Positron Annihilation Ratio Spectroscopy Study of Electric Fields Applied to Positronium at Material Interfaces

Science.gov (United States)

2011-03-01

from 142 ns to a few ns [3:3]. Through the application of positron annihilation lifetime spectroscopy (PALS) on a material, the o-Ps lifetime can be...Force Base, Ohio APPROVED FOR PUBLIC RELEASE; DISTRIBUTION UNLIMITED. POSITRON ANNIHILATION RATIO SPECTROSCOPY STUDY OF ELECTRIC FIELDS APPLIED TO...protection in the United States. AFIT/GNE/ENP/11-M19 POSITRON ANNIHILATION RATIO SPECTROSCOPY STUDY OF ELECTRIC FIELDS APPLIED TO POSITRONIUM AT

Advances in Molecular Rotational Spectroscopy for Applied Science

Science.gov (United States)

Harris, Brent; Fields, Shelby S.; Pulliam, Robin; Muckle, Matt; Neill, Justin L.

2017-06-01

Advances in chemical sensitivity and robust, solid-state designs for microwave/millimeter-wave instrumentation compel the expansion of molecular rotational spectroscopy as research tool into applied science. It is familiar to consider molecular rotational spectroscopy for air analysis. Those techniques for molecular rotational spectroscopy are included in our presentation of a more broad application space for materials analysis using Fourier Transform Molecular Rotational Resonance (FT-MRR) spectrometers. There are potentially transformative advantages for direct gas analysis of complex mixtures, determination of unknown evolved gases with parts per trillion detection limits in solid materials, and unambiguous chiral determination. The introduction of FT-MRR as an alternative detection principle for analytical chemistry has created a ripe research space for the development of new analytical methods and sampling equipment to fully enable FT-MRR. We present the current state of purpose-built FT-MRR instrumentation and the latest application measurements that make use of new sampling methods.

Preparation and Characteristics of Corn Straw-Co-AMPS-Co-AA Superabsorbent Hydrogel

Directory of Open Access Journals (Sweden)

Wei-Min Cheng

2015-11-01

Full Text Available In this study, the corn straw after removing the lignin was grafted with 2-acrylamido-2-methylpropanesulfonic acid (AMPS to prepare sulfonated cellulose. The grafting copolymerization between the sulfonated cellulose and acrylic acid (AA was performed using potassium persulfate and N,N′-methylenebisacrylamide as the initiator and crosslinking agent, respectively, to prepare corn straw-co-AMPS-co-AA hydrogels. The structure and properties of the resulting hydrogels were characterized by Fourier transform infrared spectroscopy, X-ray diffraction, scanning electron microscopy, thermogravimetric analysis, and dynamic rheometry. The effects of initiator, crosslinker, monomer neutralization degree, and temperature on the swelling ratio of the hydrogels were studied. The water retention, salt resistance, and recyclability of the corn straw-co-AMPS-co-AA hydrogels were also investigated. The optimum water absorptivity of the corn straw hydrogels was obtained at a polymerization temperature of 50 °C with 1.2% crosslinker, 1:7 ratio of the pretreated corn straw and AA, 2% initiator, and 50% neutralized AA.

Terahertz spectroscopy applied to food model systems

DEFF Research Database (Denmark)

Møller, Uffe

Water plays a crucial role in the quality of food. Apart from the natural water content of a food product, the state of that water is very important. Water can be found integrated into the biological material or it can be added during production of the product. Currently it is difficult...... to differentiate between these types of water in subsequent quality controls. This thesis describes terahertz time-domain spectroscopy applied on aqueous food model systems, with particular focus on ethanol-water mixtures and confined water pools in inverse micelles....

HST/STIS ULTRAVIOLET SPECTROSCOPY OF THE COMPONENTS OF THE MASSIVE TRIPLE STAR δ ORI A

Energy Technology Data Exchange (ETDEWEB)

Richardson, Noel D.; Moffat, Anthony F. J. [Département de physique and Centre de Recherche en Astrophysique du Québec (CRAQ), Université de Montréal, C.P. 6128, Succ. Centre-Ville, Montréal, Québec, H3C 3J7 (Canada); Gull, Theodore R.; Lindler, Don J. [Astrophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Gies, Douglas R. [Center for High Angular Resolution Astronomy and Department of Physics and Astronomy, Georgia State University, P.O. Box 5060, Atlanta, GA 30302-5060 (United States); Corcoran, Michael F. [CRESST and X-ray Astrophysics Laboratory NASA/GSFC, Greenbelt, MD 20771 (United States); Chené, André-Nicolas, E-mail: richardson@astro.umontreal.ca, E-mail: moffat@astro.umontreal.ca, E-mail: theodore.r.gull@nasa.gov, E-mail: don.j.lindler@nasa.gov, E-mail: gies@chara.gsu.edu, E-mail: michael.f.corcoran@nasa.gov, E-mail: achene@gemini.edu [Gemini Observatory, Northern Operations Center, 670 North A’ohoku Place, Hilo, HI 96720 (United States)

