their size, weight, abdomen width and/or gonopod or pleopod length compared to normal individuals. The mean body weight of abnormal crabs (type 1–5 were higher than normal crabs with smaller body size, while females with type 6 abnormality were always heavier than the normal counterparts at any given size. Sacculinid’s externa were observed in the abdomen of crabs with type 4 and type 6 abnormalities. The presence of embryos within the externa and subsequent molecular analysis of partial mitochondrial COI region confirmed the rhizocephalan parasite as Sacculina beauforti. Future in-depth descriptions of the life cycle and characteristics of S. beauforti are recommended as it involves a commercially important edible crab species and the effect on human health from the consumption of crabs is of crucial concern.

  11. Hermit crabs in the diet of Pigeon Guillemots at Kachemak Bay, Alaska

    Science.gov (United States)

    Litzow, Michael A.; Piatt, John F.; Figurski, Jared D.

    1998-01-01

    Guillemots (Cepphus spp.) feed their chicks a diet that is almost exclusively fish. We observed Pigeon Guillemots (C. columba) at two colonies in Alaska where hermit crabs (Crustacea: Anomura) were a major part of the diet for some nestlings. Hermit crabs were delivered to three of five observed nests at one colony, comprised between 2% and 22% of the items delivered at those nests, and were the second most common food type at one nest. Hermit crabs may be an attractive prey item when lipid-rich forage fish are scarce, and crabs living in gastropod shells that have been softened by encrustations of Suberites sponges may be vulnerable to guillemot predation.

  12. Studies on the ecology and behaviour of the ghost crab, Ocypode cursor (L. in northern Cyprus

    Directory of Open Access Journals (Sweden)

    P. H. Strachan

    1999-03-01

    Full Text Available Aspects of the ecology and behaviour of Ocypode cursor were studied on the beaches of Northern Cyprus. The crabs were widely distributed around the north coast of the island, occurring on 68 of the 77 sandy beaches investigated. At the main study beach at Alagadi, crabs occupied a band approximately 12 m wide; starting approximately 3 m horizontally from the edge of the sea (tidal fluctuation was minimal. Most small burrows occurred near to the sea, with the burrows of larger crabs predominating higher up the beach. Burrow numbers varied during the summer which was mainly attributable to variations in the numbers of burrows of juveniles. The sex ratio of emergent crabs also varied during the summer, possibly reflecting burrow oriented behaviour of reproductive females. There were strong correlations between burrow diameters and carapace lengths of the occupant crabs. There was a positive correlation between the presence of crab burrows and the number of people using sections of beach. The crabs were principally nocturnal, benefitting from food discarded by tourists. They also scavenged animal carcasses and were active predators of turtle eggs and hatchlings. Crab burrows usually had a single opening oriented towards the sea and those cast were L- or J-shaped. Burrows did not penetrate to the water table. The water content of the sand at the bottom of burrows was around 14 % by weight. Their burrows in the well-sorted sand provided the crabs with a thermally stable environment.

  13. Edible crabs "go west": migrations and incubation cycle of Cancer pagurus revealed by electronic tags.

    Science.gov (United States)

    Hunter, Ewan; Eaton, Derek; Stewart, Christie; Lawler, Andrew; Smith, Michael T

    2013-01-01

    Crustaceans are key components of marine ecosystems which, like other exploited marine taxa, show seasonable patterns of distribution and activity, with consequences for their availability to capture by targeted fisheries. Despite concerns over the sustainability of crab fisheries worldwide, difficulties in observing crabs' behaviour over their annual cycles, and the timings and durations of reproduction, remain poorly understood. From the release of 128 mature female edible crabs tagged with electronic data storage tags (DSTs), we demonstrate predominantly westward migration in the English Channel. Eastern Channel crabs migrated further than western Channel crabs, while crabs released outside the Channel showed little or no migration. Individual migrations were punctuated by a 7-month hiatus, when crabs remained stationary, coincident with the main period of crab spawning and egg incubation. Incubation commenced earlier in the west, from late October onwards, and brooding locations, determined using tidal geolocation, occurred throughout the species range. With an overall return rate of 34%, our results demonstrate that previous reluctance to tag crabs with relatively high-cost DSTs for fear of loss following moulting is unfounded, and that DSTs can generate precise information with regards life-history metrics that would be unachievable using other conventional means.

  14. Dominant white spotting in the Chinese hamster.

    Science.gov (United States)

    Henwood, C; Henwood, J; Robinson, R

    1987-01-01

    An autosomal dominant white spotting mutant is described for the Chinese hamster. The mutant gene is designated as dominant spot (symbol Ds). The homozygote DsDs is a prenatal lethal while the heterozygote Ds + displays white spotting. The expression of white is variable, ranging from a white forehead spot to extensive white on the body. The venter is invariably white. Growth appears to be normal and the fertility of both sizes shows no impairment.

  15. Laser Pyrometer For Spot Temperature Measurements

    Science.gov (United States)

    Elleman, D. D.; Allen, J. L.; Lee, M. C.

    1988-01-01

    Laser pyrometer makes temperature map by scanning measuring spot across target. Scanning laser pyrometer passively measures radiation emitted by scanned spot on target and calibrated by similar passive measurement on blackbody of known temperature. Laser beam turned on for active measurements of reflectances of target spot and reflectance standard. From measurements, temperature of target spot inferred. Pyrometer useful for non-contact measurement of temperature distributions in processing of materials.

  16. A horseshoe crab receptor structurally related to Drosophila Toll.

    Science.gov (United States)

    Inamori, K; Koori, K; Mishima, C; Muta, T; Kawabata, S

    2000-01-01

    Innate immunity against microbial pathogens relies on the pattern recognition of cell wall components on invading microbes. Recent evidence has shown that a mammalian Toll-like receptor (TLR) is activated by bacterial lipopolysaccharides (LPS). The innate immunity in invertebrates is also triggered by LPS, as seen in the hemolymph coagulation in horseshoe crab. We report the cloning of a TLR from the Japanese horseshoe crab Tachypleus tridentatus. A cDNA coding for Tachypleus Toll was isolated from a hemocyte cDNA library and the open reading frame codes for a proprotein including a signal sequence. Like Drosophila Toll, Tachypleus Toll is a type I transmembrane protein with an extracellular domain consisting of two leucine-rich repeats flanked by two cystein-rich clusters and a cytoplasmic domain exhibiting striking similarity with the cytoplasmic domain of interleukin-1 receptor. Tachypleus Toll is most similar to Drosophila Toll in the domain architecture and the overall length.

  17. Shell selection of hermit crabs is influenced by fluid drag

    Science.gov (United States)

    Casillas, Barbara; Ledesma, Rene; Alcaraz, Guillermina; Zenit, Roberto

    2010-11-01

    The flow around gastropod shells used by hermit crabs (Calcinus californiensis) was visualized experimentally. These crabs choose their shells according to many factors; we found that the choice of shell (shape and weight) is directly related to the drag caused over them by the exposure to wave action. Tests were conducted in a wind tunnel to investigate flow differences for shells of various shapes. A particle image velocimetry (PIV) system was used to visualize the flow field. The images above show the flow field around two types of shells (Thais speciosa and Nerita scabircosta) for Reynolds numbers of O(10^5). Using a control volume analysis, the drag coefficient was inferred. Several shell geometries, orientations and mean flow velocities were tested. In this talk, the flow and drag force will be shown for the different arrangements. A discussion of the relation between drag and shape will be presented.

  18. M10.3.1: LHC crab cavity specifications completed

    CERN Document Server

    Ciapala, E

    2010-01-01

    • The starting point of Sub-task 1 is to determine the full LHC system requirements for the crab cavity system. This milestone concerns completion of basic specifications for the crab cavity system. This comprises the beam requirements, the cavity impedance constraints, the operating conditions and constraints, the layout and integration constraints in LHC and very importantly machine protection issues. The specifications of the cavity itself and its ancillaries follow from these system requirements and on the technology chosen for the cavity design. • The beam requirements result from the known parameters of the LHC upgrade lattice and the expected LHC beam parameters at ultimate bunch intensity. There are boundary conditions imposed by certain beam parameters such as the bunch length and intensity and by the machine layout, mainly the available beam pipe separations at the proposed cavity positions. Requirements on RF noise and stability are tight, to avoid emittance blow-up. Machine protection issues a...

  19. LHC crab cavity specifications milestone: M10.3.1

    CERN Document Server

    Calaga, R; Jensen, E; McIntosh, P; Shaposhnikova, E; Tuckmantel, J; Zimmermann, F

    2010-01-01

    The starting point of Sub-task 1 is to determine the full LHC system requirements for the crab cavity system. This milestone concerns completion of basic specifications for the crab cavity system. This comprises the beam requirements, the cavity impedance constraints, the operating conditions and constraints, the layout and integration constraints in LHC and very importantly machine protection issues. The specifications of the cavity itself and its ancillaries follow from these system requirements and on the technology chosen for the cavity design. The beam requirements result from the known parameters of the LHC upgrade lattice and the expected LHC beam parameters at ultimate bunch intensity. There are boundary conditions imposed by certain beam parameters such as the bunch length and intensity and by the machine layout, mainly the available beam pipe separations at the proposed cavity positions. Requirements on RF noise and stability are tight, to avoid emittance blow-up. Machine protection issues arise fro...

  20. A Spider That Lays Its Eggs in Rows

    Directory of Open Access Journals (Sweden)

    Robert L. Edwards

    2000-01-01

    Full Text Available The small (2.5-3.0 mm, colorful metine spider, Homalometa nigritarsis Simon 1897, Family Tetragnathidae, has previously been reported from northern Mexico, Panama and the southern islands of the Lesser Antilles (Levi 1986. In the rain forest of northeastern Puerto Rico it is most frequently found with webbing on the larger outer concave surfaces of pendulous leaves. H. nigritarsis typically makes a circular, relatively flat retreat within which the female deposits two parallel rows of naked eggs. The rows are produced at intervals; as one row hatches another replaces it shortly thereafter. Evidence of up to four generations of rows has been observed. Above the retreat, and closely aligned with it, the spider builds a nearly invisible, delicate orb web, typically from edge to edge of the leaf (Fig. 1a and b. While retaining the traditional orb-web, H. nigritarsis has adopted a unique habitat and set of life history features.

  1. Lethal intragroup aggression by adult male spider monkeys (Ateles geoffroyi).

    Science.gov (United States)

    Campbell, Christina J

    2006-12-01

    I report three cases of coalitionary aggression by adult male black-handed spider monkeys (Ateles geoffroyi) against subadult males within their community on Barro Colorado Island (BCI), Panama. Two of these cases were followed by the disappearance and presumed death of the victim. Similar behavior was recently reported by Valero et al. [in press], who suggested that this behavior may be the result of intense male reproductive competition. Like the single instance they reported, the cases I report all occurred when the operational sex ratio was approximately 1:1, which suggests that intense competition among males for access to reproductively viable females may be a contributing factor. Additionally the very low density of spider monkeys on BCI may play a significant role in the occurrence of this lethal aggression. Large numbers of adult males are not necessary to protect a territorial boundary against neighboring groups, and additional males may act merely as mating competition. (c) 2006 Wiley-Liss, Inc.

  2.  “Spiders and Webs in American Literature”

    Directory of Open Access Journals (Sweden)

    Vincent Dussol

    2012-05-01

    Full Text Available From Jonathan Edwards to Jorie Graham, spiders are strikingly present in American literature. The purpose of this article is first to show how that theme may have become something of a national tradition as very different writers, all of them careful observers of aranae, answered one another through the years. It is very likely that the attention paid to spiders by American authors was increased by those Native American myths in which spiders are a central figure. More than occasionally, on the female side of the American counter-culture, especially among its feminist and lesbian exponents, simple activists and creative writers have harnessed the symbolic power invested in the spider by Native Americans.There may be deeper reasons accounting for American authors’ fascination with spiders. The country’s phobia of disunion is one; a nation of settlers’ acute consciousness of the precariousness of its occupation of the territory is another. In demonstrating outstanding skills for adjustment to unknown places, spiders epitomize a form of identity permanence. The predominantly positive character of spider symbols in American literature will occasionally be inverted. Following the national logic of checks and balances, any web covering the whole of the United States will tend to come under suspicion.This study ends with an inventory of cultural productions linked with spiders and webs and whose Americanness is yet to be clearly determined.De Jonathan Edwards à Jorie Graham, l’araignée apparaît dans un nombre frappant de textes littéraires américains. On a d’abord voulu tenter de montrer comment a pu se construire cette tradition thématique et faire la preuve que différents écrivains, réunis par un souci de l’observation, se sont répondus à travers elle. L’attention prêtée à l’araignée s’est certainement trouvée renforcée par les récits mythologiques des peuples premiers américains qui font de l’araignée une

  3. Comparing the rheology of native spider and silkworm spinning dope

    Science.gov (United States)

    Holland, C.; Terry, A. E.; Porter, D.; Vollrath, F.

    2006-11-01

    Silk production has evolved to be energetically efficient and functionally optimized, yielding a material that can outperform most industrial fibres, particularly in toughness. Spider silk has hitherto defied all attempts at reproduction, despite advances in our understanding of the molecular mechanisms behind its superb mechanical properties. Spun fibres, natural and man-made, rely on the extrusion process to facilitate molecular orientation and bonding. Hence a full understanding of the flow characteristics of native spinning feedstock (dope) will be essential to translate natural spinning to artificial silk production. Here we show remarkable similarity between the rheologies for native spider-dragline and silkworm-cocoon silk, despite their independent evolution and substantial differences in protein structure. Surprisingly, both dopes behave like typical polymer melts. This observation opens the door to using polymer theory to clarify our general understanding of natural silks, despite the many specializations found in different animal species.

  4. Optics of the ultraviolet reflecting scales of a jumping spider

    Science.gov (United States)

    Land, Michael F; Horwood, Julia; Lim, Matthew L.M; Li, Daiqin

    2007-01-01

    The jumping spider Cosmophasis umbratica from Singapore is strongly sexually dimorphic. The males, but not the females, reflect ultraviolet as well as green–orange light. The scales responsible for this are composed of a chitin–air–chitin sandwich in which the chitin layers are three-quarters of a wavelength thick and the air gap a quarter wavelength (where λ=600 nm, the peak wavelength of the principal reflection maximum). It is shown that this configuration produces a second reflectance peak at approximately 385 nm, accounting for the observed reflection in the ultraviolet. Other scales have a similar thickness of chitin but lack the air gap and thus produce a dull purple reflection. This novel mechanism provides the spiders with two colour signals, both of which are important in mating displays. PMID:17456453

  5. Battre sa (super) coulpe : Spider-Man (1962)

    OpenAIRE

    Tomasovic, Dick

    2016-01-01

    L’édification est l'une des grandes fonctions traditionnelles de la littérature de jeunesse. Spider-Man, héros populaire s'il en est, s'est révélé bien sûr l'ambassadeur de nombreuses valeurs sociétales américaines (le do it yourself, l'esprit d'entreprise et d'indépendance, la tolérance, la fidélité , la célébration du système éducationnel, la transmission et la solidarité intergénérationnelle, le sens des responsabilités, évidemment, etc.). Spider-Man se bat moins qu'il ne se débat. Il est ...

  6. Black widow spider envenomation, a rare cause of Horner's syndrome.

    Science.gov (United States)

    Strowd, Roy E; Scott, Blake; Walker, Francis O

    2012-06-01

    Horner's syndrome involves a triad of eyelid ptosis, miosis, and facial anhidrosis that results from disruption of the oculosympathetic pathway. Acquired Horner's syndrome is associated with a variety of medical conditions including Pancoast tumor and carotid dissection. We report the unique case of a 47-year-old man presenting with Horner's syndrome 4 weeks after black widow spider envenomation. Workup did not reveal any alternative explanatory etiology. We hypothesize that late sequelae of black widow spider envenomation secondary to autonomic nerve injury or retrograde axonal transport after mechanical inoculation may have led to an acquired defect in the oculosympathetic pathway resulting in a Horner's syndrome. This case introduces a rare cause of Horner's syndrome and highlights the importance of environmental exposures in the evaluation of these patients. Copyright © 2012 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.

  7. Gravity Reception and Cardiac Function in the Spider

    Science.gov (United States)

    Finck, A.

    1985-01-01

    The following features of the arachnid gravity system were studied. (1) the absolute threshold to hyper-gz is quite low indicating fine proprioreceptive properties of the lyriform organ, the Gz/vibration detector; (2) the neurogenic heart of the spider is a good dependent variable for assessing its behavior to Gz and other stimuli which produce mechanical effects on the exoskeleton; (3) Not only is the cardiac response useful but it is now understood to be an integral part of the system which compensates for the consequences of gravity in the spider (an hydraulic leg extension); and (4) a theoretical model was proposed in which a mechanical amplifier, the leg lever, converts a weak force (at the tarsus) to a strong force (at the patella), capable of compressing the exoskeleton and consequently the lyriform receptor.

  8. Structure to function: Spider silk and human collagen

    Science.gov (United States)

    Rabotyagova, Olena S.

    Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

  9. Black widow spider (Latrodectus mactans) envenomation in a term pregnancy.

    Science.gov (United States)

    Sherman; Groll; Gonzalez; Aerts

    2000-07-01

    Description of a black widow spider (Latrodectus mactans) envenomation in a term pregnancy.Case report conducted at an Air Force tertiary care hospital of a 27-year-old primigravida at 38 1/7 weeks pregnancy.Latrodectus mactans antivenin can be given to treat symptoms of black widow envenomation.Black widow envenomations can cause symptoms associated with acute intra-abdominal processes. In pregnancy, envenomations can result in symptoms and signs similar to those seen in preeclampsia (abdominal pain, headache, hypertension, and proteinuria). Latrodectism should be considered in patients complaining of these symptoms in association with a spider bite. If latrodectism is considered to be the underlying origin for these symptoms, appropriate treatment should be administered. In cases of pregnancy, treatment should include L. mactans antivenin if believed to be clinically indicated. There is no current evidence that this antivenin is contraindicated in pregnancy. (Curr Surg 57:346-348)

  10. Environmental Engineering Approaches toward Sustainable Management of Spider Mites.

    Science.gov (United States)

    Suzuki, Takeshi

    2012-10-26

    Integrated pest management (IPM), which combines physical, biological, and chemical control measures to complementary effect, is one of the most important approaches to environmentally friendly sustainable agriculture. To expand IPM, we need to develop new pest control measures, reinforce existing measures, and investigate interactions between measures. Continued progress in the development of environmental control technologies and consequent price drops have facilitated their integration into plant production and pest control. Here I describe environmental control technologies for the IPM of spider mites through: (1) the disturbance of photoperiod-dependent diapause by artificial light, which may lead to death in seasonal environments; (2) the use of ultraviolet radiation to kill or repel mites; and (3) the use of water vapor control for the long-term cold storage of commercially available natural enemies. Such environmental control technologies have great potential for the efficient control of spider mites through direct physical effects and indirect effects via natural enemies.

  11. First Test Results of the 4-ROD Crab Cavity

    CERN Document Server

    Ambattu, P; Burt, G; Calaga, R; Capatina, O; Calatroni, S; Ciapala, E; Doherty, D; Ferreira, L; Jensen, E; Hall, B; Lingwood, C; Maesen, P; Mongelluzzo, A; Renaglia, T; Therasse, M

    2013-01-01

    The first compact prototype crab cavity with the 4rod geometry has undergone surface treatment and cold testing. Due to the complex geometry and unique fabrication procedure, RF validation of the field at beyond the nominal operating voltage at a sufficiently high Q0 is an important pre-requisite. Preliminary results of the first cold tests are presented along with cavity performance at different stages of the cavity processing is described.

  12. Crab Hole Mosquito Blues—The Story

    Centers for Disease Control (CDC) Podcasts

    2011-05-12

    This podcast reports on a humorous song that takes a look at a very serious human and equine disease. Written and performed by the MARU Health Angels Band, Bill Dietz, director of the Division of Nutrition, Physical Activity and Obesity at CDC, talks about the song, "Crab Hole Mosquito Blues", and the history behind it.  Created: 5/12/2011 by National Center for Emerging Zoonotic and Infectious Diseases (NCEZID).   Date Released: 5/23/2011.

  13. A troglomorphic spider from Java (Araneae, Ctenidae, Amauropelma)

    Science.gov (United States)

    Miller, Jeremy; Rahmadi, Cahyo

    2012-01-01

    Abstract A new troglomorphic spider from caves in Central Java, Indonesia, is described and placed in the ctenid genus Amauropelma Raven, Stumkat & Gray, until now containing only species from Queensland, Australia. Only juveniles and mature females of the new species are known. We give our reasons for placing the new species in Amauropelma, discuss conflicting characters, and make predictions about the morphology of the as yet undiscovered male that will test our taxonomic hypothesis. The description includes DNA barcode sequence data. PMID:22303127

  14. Traditions in Spider Monkeys Are Biased towards the Social Domain

    OpenAIRE

    Santorelli, Claire J.; Schaffner, Colleen M.; Campbell, Christina J.; Notman, Hugh; Pavelka, Mary S.; Weghorst, Jennifer A.; Aureli, Filippo

    2011-01-01

    Cross-site comparison studies of behavioral variation can provide evidence for traditions in wild species once ecological and genetic factors are excluded as causes for cross-site differences. These studies ensure behavior variants are considered within the context of a species' ecology and evolutionary adaptations. We examined wide-scale geographic variation in the behavior of spider monkeys (Ateles geoffroyi) across five long-term field sites in Central America using a well established ethn...

  15. Innate pattern recognition and categorization in a jumping spider.

    Directory of Open Access Journals (Sweden)

    Yinnon Dolev

    Full Text Available The East African jumping spider Evarcha culicivora feeds indirectly on vertebrate blood by preferentially preying upon blood-fed Anopheles mosquitoes, the vectors of human malaria1, using the distinct resting posture and engorged abdomen characteristic of these specific prey as key elements for their recognition. To understand perceptual categorization of objects by these spiders, we investigated their predatory behavior toward different digital stimuli--abstract 'stick figure' representations of Anopheles constructed solely by known key identification elements, disarranged versions of these, as well as non-prey items and detailed images of alternative prey. We hypothesized that the abstract images representing Anopheles would be perceived as potential prey, and would be preferred to those of non-preferred prey. Spiders perceived the abstract stick figures of Anopheles specifically as their preferred prey, attacking them significantly more often than non-preferred prey, even when the comprising elements of the Anopheles stick figures were disarranged and disconnected from each other. However, if the relative angles between the elements of the disconnected stick figures of Anopheles were altered, the otherwise identical set of elements was no longer perceived as prey. These data show that E. culicivora is capable of making discriminations based on abstract concepts, such as the hypothetical angle formed by discontinuous elements. It is this inter-element angle rather than resting posture that is important for correct identification of Anopheles. Our results provide a glimpse of the underlying processes of object recognition in animals with minute brains, and suggest that these spiders use a local processing approach for object recognition, rather than a holistic or global approach. This study provides an excellent basis for a comparative analysis on feature extraction and detection by animals as diverse as bees and mammals.

  16. Spiders in mountain habitats of the Giant Mountains

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Vaněk, J.; Šmilauer, P.

    2012-01-01

    Roč. 43, č. 4 (2012), s. 341-347 ISSN 1067-4136 Institutional research plan: CEZ:AV0Z50070508 Keywords : Giant Mountains (Krkonoše, Karkonosze) * spider s * anemo-orographic systems Subject RIV: EH - Ecology , Behaviour Impact factor: 0.236, year: 2012 http://www.springerlink.com/content/0k5g721q1155r146/fulltext.pdf

  17. Colonization of subterranean habitats by spiders in Central Europe

    Czech Academy of Sciences Publication Activity Database

    Růžička, Vlastimil; Šmilauer, P.; Mlejnek, R.

    2013-01-01

    Roč. 42, č. 2 (2013), s. 133-140 ISSN 0392-6672 Grant - others:GA JU(CZ) GAJU 04-142/2010/P Institutional support: RVO:60077344 Keywords : superficial and deep subterranean habitats * caves * spider s Subject RIV: EH - Ecology , Behaviour Impact factor: 1.275, year: 2013 http://scholarcommons.usf.edu/cgi/viewcontent.cgi?article=1288&context=ijs

  18. Early environmental conditions shape personality types in a jumping spider

    Directory of Open Access Journals (Sweden)

    Jannis eLiedtke

    2015-12-01

    Full Text Available Individuals of many species across the animal kingdom are found to be less plastic than expected, even in behavioral traits. The existence of consistent behavioral differences between individuals, termed personality differences, is puzzling, since plastic behavior is considered ideal to enable animals to adaptively respond to changes in environmental conditions. In order to elucidate which mechanisms are important for the evolution of personality differences, it is crucial to understand which aspects of the environment are important for the development of personality differences. Here, we tested whether physical or social aspects of the environment during development influence individual differentiation (mean level of behavior using the jumping spider Marpissa muscosa. Furthermore, we assessed whether those behaviors were repeatable, i.e. whether personalities existed. We applied a split-brood design and raised spider siblings in three different environments: a deprived environment with no enrichment, a socially and a physically enriched environment. We focused on exploratory behavior and repeatedly assessed individual behavior in a novel environment and a novel object test. Results show that the environment during development influenced spiders’ exploratory tendencies: spiders raised in enriched environments tended to be more exploratory. Most investigated behaviors were repeatable (i.e. personalities existed across all individuals tested, whereas only few behaviors were also repeatable across individuals that had experienced the same environmental condition. Taken together, our results indicate that external stimuli can influence the development of one aspect of personality, the inter-individual variation (mean level of behavior, in a jumping spider. We also found family by environment interactions on behavioral traits potentially suggesting genetic variation in developmental plasticity.

  19. Damage, Self-Healing, and Hysteresis in Spider Silks

    OpenAIRE

    De Tommasi, D.; Puglisi, G.; Saccomandi, G.

    2010-01-01

    In this article, we propose a microstructure-based continuum model to describe the material behavior of spider silks. We suppose that the material is composed of a soft fraction with entropic elasticity and a hard, damageable fraction. The hard fraction models the presence of stiffer, crystal-rich, oriented regions and accounts for the effect of softening induced by the breaking of hydrogen bonds. To describe the observed presence of crystals with different size, composition, and orientation,...

  20. A Parasitoid Wasp Induces Overwintering Behaviour in Its Spider Host

    OpenAIRE

    Korenko, Stanislav; Pekár, Stano

    2011-01-01

    Parasites and parasitoids control behaviors of their hosts. However, the origin of the behavior evoked by the parasitic organism has been rarely identified. It is also not known whether the manipulation is universal or host-specific. Polysphinctine wasps, koinobiont ectoparasitoids of several spider species that manipulate host web-spinning activity for their own protection during pupation, provide an ideal system to reveal the origin of the evoked behavior. Larva of Zatypota percontatoria pe...

  1. [Neurotoxic manifestations of black widow spider envenomation in paediatric patients].

    Science.gov (United States)

    Sotelo-Cruz, N; Gómez-Rivera, N

    2016-05-01

    Envenomation by black widow spiders manifests clinically with signs of neurotoxicity in paediatric patients. Identify typical neurological signs and symptoms in paediatric patients of different ages, and describe treatment and outcomes in a paediatric hospital in northwest Mexico. We reviewed 70 clinical records of patients hospitalised due to black widow spider bite between 1978 and 2014. We divided the total into 2 groups: Group 1, infants and preschool children; and Group 2, school-age children and adolescents. The demographic variables were age, sex, birthplace, place where envenomation occurred, body part(s) affected, degree of envenomation according to signs and symptoms, treatment, clinical outcome, and statistical differences. Boys accounted for 61.4% of all cases, and infants younger than one year old made up 14.2%. Most patients (70%) were bitten by the spider at home; the anatomical areas most frequently affected were the legs, neck, thorax, and abdomen. The neurological signs and symptoms displayed by Group 1 were irritability, constant crying, sialorrhoea, nausea, tachycardia, arrhythmias, fatigue when walking, agitation, muscle spasms paraesthesia, tetany, seizures, and nystagmus. Signs in Group 2 included localized pain, headache, sialorrhoea, paraesthesia, profuse sweating, anxiety, muscle weakness, muscle spasms, and fine tremor. The predominant autonomic sign in Group 1 was sialorrhoea (P<.0001) and in Group 2, paraesthesia (P<.0001). Patients who received Fab antivenom treatment displayed better outcomes and shorter hospital stays than those who did not. No deaths were reported. The neurological signs and symptoms caused by black widow spider bite are predominantly autonomic, and identifying them permits early diagnosis and more effective treatment. Copyright © 2015 Sociedad Española de Neurología. Published by Elsevier España, S.L.U. All rights reserved.

  2. Visual Discrimination Learning in the Jumping Spider Phidippus regius

    OpenAIRE

    Massimo De Agrò; Lucia Regolin; Enzo Moretto

    2017-01-01

    Over the past decade, research in comparative psychology has increasingly focused on non-vertebrate models of cognition. Jumping spiders provide excellent models for the study of visually mediated behaviors, such as associative learning or the navigation of complex environments. Here, we tested visual and memory abilities of Phidippus regius to discriminate between artificial geometrical stimuli and to generalize the learned discrimination to illusory stimuli, using the amodal completion mech...

  3. A Drosophila wing spot test

    International Nuclear Information System (INIS)

    Ayaki, Toshikazu; Yoshikawa, Isao; Niikawa, Norio; Hoshi, Masaharu.

    1986-01-01

    A Drosophila wing spot test system was used to investigate the effects of low doses of X-rays, gamma rays, and both 2.3 and 14.1 MeV neutrons on somatic chromosome mutation (SCM) induction. The incidence of SCM was significantly increased with any type of radiation, with evident linear dose-response relationship within the range of 3 to 20 cGy. It was estimated that relative biological effectiveness value for SCM induction of 2.3 MeV neutrons to X-rays and gamma rays is much higher than that of 14.1 MeV neutrons to those photons (2.4 vs 8.0). The Drosophila wing spot test system seems to become a promising in vivo experimental method for higher animals in terms of the lack of necessity for a marvelously large number of materials required in conventional test system. (Namekawa, K.)

  4. Differential escape from parasites by two competing introduced crabs

    Science.gov (United States)

    Blakeslee, April M.; Keogh, Carolyn L.; Byers, James E.; Kuris, Armand M.; Lafferty, Kevin D.; Torchin, Mark E.

    2009-01-01

    Although introduced species often interact with one another in their novel communities, the role of parasites in these interactions remains less clear. We examined parasite richness and prevalence in 2 shorecrab species with different invasion histories and residency times in an introduced region where their distributions overlap broadly. On the northeastern coast of the USA, the Asian shorecrab Hemigrapsus sanguineus was discovered 20 yr ago, while the European green crab Carcinus maenas has been established for over 200 yr. We used literature and field surveys to evaluate parasitism in both crabs in their native and introduced ranges. We found only 1 parasite species infecting H. sanguineus on the US East Coast compared to 6 species in its native range, while C. maenas was host to 3 parasite species on the East Coast compared to 10 in its native range. The prevalence of parasite infection was also lower for both crabs in the introduced range compared to their native ranges; however, the difference was almost twice as much for H. sanguineus as for C. maenas. There are several explanations that could contribute to C. maenas' greater parasite diversity than that of H. sanguineus on the US East Coast, including differences in susceptibility, time since introduction, manner of introduction (vector), distance from native range, taxonomic isolation, and the potential for parasite identification bias. Our study underscores not just that non-native species lose parasites upon introduction, but that they may do so differentially, with ramifications for their direct interactions and with potential community-level influences.

  5. On the injection of relativistic particles into the Crab Nebula

    International Nuclear Information System (INIS)

    Shklovskij, I.S.

    1977-01-01

    It is shown that a flux of relativistic electrons from the NP 0532 pulsar magnetosphere, responsible for its synchrotron emission, cannot provide the necessary energy pumping to the Crab Nebula. A conclusion is reached that such a pumping can be effectuated by a flow of relativistic electrons leaving the NP 0532 magnetosphere at small pitch angles and giving therefore no appreciable contribution to the synchrotron emission of the pulsar. An interpretation of the Crab Nebula synchrotron spectrum is given on the assumption of secular ''softening'' of the energy spectrum of the relativistic electrons injected into the Nebula. A possibility of explanation of the observed rapid variability of some features in the central part of the Nebula by ejection of free - neutron - rich dense gas clouds from the pulsar surface during ''starquakes'' is discussed. The clouds of rather dense (nsub(e) approximately 10 7 cm -3 ) plasma, thus formed at about 10 13 cm from pulsar, will be accelerated up to relativistic velocities by the pressure of the magneto-dipole radiation of NP 0532 and will deform the magnetic field in the inner part (R 17 cm) of the Crab Nebula, that is the cause of the variability observed. In this case, favourable conditions for the acceleration of the particles in the cloud up to relativistic energies are realized; that may be an additional source of injection

  6. Observation and Spectral Measurements of the Crab Nebula with Milagro

    Science.gov (United States)

    Abdo, A. A.; Allen, B. T.; Aune, T.; Benbow, W.; Berley, D.; Chen, C.; Christopher, G. E.; DeYoung, T.; Dingus, B. L.; Falcone, A.; hide

    2011-01-01

    The Crab Nebula was detected with the Milagro experiment at a statistical significance of 17 standard deviations over the lifetime of the experiment. The experiment was sensitive to approximately 100 GeV - 100 TeV gamma ray air showers by observing the particle footprint reaching the ground. The fraction of detectors recording signals from photons at the ground is a suitable proxy for the energy of the primary particle and has been used to measure the photon energy spectrum of the Crab Nebula between 1 and 100 TeV. The TeV emission is believed to be caused by inverse-Compton up-scattering scattering of ambient photons by an energetic electron population. The location of a Te V steepening or cutoff in the energy spectrum reveals important details about the underlying electron population. We describe the experiment and the technique for distinguishing gamma-ray events from the much more-abundant hadronic events. We describe the calculation of the significance of the excess from the Crab and how the energy spectrum is fit.

  7. Sweet Spots and Door Stops

    Science.gov (United States)

    Thompson, Michael; Tsui, Stella; Leung, Chi Fan

    2011-01-01

    A sweet spot is referred to in sport as the perfect place to strike a ball with a racquet or bat. It is the point of contact between bat and ball where maximum results can be produced with minimal effort from the hand of the player. Similar physics can be applied to the less inspiring examples of door stops; the perfect position of a door stop is…

  8. Evidence for antimicrobial activity associated with common house spider silk

    Directory of Open Access Journals (Sweden)

    Wright Simon

    2012-06-01

    Full Text Available Abstract Background Spider silk is one of the most versatile materials in nature with great strength and flexibility. Native and synthetically produced silk has been used in a wide range of applications including the construction of artificial tendons and as substrates for human cell growth. In the literature there are anecdotal reports that suggest that native spider silk may also have antimicrobial properties. Findings In this study we compared the growth of a Gram positive and a Gram negative bacterium in the presence and absence of silk produced by the common house spider Tegenaria domestica. We demonstrate that native web silk of Tegenaria domestica can inhibit the growth of the Gram positive bacterium, Bacillus subtilis. No significant inhibition of growth was detected against the Gram negative bacterium, Escherichia coli. The antimicrobial effect against B. subtilis appears to be short lived thus the active agent potentially acts in a bacteriostatic rather than bactericidal manner. Treatment of the silk with Proteinase K appears to reduce the ability to inhibit bacterial growth. This is consistent with the active agent including a protein element that is denatured or cleaved by treatment. Tegenaria silk does not appear to inhibit the growth of mammalian cells in vitro thus there is the potential for therapeutic applications.

  9. Artificial insemination in black-handed spider monkey (Ateles geoffroyi).

    Science.gov (United States)

    Hernández-López, L; Cerda-Molina, A L; Páez-Ponce, D L; Rojas-Maya, S; Mondragón-Ceballos, R

    2007-01-15

    Artificial insemination (AI) was performed in spider monkeys; these primates are vulnerable to extinction and usually do not reproduce spontaneously in captivity. Uterine cycles were followed by daily assessment of vaginal cytology, and corroborated a posteriori by concentrations of 17-beta estradiol and progesterone, measured by radioimmunoassay (RIA), in fecal samples collected once daily. Five females between 13 to 27 years old were inseminated intravaginally (with fresh semen) twice each during the periovulatory phase (Days 9-12 of the menstrual cycle; Day 0, first day of menstrual bleeding), from September to the first 3 weeks of November (most fertile months). Transcervical AI was not useful in this primate because the liquid portion of the semen completely solidified instead of liquefying as in other primates. Pregnancies were apparently achieved in 5 of 14 attempts. One female became pregnant after the first round of inseminations, delivered a healthy infant, was inseminated and got pregnant again (subsequently aborted). One female aborted, apparently due to an intramural uterine leiomyoma. Another two females stopped menstruating for a few months, then restarted menstruating (these females may have been pregnant and aborted). In conclusion, in spider monkeys: (1) captivity-induced stress did not inhibit reproduction; (2) fecal steroid hormones were useful to assess cyclicity; (3) the semen coagulum, which apparently is a tightly packed and large reservoir of spermatozoa, must not be discarded but used in AI; (4) old female spider monkeys did not have cessation of reproductive function.

  10. Epigeic spiders of the pastures of northern Wielkopolska

    Directory of Open Access Journals (Sweden)

    Woźny, Marek

    2000-10-01

    Full Text Available The fauna of epigeic spiders (Araneae occurring on three different types of pastures in northern Wielkopolska was analysed. Studies were conducted from May 1992 to October 1993. The 18,995 specimens collected were classified as belonging to 137 species and 17 families. The family Linyphiidae proved the richest in species while Lycosidae was the most abundantly in terms of number of specimens. Zoocenological analysis of spider communities showed their differentiation testifying to differences in the sites studied. The dominants were: 1 Osowo Stare (Site 1: Pardosa palustris, 2 Sycyn Dolny (Site 2: Xerolycosa miniata, P. palustris, Xysticus kochi, 3 Braczewo (Site 3: Erigone dentipalpis, P. palustris. Seasonal changes of dominance of the species at each site were established. A comparison of changes of the species’ dominances in the years 1992 and 1993 disclosed similar values of the individual dominance coefficient at the sites in Osowo Stare and Braczewo. This result indicates the occurrence of the process of stabilization of these biocenoses and a tendency to equilibrium in the environment. The least stable proved to be the site at Sycyn Dolny. Analysis of the seasonal dynamics of epigeic spider communities was also made by determining the mean number of species at each site in the two years of study. The highest number of species was noted in spring. It is interesting to note the appearance of species which are rare or very rare in Poland such as: Lepthyphantes insignis, Ostearius melanopygius, Enoplognatha mordax and Enoplognatha oelandica.

  11. Seasonal variation of ground spiders in a Brazilian Savanna

    Directory of Open Access Journals (Sweden)

    Marina Farcic Mineo

    2010-06-01

    Full Text Available The Brazilian Savanna Ecoregion (Cerrado is one of the richest biomes in the world, with a characteristic highly seasonal climate a dry season between May and September and a rainy season from October through April. Ground-dwelling spiders from three Cerrado phytophysiognomies, "campo cerrado", "cerrado" and "cerrad��o", were sampled using pitfall traps during two years, totaling 111 species and 3,529 individuals. The abundance of individuals and species richness was higher during the wet season. Fifty-eight species were captured exclusively during that period, whereas only nineteen were restricted to the dry season. Only two species were found in all samples. The number of juveniles was higher than the number of adults in all phytophysiognomies and in all species during both seasons. The highest abundance was registered in October and the lowest in April. Overall sex ratio was male-biased in all vegetation types sampled. Distinct climate variables affected the abundance of spiders depending on sex, age and vegetal physiognomy where they were sampled. This study involved the longest sampling of spider abundance and diversity on the ground of a Brazilian Savanna.

  12. A New Limit on CMB Circular Polarization from SPIDER

    Energy Technology Data Exchange (ETDEWEB)

    Nagy, J. M.; Ade, P. A. R.; Amiri, M.; Benton, S. J.; Bergman, A. S.; Bihary, R.; Bock, J. J.; Bond, J. R.; Bryan, S. A.; Chiang, H. C.; Contaldi, C. R.; Doré, O.; Duivenvoorden, A. J.; Eriksen, H. K.; Farhang, M.; Filippini, J. P.; Fissel, L. M.; Fraisse, A. A.; Freese, K.; Galloway, M.; Gambrel, A. E.; Gandilo, N. N.; Ganga, K.; Gudmundsson, J. E.; Halpern, M.; Hartley, J.; Hasselfield, M.; Hilton, G.; Holmes, W.; Hristov, V. V.; Huang, Z.; Irwin, K. D.; Jones, W. C.; Kuo, C. L.; Kermish, Z. D.; Li, S.; Mason, P. V.; Megerian, K.; Moncelsi, L.; Morford, T. A.; Netterfield, C. B.; Nolta, M.; Padilla, I. L.; Racine, B.; Rahlin, A. S.; Reintsema, C.; Ruhl, J. E.; Runyan, M. C.; Ruud, T. M.; Shariff, J. A.; Soler, J. D.; Song, X.; Trangsrud, A.; Tucker, C.; Tucker, R. S.; Turner, A. D.; List, J. F. Van Der; Weber, A. C.; Wehus, I. K.; Wiebe, D. V.; Young, E. Y.

    2017-08-01

    We present a new upper limit on CMB circular polarization from the 2015 flight of SPIDER, a balloon-borne telescope designed to search for $B$-mode linear polarization from cosmic inflation. Although the level of circular polarization in the CMB is predicted to be very small, experimental limits provide a valuable test of the underlying models. By exploiting the non-zero circular-to-linear polarization coupling of the HWP polarization modulators, data from SPIDER's 2015 Antarctic flight provides a constraint on Stokes $V$ at 95 and 150 GHz from $33<\\ell<307$. No other limits exist over this full range of angular scales, and SPIDER improves upon the previous limit by several orders of magnitude, providing 95% C.L. constraints on $\\ell (\\ell+1)C_{\\ell}^{VV}/(2\\pi)$ ranging from 141 $\\mu K ^2$ to 203 $\\mu K ^2$ at 150 GHz for a thermal CMB spectrum. As linear CMB polarization experiments become increasingly sensitive, the techniques described in this paper can be applied to obtain stronger constraints on circular polarization.

  13. Review of the Australian wolf spider genus Venator (Araneae, Lycosidae).

    Science.gov (United States)

    Framenau, Volker W

    2015-09-11

    Species of the Australian wolf spider genus Venator are reviewed including the type species, V. spenceri Hogg, 1900, from south-eastern Australia and V. immansuetus (Simon, 1909) comb. nov., a common species in south-west Western Australia. Venator marginatus Hogg, 1900 is only known from two female specimens and the genital morphology of this species does not conform to the diagnosis of genus as presented here. Therefore V. marginatus is considered incerta sedis. Venator includes medium-sized (9.0-22 mm body length) wolf spiders of overall brownish colouration, and with a black patch covering the anterior three quarters of the venter. They differ from all other wolf spiders in particular by genitalic characters, namely an elevated atrium of the female epigyne that forms a raised edged against the inverted T-shaped median septum. This edge often corresponds to a retrolateral incision on the tegular apophysis of the male pedipalp. The genus is mainly a representative of the Bassian fauna of the Australian continent where it occurs predominantly in dry sclerophyll forests.

  14. Optimal foraging, not biogenetic law, predicts spider orb web allometry.

    Science.gov (United States)

    Gregorič, Matjaž; Kiesbüy, Heine C; Lebrón, Shakira G Quiñones; Rozman, Alenka; Agnarsson, Ingi; Kuntner, Matjaž

    2013-03-01

    The biogenetic law posits that the ontogeny of an organism recapitulates the pattern of evolutionary changes. Morphological evidence has offered some support for, but also considerable evidence against, the hypothesis. However, biogenetic law in behavior remains underexplored. As physical manifestation of behavior, spider webs offer an interesting model for the study of ontogenetic behavioral changes. In orb-weaving spiders, web symmetry often gets distorted through ontogeny, and these changes have been interpreted to reflect the biogenetic law. Here, we test the biogenetic law hypothesis against the alternative, the optimal foraging hypothesis, by studying the allometry in Leucauge venusta orb webs. These webs range in inclination from vertical through tilted to horizontal; biogenetic law predicts that allometry relates to ontogenetic stage, whereas optimal foraging predicts that allometry relates to gravity. Specifically, pronounced asymmetry should only be seen in vertical webs under optimal foraging theory. We show that, through ontogeny, vertical webs in L. venusta become more asymmetrical in contrast to tilted and horizontal webs. Biogenetic law thus cannot explain L. venusta web allometry, but our results instead support optimization of foraging area in response to spider size.

  15. a Surprise from the Pulsar in the Crab Nebula

    Science.gov (United States)

    1995-11-01

    New observations of the spectrum of the rapidly spinning neutron star (the `pulsar') in the Crab Nebula have been carried out with the ESO 3.5-metre New Technology Telescope (NTT) by a group of Italian astronomers [1]. Because of greatly improved spectral resolution which allows to register even very fine details in the pulsar's spectrum, they are able to determine for the first time with high accuracy the overall dependance of the emission on wavelength, i.e. the `shape' of the spectrum. Quite unexpectedly, they also detect a hitherto unknown 100 A (10 nm) broad `absorption dip', which can be securely attributed to the pulsar. These results open an exciting new window for the study of the extreme physical processes close to a pulsar. The Nature of Pulsars It is estimated that there may be as many as 100 million neutron stars in our Galaxy. A neutron star is the superdense remnant of the extremely violent supernova explosion that occurs at the end of the life of a comparatively massive star. In fact, all stars that are more than about 6 times heavier than the Sun are believed to end their lives as supernovae. During the explosion, the central core of the dying star collapses in a few milliseconds and the matter at the centre is compressed to a density comparable to that of an atomic nucleus. Due to the enormous inward pressure, the atomic particles are squeezed together into a kind of neutron jam. The outcome is the formation of a neutron star with a diameter of 10-15 kilometres, weighing as much as the Sun. In accordance with the physical law that implies that the rotation momentum of the exploding star must be conserved, newborn neutron stars will rotate very rapidly around their axis, in some cases as fast as 100 times per second. In the same way, the new neutron star is expected to possess a strong magnetic field. Of these myriads of neutron stars, about 700 have been observed to emit radio pulses (hence the name `pulsar'). A few of these can also be detected

  16. Justifications shape ethical blind spots.

    Science.gov (United States)

    Pittarello, Andrea; Leib, Margarita; Gordon-Hecker, Tom; Shalvi, Shaul

    2015-06-01

    To some extent, unethical behavior results from people's limited attention to ethical considerations, which results in an ethical blind spot. Here, we focus on the role of ambiguity in shaping people's ethical blind spots, which in turn lead to their ethical failures. We suggest that in ambiguous settings, individuals' attention shifts toward tempting information, which determines the magnitude of their lies. Employing a novel ambiguous-dice paradigm, we asked participants to report the outcome of the die roll appearing closest to the location of a previously presented fixation cross on a computer screen; this outcome would determine their pay. We varied the value of the die second closest to the fixation cross to be either higher (i.e., tempting) or lower (i.e., not tempting) than the die closest to the fixation cross. Results of two experiments revealed that in ambiguous settings, people's incorrect responses were self-serving. Tracking participants' eye movements demonstrated that people's ethical blind spots are shaped by increased attention toward tempting information. © The Author(s) 2015.

  17. AFSC/RACE/SAP: Detailed Crab Data From NOAA Fisheries Service 2012 Chukchi Sea Bottom Trawl Surveys

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains detailed crab data collected from the 2012 NOAA/NMFS/AFSC/RACE crab-groundfish bottom trawl survey of the Chukchi Sea. 71 survey stations were...

  18. Differential predictive power of self report and implicit measures on behavioural and physiological fear responses to spiders

    NARCIS (Netherlands)

    van Bockstaele, B.; Verschuere, B.; Koster, E.H.W.; Tibboel, H.; de Houwer, J.; Crombez, G.

    2011-01-01

    In this study, we investigated to what extent indirect measures predict behavioural and physiological fear responses towards spiders. Implicit attitudes towards spiders were assessed using an implicit association test and attentional bias towards spiders was assessed using a dot probe task and a

  19. Spider-mediated flux of PCBs from contaminated sediments to terrestrial ecosystems and potential risks to arachnivorous birds

    Science.gov (United States)

    Walters, D.M.; Mills, M.A.; Fritz, K.M.; Raikow, D.F.

    2010-01-01

    We investigated aquatic insect utilization and PCB exposure in riparian spiders at the Lake Hartwell Superfund site (Clemson, SC). We sampled sediments, adult chironomids, terrestrial insects, riparian spiders (Tetragnathidae, Araneidae, and Mecynogea lemniscata), and upland spiders (Araneidae) along a sediment contamination gradient. Stable isotopes (?13C, ? 15N) indicated that riparian spiders primarily consumed aquatic insects whereas upland spiders consumed terrestrial insects. PCBs in chironomids (mean 1240 ng/g among sites) were 2 orders of magnitude higher than terrestrial insects (15.2 ng/g), similar to differences between riparian (820?2012 ng/g) and upland spiders (30 ng/g). Riparian spider PCBs were positively correlated with sediment concentrations for all taxa (r2 = 0.44?0.87). We calculated spider-based wildlife values (WVs, the minimum spider PCB concentrations causing physiologically significant doses in consumers) to assess exposure risks for arachnivorous birds. Spider concentrations exceeded WVs for most birds at heavily contaminated sites and were ?14-fold higher for the most sensitive species (chickadee nestlings, Poecile spp.). Spiders are abundant and ubiquitous in riparian habitats, where they depend on aquatic insect prey. These traits, along with the high degree of spatial correlation between spider and sediment concentrations we observed, suggest that they are model indicator species for monitoring contaminated sediment sites and assessing risks associated with contaminant flux into terrestrial ecosystems. ?? This article not subject to U.S. Copyright. Published 2009 by the American Chemical Society.

  20. An insect-feeding guild of carnivorous plants and spiders: does optimal foraging lead to competition or facilitation?

    Science.gov (United States)

    Crowley, Philip H; Hopper, Kevin R; Krupa, James J

    2013-12-01

    Carnivorous plants and spiders, along with their prey, are main players in an insect-feeding guild found on acidic, poorly drained soils in disturbed habitat. Darwin's notion that these plants must actively attract the insects they capture raises the possibility that spiders could benefit from proximity to prey hotspots created by the plants. Alternatively, carnivorous plants and spiders may deplete prey locally or (through insect redistribution) more widely, reducing each other's gain rates from predation. Here, we formulate and analyze a model of this guild, parameterized for carnivorous sundews and lycosid spiders, under assumptions of random movement by insects and optimal foraging by predators. Optimal foraging here involves gain maximization via trap investment (optimal web sizes and sundew trichome densities) and an ideal free distribution of spiders between areas with and without sundews. We find no facilitation: spiders and sundews engage in intense exploitation competition. Insect attraction by plants modestly increases sundew gain rates but slightly decreases spider gain rates. In the absence of population size structure, optimal spider redistribution between areas with and without sundews yields web sizes that are identical for all spiders, regardless of proximity to sundews. Web-building spiders have higher gain rates than wandering spiders in this system at high insect densities, but wandering spiders have the advantage at low insect densities. Results are complex, indicating that predictions to be tested empirically must be based on careful quantitative assessment.

  1. Resistance Spot Welding of dissimilar Steels

    Directory of Open Access Journals (Sweden)

    Ladislav Kolařík

    2012-01-01

    Full Text Available This paper presents an analysis of the properties of resistance spot welds between low carbon steel and austenitic CrNi stainless steel. The thickness of the welded dissimilar materials was 2 mm. A DeltaSpot welding gun with a process tape was used for welding the dissimilar steels. Resistance spot welds were produced with various welding parameters (welding currents ranging from 7 to 8 kA. Light microscopy, microhardness measurements across the welded joints, and EDX analysis were used to evaluate the quality of the resistance spot welds. The results confirm the applicability of DeltaSpot welding for this combination of materials.

  2. Acanthocephala Parasite (Profilicollis spp.) Loads in Correlation to Pacific Mole Crab (Emerita analoga) Size

    Science.gov (United States)

    Cheng, T.; Huang, S.; Galathe, M.; Jenkins, M.; Ramirez, A.; Crosby, L.; Barrera, J.; FitzHoward, S.

    2013-12-01

    Since 2002, San Francisco Bay students have been conducting marine ecosystem monitoring through a joint project with the Long-term Monitoring Program and Experiential Training for Students (LiMPETS), in conjunction with the Gulf of Farallones National Marine Sanctuary. Each year students collect population and demographic data on Pacific mole crabs (Emerita analoga), an indicator species that lives in the sandy beach habitat in temperate regions along the Pacific Ocean. Pacific mole crabs are filter feeding crustaceans that inhabit the intertidal swash zone and are known to be an intermediate host for parasitic ';spiny-headed' worms in the phylum Acanthocephala (Profilicollis spp.). Sampling takes place during their reproductive period, which occurs from spring to fall, and includes measuring total body length of the Pacific mole crabs and dissecting them to determine presence of Acanthocephalan parasites. We hypothesize that due to larger body mass, larger Pacific mole crabs will have a greater number of Acanthocephala parasites.We conducted several analyses using the LiMPETS long-term data. Specifically, we compared body length, crab gender, and parasite abundance from Pacific mole crabs sampled from four beaches located in the county and city of San Francisco. Our results indicated that larger Pacific mole crabs do not necessarily have more parasites, but are more likely to have at least one parasite, while female Pacific mole crabs carrying eggs, have more parasites than males or females without eggs. We also found that parasite loads per mole crab was highest in the spring. Further analysis will be conducted to determine factors affecting Pacific mole crab parasite loads. Studying Pacific mole crabs help evaluate the health of California's intertidal systems and how human activities, geologic changes, and climate changes all make huge impacts to the intertidal ecosystems.

  3. Crabbing system for an electron-ion collider

    Energy Technology Data Exchange (ETDEWEB)

    Castilla, Alejandro [Old Dominion Univ., Norfolk, VA (United States)

    2017-05-01

    As high energy and nuclear physicists continue to push further the boundaries of knowledge using colliders, there is an imperative need, not only to increase the colliding beams' energies, but also to improve the accuracy of the experiments, and to collect a large quantity of events with good statistical sensitivity. To achieve the latter, it is necessary to collect more data by increasing the rate at which these processes are being produced and detected in the machine. This rate of events depends directly on the machine's luminosity. The luminosity itself is proportional to the frequency at which the beams are being delivered, the number of particles in each beam, and inversely proportional to the cross-sectional size of the colliding beams. There are several approaches that can be considered to increase the events statistics in a collider other than increasing the luminosity, such as running the experiments for a longer time. However, this also elevates the operation expenses, while increasing the frequency at which the beams are delivered implies strong physical changes along the accelerator and the detectors. Therefore, it is preferred to increase the beam intensities and reduce the beams cross-sectional areas to achieve these higher luminosities. In the case where the goal is to push the limits, sometimes even beyond the machines design parameters, one must develop a detailed High Luminosity Scheme. Any high luminosity scheme on a modern collider considers|in one of their versions|the use of crab cavities to correct the geometrical reduction of the luminosity due to the beams crossing angle. In this dissertation, we present the design and testing of a proof-of-principle compact superconducting crab cavity, at 750 MHz, for the future electron-ion collider, currently under design at Jefferson Lab. In addition to the design and validation of the cavity prototype, we present the analysis of the first order beam dynamics and the integration of the

  4. From repulsion to attraction: species- and spatial context-dependent threat sensitive response of the spider mite Tetranychus urticae to predatory mite cues

    Science.gov (United States)

    Fernández Ferrari, M. Celeste; Schausberger, Peter

    2013-06-01

    Prey perceiving predation risk commonly change their behavior to avoid predation. However, antipredator strategies are costly. Therefore, according to the threat-sensitive predator avoidance hypothesis, prey should match the intensity of their antipredator behaviors to the degree of threat, which may depend on the predator species and the spatial context. We assessed threat sensitivity of the two-spotted spider mite, Tetranychus urticae, to the cues of three predatory mites, Phytoseiulus persimilis, Neoseiulus californicus, and Amblyseius andersoni, posing different degrees of risk in two spatial contexts. We first conducted a no-choice test measuring oviposition and activity of T. urticae exposed to chemical traces of predators or traces plus predator eggs. Then, we tested the site preference of T. urticae in choice tests, using artificial cages and leaves. In the no-choice test, T. urticae deposited their first egg later in the presence of cues of P. persimilis than of the other two predators and cue absence, indicating interspecific threat-sensitivity. T. urticae laid also fewer eggs in the presence of cues of P. persimilis and A. andersoni than of N. californicus and cue absence. In the artificial cage test, the spider mites preferred the site with predator traces, whereas in the leaf test, they preferentially resided on leaves without traces. We argue that in a nonplant environment, chemical predator traces do not indicate a risk for T. urticae, and instead, these traces function as indirect habitat cues. The spider mites were attracted to these cues because they associated them with the existence of a nearby host plant.

  5. Untangling spider silk evolution with spidroin terminal domains

    Directory of Open Access Journals (Sweden)

    Garb Jessica E

    2010-08-01

    Full Text Available Abstract Background Spidroins are a unique family of large, structural proteins that make up the bulk of spider silk fibers. Due to the highly variable nature of their repetitive sequences, spidroin evolutionary relationships have principally been determined from their non-repetitive carboxy (C-terminal domains, though they offer limited character data. The few known spidroin amino (N-terminal domains have been difficult to obtain, but potentially contain critical phylogenetic information for reconstructing the diversification of spider silks. Here we used silk gland expression data (ESTs from highly divergent species to evaluate the functional significance and phylogenetic utility of spidroin N-terminal domains. Results We report 11 additional spidroin N-termini found by sequencing ~1,900 silk gland cDNAs from nine spider species that shared a common ancestor > 240 million years ago. In contrast to their hyper-variable repetitive regions, spidroin N-terminal domains have retained striking similarities in sequence identity, predicted secondary structure, and hydrophobicity. Through separate and combined phylogenetic analyses of N-terminal domains and their corresponding C-termini, we find that combined analysis produces the most resolved trees and that N-termini contribute more support and less conflict than the C-termini. These analyses show that paralogs largely group by silk gland type, except for the major ampullate spidroins. Moreover, spidroin structural motifs associated with superior tensile strength arose early in the history of this gene family, whereas a motif conferring greater extensibility convergently evolved in two distantly related paralogs. Conclusions A non-repetitive N-terminal domain appears to be a universal attribute of spidroin proteins, likely retained from the origin of spider silk production. Since this time, spidroin N-termini have maintained several features, consistent with this domain playing a key role in silk

  6. The spider Harpactea sadistica: co-evolution of traumatic insemination and complex female genital morphology in spiders

    Science.gov (United States)

    Řezáč, Milan

    2009-01-01

    The males of invertebrates from a few phyla, including arthropods, have been reported to practise traumatic insemination (TI; i.e. injecting sperm by using the copulatory organ to penetrate the female's body wall). As all previously reported arthropod examples have been insects, there is considerable interest in whether TI might have evolved independently in other arthropods. The research reported here demonstrates the first case of TI in the arthropod subphylum Chelicerata, in particular how the genital morphology and mating behaviour of Harpactea sadistica (Řezáč 2008), a spider from Israel, has become adapted specifically for reproduction based on TI. Males have needle-like intromittent organs and females have atrophied spermathecae. In other spiders, eggs are fertilized simultaneously with oviposition, but the eggs of H. sadistica are fertilized in the ovaries (internal fertilization) and develop as embryos before being laid. Sperm-storage organs of phylogenetically basal groups to H. sadistica provide males with last male sperm priority and allow removal of sperm by males that mate later, suggesting that TI might have evolved as an adaptive strategy to circumvent an unfavourable structure of the sperm-storage organs, allowing the first male to mate with paternity advantage. Understanding the functional significance of TI gives us insight into factors underlying the evolution of the genital and sperm-storage morphology in spiders. PMID:19403531

  7. Vibration transmission through sheet webs of hobo spiders (Eratigena agrestis) and tangle webs of western black widow spiders (Latrodectus hesperus).

    Science.gov (United States)

    Vibert, Samantha; Scott, Catherine; Gries, Gerhard

    2016-11-01

    Web-building spiders construct their own vibratory signaling environments. Web architecture should affect signal design, and vice versa, such that vibratory signals are transmitted with a minimum of attenuation and degradation. However, the web is the medium through which a spider senses both vibratory signals from courting males and cues produced by captured prey. Moreover, webs function not only in vibration transmission, but also in defense from predators and the elements. These multiple functions may impose conflicting selection pressures on web design. We investigated vibration transmission efficiency and accuracy through two web types with contrasting architectures: sheet webs of Eratigena agrestis (Agelenidae) and tangle webs of Latrodectus hesperus (Theridiidae). We measured vibration transmission efficiencies by playing frequency sweeps through webs with a piezoelectric vibrator and a loudspeaker, recording the resulting web vibrations at several locations on each web using a laser Doppler vibrometer. Transmission efficiencies through both web types were highly variable, with within-web variation greater than among-web variation. There was little difference in transmission efficiencies of longitudinal and transverse vibrations. The inconsistent transmission of specific frequencies through webs suggests that parameters other than frequency are most important in allowing these spiders to distinguish between vibrations of prey and courting males.

  8. ESA uncovers Geminga's `hot spot'

    Science.gov (United States)

    2004-07-01

    16 July 2004 Astronomers using ESA’s X-ray observatory XMM-Newton have detected a small, bright ‘hot spot’ on the surface of the neutron star called Geminga, 500 light-years away. The hot spot is the size of a football field and is caused by the same mechanism producing Geminga’s X-ray tails. This discovery identifies the missing link between the X-ray and gamma-ray emission from Geminga. hi-res Size hi-res: 1284 kb Credits: ESA, P. Caraveo (IASF, Milan) Geminga's hot spot This figure shows the effects of charged particles accelerated in the magnetosphere of Geminga. Panel (a) shows an image taken with the EPIC instrument on board the XMM-Newton observatory. The bright tails, made of particles kicked out by Geminga’s strong magnetic field, trail the neutron star as it moves about in space. Panel (b) shows how electrically charged particles interact with Geminga’s magnetic field. For example, if electrons (blue) are kicked out by the star, positrons (in red) hit the star’s magnetic poles like in an ‘own goal’. Panel (c) illustrates the size of Geminga’s magnetic field (blue) compared to that of the star itself at the centre (purple). The magnetic field is tilted with respect to Geminga’s rotation axis (red). Panel (d) shows the magnetic poles of Geminga, where charged particles hit the surface of the star, creating a two-million degrees hot spot, a region much hotter than the surroundings. As the star spins on its rotation axis, the hot spot comes into view and then disappears, causing the periodic colour change seen by XMM-Newton. An animated version of the entire sequence can be found at: Click here for animated GIF [low resolution, animated GIF, 5536 KB] Click here for AVI [high resolution, AVI with DIVX compression, 19128 KB] hi-res Size hi-res: 371 kb Credits: ESA, P. Caraveo (IASF, Milan) Geminga's hot spot, panel (a) Panel (a) shows an image taken with the EPIC instrument on board the XMM-Newton observatory. The bright tails, made of

  9. High-toughness silk produced by a transgenic silkworm expressing spider (Araneus ventricosus dragline silk protein.

    Directory of Open Access Journals (Sweden)

    Yoshihiko Kuwana

    Full Text Available Spider dragline silk is a natural fiber that has excellent tensile properties; however, it is difficult to produce artificially as a long, strong fiber. Here, the spider (Araneus ventricosus dragline protein gene was cloned and a transgenic silkworm was generated, that expressed the fusion protein of the fibroin heavy chain and spider dragline protein in cocoon silk. The spider silk protein content ranged from 0.37 to 0.61% w/w (1.4-2.4 mol% native silkworm fibroin. Using a good silk-producing strain, C515, as the transgenic silkworm can make the raw silk from its cocoons for the first time. The tensile characteristics (toughness of the raw silk improved by 53% after the introduction of spider dragline silk protein; the improvement depended on the quantity of the expressed spider dragline protein. To demonstrate the commercial feasibility for machine reeling, weaving, and sewing, we used the transgenic spider silk to weave a vest and scarf; this was the first application of spider silk fibers from transgenic silkworms.

  10. Biased interpretation and memory in children with varying levels of spider fear

    NARCIS (Netherlands)

    Klein, A.M.; Titulaer, G.; Simons, C.; Allart, E.; de Gier, E.; Bögels, S.M.; Becker, E.S.; Rinck, M.

    2014-01-01

    This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent

  11. In Vitro Evaluation of Spider Silk Meshes as a Potential Biomaterial for Bladder Reconstruction

    NARCIS (Netherlands)

    Steins, A.; Dik, P.; Müller, W.H.; Vervoort, S.J.; Reimers, K.; Kubhier, J.W.; Vogt, P.M.; van Apeldoorn, Aart A.; Coffer, P.J.; Schepers, K.

    2015-01-01

    Reconstruction of the bladder by means of both natural and synthetic materials remains a challenge due to severe adverse effects such as mechanical failure. Here we investigate the application of spider major ampullate gland-derived dragline silk from the Nephila edulis spider, a natural biomaterial

  12. Photoluminescent properties of spider silk coated with Eu-doped nanoceria

    Energy Technology Data Exchange (ETDEWEB)

    Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

    2017-02-15

    Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

  13. High School Students' Attitudes Towards Spiders: A cross-cultural comparison

    Science.gov (United States)

    Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

    2010-08-01

    Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

  14. Methods of assembling and disassembling spider and burnable poison rod structures for nuclear reactors

    International Nuclear Information System (INIS)

    Walton, L.A.

    1981-01-01

    A method is described of joining burnable poison rods to the spider arms of a pressurised water power reactor fuel assembly which is proof against the reactor core environment but permits these rods to be removed from the spider simply, swiftly and delicately. (U.K.)

  15. Parasitization of a huntsman spider (Arachnida: Araneae: Sparassidae: Heteropoda venatoria by a mermithid nematode (Nematoda: Mermithidae

    Directory of Open Access Journals (Sweden)

    Sachin P. Ranade

    2016-11-01

    Full Text Available The emergence of a mermithid worm from a huntsman spider Heteropoda venatoria was witnessed at Buxa Tiger Reserve, West Bengal.  It appears to be a first record of the spider family Sparassidae serving as a host for a member of the family Mermithidae. 

  16. Contamination vs. harm-relevant outcome expectancies and covariation bias in spider phobia

    NARCIS (Netherlands)

    de Jong, Peter J.; Peters, Madelon L.

    There is increasing evidence that spiders are not feared because of harmful outcome expectancies but because of disgust and contamination-relevant outcome expectancies. This study investigated the relative strength of contamination- and harm-relevant UCS expectancies and covariation bias in spider

  17. Differences among plant species in acceptance by the spider mite Tetranychus urticae Koch

    NARCIS (Netherlands)

    Boom, van den C.E.M.; Beek, van T.A.; Dicke, M.

    2003-01-01

    The spider mite Tetranychus urticae Koch has a broad range of host plants. However, the spider mite does not accept all plants to the same degree because of differences in nutritive and toxic constituents. Other factors, such as the induction of secondary metabolites, the morphology of a leaf

  18. fMRI neurofeedback facilitates anxiety regulation in females with spider phobia

    NARCIS (Netherlands)

    Zilverstand, Anna; Sorger, Bettina; Sarkheil, Pegah; Goebel, R.

    2015-01-01

    BACKGROUND: Spider phobics show an exaggerated fear response when encountering spiders. This fear response is aggravated by negative and irrational beliefs about the feared object. Cognitive reappraisal can target these beliefs, and therefore has a fear regulating effect. The presented study

  19. The spider anxiety and disgust screening for children: Reliability and validity of a screening for children

    NARCIS (Netherlands)

    Klein, A.M.; Niekerk, R.E. van; Baartmans, J.M.D.; Rinck, M.; Becker, E.S.

    2017-01-01

    Objectives: Specific fears, such as fear of spiders, are often used as a model for studying the development of other fears because several studies suggest that the underlying processes of fear are similar. For the screening of spider fear in children, a good, fast, and reliable screening instrument

  20. Utility Assessment Report for SPIDERS Phase 2: Ft. Carson (Rev 1.0)

    Energy Technology Data Exchange (ETDEWEB)

    Barr, Jonathan L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tuffner, Francis K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hadley, Mark D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Schneider, Kevin P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2014-01-01

    This document contains the Utility Assessment Report (UAR) for the Phase 2 operational Demonstration (OD) of the Smart Power Infrastructure Demonstration for Energy Reliability and Security (SPIDERS) Joint Capability Technology Demonstration (JCTD). The UAR for Phase 2 shows that the SPIDERS system was able to meet the requirements of the Implementation Directive at Ft. Carson.

  1. Postharvest fumigation of California table grapes with ozone to control Western black widow spider (Araneae: Theridiidae)

    Science.gov (United States)

    Ozone fumigations were evaluated for postharvest control of Western black widow spider (BWS), Latrodectus hesperus (Chamberlin and Ivie), in fresh table grapes destined for export from California USA. Mature adult female black widow spiders were contained in separate gas-permeable cages within a flo...

  2. Species status and conservation issues of New Zealand's endemic Latrodectus spider species (Araneae: Theridiidae)

    DEFF Research Database (Denmark)

    Vink, Cor J; Sirvid, Phillip J; Malumbres-Olarte, Jagoba

    2008-01-01

    New Zealand has two endemic widow spiders, Latrodectus katipo Powell, 1871 and L. atritus Urquhart, 1890. Both species face many conservation threats and are actively managed. The species status of the Latrodectus spiders of New Zealand was assessed using molecular (COI, ITS1, ITS2) and morpholog...

  3. Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

    Science.gov (United States)

    Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

    2013-12-30

    Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

  4. Species richness and composition assessment of spiders in a Mediterranean scrubland

    DEFF Research Database (Denmark)

    Bondoso Cardoso, Pedro Miguel; Henriques, Sérgio S.; Gaspar, Clara

    2009-01-01

    Intensive fieldwork has been undertaken in Portugal in order to develop a standardized and optimized sampling protocol for Mediterranean spiders. The present study had the objectives of testing the use of semi-quantitative sampling for obtaining an exhaustive species richness assessment of spider...

  5. Web orientation and prey resources for web-building spiders in eastern hemlock.

    Science.gov (United States)

    Mallis, Rachael E; Rieske, Lynne K

    2010-10-01

    We examined the arthropod community on eastern hemlock, Tsuga canadensis (L.) Carr, in the context of its role in providing potential prey items for hemlock-associated web-weaving spiders. Using sticky traps simulating spider webs, we evaluated what prey items are available to web-weaving spiders in eastern hemlock based on web orientation (horizontal versus vertical) and cardinal direction. We found that the overwhelming majority (>70%) of prey items available to spiders in hemlock canopies were Diptera. Psocoptera, Hymenoptera, and Hemiptera comprised most of the remaining potential prey. A significant direction × orientation interaction, and greater trap capture in some direction-orientation combinations, suggests that spiders might locate their webs in eastern hemlock canopies for thermoregulatory purposes, ultimately optimizing prey capture. We also evaluated these findings in the context of hemlock infestation by the invasive hemlock woolly adelgid, Adelges tsugae Annand. The adelgid is a sedentary insect with a mobile crawler stage that provides a readily available, easily obtained food source for predators in hemlock canopies. However, an abundance of alternative prey will affect within canopy spider distribution and the potential intensity with which spiders consume these prey. Understanding the response of spiders to potential prey availability is essential to understanding the trophic interactions involving these predators and their potential for influencing herbivore populations.

  6. Red-back spider (Latrodectus mactans hasselti) envenomation in a neonate.

    Science.gov (United States)

    Byrne, G C; Pemberton, P J

    A case of red-back spider (Latrodectus mactans hasselti) envenomation in a neonate is presented. The signs of envenomation in a neonate are discussed, together with the dose of antivenom necessary for the successful treatment of envenomation. In episodes of untractable crying in neonates, the possibility that the baby has been bitten by a red-back spider should be considered.

  7. The path to the nest of spiders The path to the nest of spiders

    Directory of Open Access Journals (Sweden)

    Eliane Luz Bayer

    2008-04-01

    Full Text Available Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell. He tells us that this is a story in which iobody is a hero and nobody has the class consciousness necessary to unify them in the struggle. Calvino acknowledges that it was difficult to conciliate his experiences with the postwar literary movement which he calls Neo-expresSionism, a term which, he thinks, describes better Italian Neo-realism. This is a book with a full realistic depictior of the incongruousness of the whole situation, showing rumen beings driven by loneliness, aggressiveness, unfulfilment and failure to meet, their nerves frayed by the War. It reveals human beings in their weaknesses, subjected to deterministic fates changing roles according to circumstance. Partisans shift to the Nazi side and inform on their f rmer allies and vice-versa, being later chased in revenge. The novel has as its setting Italy under Fascism and unde German occupation, the Italian people being divided betw en the fascists of the "Black Brigade" and the "Partisa4s" who belonged to the Resistance. Although this is a pOlitical book, it has universal appeal. At the same time that it livens up historical facts about the period, it moves our feelings. Calvino's book is about World War II as it is viewed and felt by a small outcast, Pin, who makes considerable efforts to be accepted and understood by adults. In his daily life Pinsuffers the consequences Of the war. His aggressive disposition reflects the environment which he has been brought up in: since he was born, his country has been at war. Besides that, his only sister is a whore, whom he hates and despises. Italo Calvino writes in his preface to The Path to the Nest of Spiders that the novel answers to the "ripeness of the time" since ht wrote it after wartime, a period when everyone had a tale to tell

  8. The time course of location-avoidance learning in fear of spiders.

    Science.gov (United States)

    Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

    2016-01-01

    Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

  9. Proximate mechanism of behavioral manipulation of an orb-weaver spider host by a parasitoid wasp.

    Directory of Open Access Journals (Sweden)

    Thiago Gechel Kloss

    Full Text Available Some ichneumonid wasps induce modifications in the web building behavior of their spider hosts to produce resistant "cocoon" webs. These structures hold and protect the wasp's cocoon during pupa development. The mechanism responsible for host manipulation probably involves the inoculation of psychotropic chemicals by the parasitoid larva during a specific developmental period. Recent studies indicate that some spiders build cocoon webs similar to those normally built immediately before ecdysis, suggesting that this substance might be a molting hormone or a precursor chemical of this hormone. Here, we report that Cyclosa spider species exhibiting modified behavior presented higher 20-OH-ecdysone levels than parasitized spiders acting normally or unparasitized individuals. We suggest that the lack of control that spiders have when constructing modified webs can be triggered by anachronic activation of ecdysis.

  10. Community structure of spiders in coastal habitats of a Mediterranean delta region (Nestos Delta, NE Greece

    Directory of Open Access Journals (Sweden)

    S. Buchholz

    2009-01-01

    Full Text Available (pp 101-115Habitat zonation and ecology of spider assemblages have been poorly studied in Mediterranean ecosystems. A first analysis of spider assemblages in coastal habitats in the east Mediterranean area is presented. The study area is the 250 km² Nestos Delta, located in East Macedonia in the North-East of Greece. Spiders were caught in pitfall traps at 17 sites from the beginning of April to the end of June 2004. Nonparametric estimators were used to determine species richness and alpha diversity. Ordination analysis (redundancy analysis indicated four clearly separable spider species groups (salt meadows, dunes, mea-dows and floodplain forests, along a soil salinity and moisture gradient. Based on these results we discuss the habitat preferences of these spiders and include the first ecological data on several species.

  11. Association of spiders and lichen on Robben Island, South Africa: a case report

    Directory of Open Access Journals (Sweden)

    A. Mukherjee

    2010-04-01

    Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

  12. Associations between dioxins/furans and dioxin-like PCBs in estuarine sediment and blue crab

    Science.gov (United States)

    Liebens, J.; Mohrherr, C.J.; Karouna-Renier, N. K.; Snyder, R.A.; Rao, K.R.

    2011-01-01

    The objective of the present study was to evaluate the relationships between the quantity, toxicity, and compositional profile of dioxin/furan compounds (PCDD/Fs) and dioxin-like polychlorinated biphenyls (DL-PCBs) in estuarine sediment and in the blue crab (Callinectes sapidus). Sediment and blue crab samples were collected in three small urban estuaries that are in relatively close proximity to each other. Results show that differences between PCDD/F and DL-PCB mass concentrations and total toxic equivalents (TEQ) toxicity in sediments of the three estuaries are reflected in those of the blue crab. TEQs are higher in the hepatopancreas of the crabs than in the sediment, but the concentration factor is inversely proportional to the TEQ in the sediments. Congener profiles in the crabs are systematically different from those in the sediments, and the difference is more pronounced for PCDD/Fs than for DL-PCBs, possibly due to differences in metabolization rates. Compared with sediment profiles, more lesser-chlorinated PCDD/Fs that have higher TEFs accumulate in crab hepatopancreas. This selective bioaccumulation of PCDD/Fs results in a TEQ augmentation in crab hepatopancreas compared with sediments. The bioaccumulation in the blue crab is also selective for PCDD/Fs over DL-PCBs. ?? 2011 Springer Science+Business Media B.V.

  13. Ex-vivo evaluation of crab shell chitosan as absorption enhancer in ...

    African Journals Online (AJOL)

    This study was aimed at evaluating crab shell chitosan as absorption enhancer in ciprofloxacin tablet formulation using the ex-vivo model. Six batches of ciprofloxacin tablets containing varying concentrations of crab shell-derived chitosan ranging from 0 to 5% w/w at 1% w/w intervals were produced. Batch CTS-0 ...

  14. Giant Robber Crabs Monitored from Space: GPS-Based Telemetric Studies on Christmas Island (Indian Ocean)

    Science.gov (United States)

    Krieger, Jakob; Grandy, Ronald; Drew, Michelle M.; Erland, Susanne; Stensmyr, Marcus C.; Harzsch, Steffen; Hansson, Bill S.

    2012-01-01

    We investigated the navigational capabilities of the world's largest land-living arthropod, the giant robber crab Birgus latro (Anomura, Coenobitidae); this crab reaches 4 kg in weight and can reach an age of up to 60 years. Populations are distributed over small Indo-Pacific islands of the tropics, including Christmas Island (Indian Ocean). Although this species has served as a crustacean model to explore anatomical, physiological, and ecological aspects of terrestrial adaptations, few behavioral analyses of it exist. We used a GPS-based telemetric system to analyze movements of freely roaming robber crabs, the first large-scale study of any arthropod using GPS technology to monitor behavior. Although female robber crabs are known to migrate to the coast for breeding, no such observations have been recorded for male animals. In total, we equipped 55 male robber crabs with GPS tags, successfully recording more than 1,500 crab days of activity, and followed some individual animals for as long as three months. Besides site fidelity with short-distance excursions, our data reveal long-distance movements (several kilometers) between the coast and the inland rainforest. These movements are likely related to mating, saltwater drinking and foraging. The tracking patterns indicate that crabs form route memories. Furthermore, translocation experiments show that robber crabs are capable of homing over large distances. We discuss if the search behavior induced in these experiments suggests path integration as another important navigation strategy. PMID:23166774

  15. Dioxins, PCBs and heavy metals in Chinese mitten crabs from Dutch rivers and lakes.

    Science.gov (United States)

    Hoogenboom, Ron L A P; Kotterman, Michiel J J; Hoek-van Nieuwenhuizen, Marion; van der Lee, Martijn K; Mennes, Wim C; Jeurissen, Suzanne M F; van Leeuwen, Stefan P J

    2015-03-01

    Chinese mitten crab is an invasive species in many European rivers and lakes. Data from the UK indicated high levels of dioxins and PCBs, in particular in the brown meat in the body. This was confirmed by studies in the Netherlands, showing average levels of dioxins and PCBs in the meat in the body of 43 pg TEQ g(-1) ww in crabs caught in the large rivers. Levels in crab of lakes in the Northern part of the Netherlands were on average 3.7-fold lower. Consumption of crabs from polluted areas results in a relatively high dose of dioxins and dl-PCBs and could significantly increase the intake above the TWI. However, in general consumption of these crabs is low, even in the Asian sub-population in the Netherlands. Cadmium and lead levels were higher in crabs from contaminated areas, but for mercury and arsenic there was no clear difference. Consumption of crabs would not result in significant risks for cadmium and mercury. For lead the daily intake could be raised above the BMDL01 for neurodevelopmental toxicity, but this would only occur on a limited number of days. For arsenic the exposure would exceed the lower end of the BMDL01 values for certain cancers, but again, the infrequent consumption by most consumers reduces this risk. Furthermore, speciation showed that most arsenic in crabs was probably not a toxic inorganic form, but likely to be in an organic form. Copyright © 2014 Elsevier Ltd. All rights reserved.

  16. Dungeness crab survey for the Southwest Ocean Disposal Site off Grays Harbor, Washington, June 1990

    Energy Technology Data Exchange (ETDEWEB)

    Higgins, B.J.; Pearson, W.H. (Battelle/Marine Sciences Lab., Sequim, WA (United States))

    1991-09-01

    As part of the Grays Harbor Navigation Improvement Project, the Seattle District of the US Army Corps of Engineers has begun active use of the Southwest Ocean Disposal Site off Grays Harbor, Washington. This survey was to verify that the location of the area of high crab density observed during site selection surveys has not shifted into the Southeast Ocean Disposal Site. In June 1990, mean densities of juvenile Dungeness crab were 146 crab/ha within the disposal site and 609 crab/ha outside ad north of the disposal site. At nearshore locations outside the disposal site, juvenile crab density was 3275 crab/ha. Despite the low overall abundance, the spatial distribution of crab was such that the high crab densities in 1990 have remained outside the Southwest Ocean Disposal Site. The survey data have confirmed the appropriateness of the initial selection of the disposal site boundaries and indicated no need to move to the second monitoring tier. 8 refs., 9 figs., 2 tabs.

  17. A new marine triclad ectoparasitic on Malaysian and Indonesian horseshoe crabs (Platyhelminthes, Turbellaria, Tricladida)

    NARCIS (Netherlands)

    Sluys, Ronald

    1983-01-01

    A new species of marine triclad, Ectoplana undata n. sp., ectoparasitic on the horseshoe crab Tachypleus gigas, is described. Cocoons of triclads were found on T. gigas as well as on the horseshoe crab Carcinoscorpius rotundicauda; since from the latter species no triclads were collected, it remains

  18. 50 CFR Table 1 to Part 680 - Crab Rationalization (CR) Fisheries

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Crab Rationalization (CR) Fisheries 1 Table 1 to Part 680 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... ZONE OFF ALASKA Pt. 680, Table 1 Table 1 to Part 680—Crab Rationalization (CR) Fisheries Fishery Code...

  19. Deep phylogeographic structuring of populations of the trapdoor spider Moggridgea tingle (Migidae) from southwestern Australia: evidence for long-term refugia within refugia.

    Science.gov (United States)

    Cooper, Steven J B; Harvey, Mark S; Saint, Kathleen M; Main, Barbara Y

    2011-08-01

    Southwestern Australia has been recognized as a biodiversity hot spot of global significance, and it is particularly well known for its considerable diversity of flowering plant species. Questions of interest are how this region became so diverse and whether its fauna show similar diverse patterns of speciation. Here, we carried out a phylogeographic study of trapdoor spiders (Migidae: Moggridgea), a presumed Gondwanan lineage found in wet forest localities across southwestern Australia. Phylogenetic, molecular clock and population genetic analyses of mitochondrial (mtDNA) COI gene and ITS rRNA (internal transcribed spacer) data revealed considerable phylogeographic structuring of Moggridgea populations, with evidence for long-term (>3 million years) isolation of at least nine populations in different geographic locations, including upland regions of the Stirling and Porongurup Ranges. High levels of mtDNA divergence and no evidence of recent mitochondrial gene flow among valley populations of the Stirling Range suggest that individual valleys have acted as refugia for the spiders throughout the Pleistocene. Our findings support the hypothesis that climate change, particularly the aridification of Australia after the late Miocene, and the topography of the landscape, which allowed persistence of moist habitats, have been major drivers of speciation in southwestern Australia. © 2011 Blackwell Publishing Ltd.

  20. Watermarking spot colors in packaging

    Science.gov (United States)

    Reed, Alastair; Filler, TomáÅ.¡; Falkenstern, Kristyn; Bai, Yang

    2015-03-01

    In January 2014, Digimarc announced Digimarc® Barcode for the packaging industry to improve the check-out efficiency and customer experience for retailers. Digimarc Barcode is a machine readable code that carries the same information as a traditional Universal Product Code (UPC) and is introduced by adding a robust digital watermark to the package design. It is imperceptible to the human eye but can be read by a modern barcode scanner at the Point of Sale (POS) station. Compared to a traditional linear barcode, Digimarc Barcode covers the whole package with minimal impact on the graphic design. This significantly improves the Items per Minute (IPM) metric, which retailers use to track the checkout efficiency since it closely relates to their profitability. Increasing IPM by a few percent could lead to potential savings of millions of dollars for retailers, giving them a strong incentive to add the Digimarc Barcode to their packages. Testing performed by Digimarc showed increases in IPM of at least 33% using the Digimarc Barcode, compared to using a traditional barcode. A method of watermarking print ready image data used in the commercial packaging industry is described. A significant proportion of packages are printed using spot colors, therefore spot colors needs to be supported by an embedder for Digimarc Barcode. Digimarc Barcode supports the PANTONE spot color system, which is commonly used in the packaging industry. The Digimarc Barcode embedder allows a user to insert the UPC code in an image while minimizing perceptibility to the Human Visual System (HVS). The Digimarc Barcode is inserted in the printing ink domain, using an Adobe Photoshop plug-in as the last step before printing. Since Photoshop is an industry standard widely used by pre-press shops in the packaging industry, a Digimarc Barcode can be easily inserted and proofed.