2015-07-20

The multiple star system of δ Orionis is one of the closest examples of a system containing a luminous O-type, bright giant star (component Aa1). It is often used as a spectral-type standard and has the highest observed X-ray flux of any hot-star binary. The main component Aa1 is orbited by two lower mass stars, faint Aa2 in a 5.7 day eclipsing binary, and Ab, an astrometric companion with an estimated period of 346 years. Generally the flux from all three stars is recorded in ground-based spectroscopy, and the spectral decomposition of the components has proved difficult. Here we present Hubble Space Telescope/Space Telescope Imaging Spectrograph ultraviolet spectroscopy of δ Ori A that provides us with spatially separated spectra of Aa and Ab for the first time. We measured radial velocities for Aa1 and Ab in two observations made near the velocity extrema of Aa1. We show tentative evidence for the detection of the Aa2 component in cross-correlation functions of the observed and model spectra. We discuss the appearance of the UV spectra of Aa1 and Ab with reference to model spectra. Both stars have similar effective temperatures, but Ab is fainter and is a rapid rotator. The results will help in the interpretation of ground-based spectroscopy and in understanding the physical and evolutionary parameters of these massive stars.

Association between AA-NAT gene polymorphism and reproductive performance in sheep

OpenAIRE

Ding-ping,Bai; Cheng-jiang,Yu; Yu-lin,Chen

2012-01-01

Arylalkylamine N-acetyltransferase (AA-NAT) is critical enzyme in Melatonin (MLT) biosynthesis for MLT regulating the animal seasonal breeding. In this study, DNA sequencing methods were applied to detect the polymorphisms of the AA-NAT gene in 179 Chinese sheep belonging to two non-seasonal reproduction breeds and two seasonal reproduction breeds. One mutation at exon 3 (NM_001009461:c.486A > G) was firstly described at the sheep AA-NAT locus. Hence, we described the SmaI PCR-RFLP m...

Influencia de los parámetros de la soldadura metálica fría en las aleaciones AA5083 y AA6061//Influence of the colt metal welding parameters on the AA5083 and AA6061 aluminum

Directory of Open Access Journals (Sweden)

René Eduardo de‐Luna‐Alanís

2015-01-01

Full Text Available El trabajo tuvo como objetivo evaluar la influencia de la velocidad de la soldadura y de las correcciones del arco y pulso en el proceso de Transferencia Metálica Fría sobre las propiedades mecánicas de las aleaciones AA5083 y AA6061. Se desarrolló un diseño experimental de tipo factorial multinivel, con 4 factores independientes (Corrección de Arco, Pulso, Velocidad de Soldadura y Aleación. Los parámetros fundamentales fueron: Corriente de base 250 A; Voltaje de arco 21 V y Polaridad (Direct current electrode positive, DCEP. La evaluación se realizó a través de un ensayo de tracción transversal sobre probetas planas obtenidas de los cupones soldados. Se demuestra que el modelo aplicado es adecuado, revelándose en los experimentos diferencias sustanciales en las propiedades Tensión de fluencia 29,56 %, Módulo de elasticidad 51,16 % y Trabajo específico de deformación elástica 42,30 %, el cual no posee una dependencia lineal con elresto de las propiedades anteriores.Palabras claves: transferencia metálica fría, aleación AA5083, aleación AA6061, propiedades mecánicas._______________________________________________________________________________AbstractThe work objective was to evaluatethe influence of Cold Metal Transfer process arc and pulse corrections and welding speed on the mechanical properties of AA5083 and AA6061 aluminum alloys. For it, a Factorial Multilevel experimental design whit 4 independent factor (arc correction, pulse correction, welding speed and alloy was developed. The essential welding parameters employed were: base current 250 A; arc voltage 21 V and polarity (DCEP. The evaluation was made whit a transverse traction test of plate welded coupons. The experimental model applied wasadequate and substantial differences was showed between yield tensile strength 29,56 %, elasticity module (51,16 % and specific work of elastic deformation 42,30 %, which it does not possess a lineal dependence whit the rest

Synergism between cerium nitrate and sodium dodecylbenzenesulfonate on corrosion of AA5052 aluminium alloy in 3 wt.% NaCl solution

Energy Technology Data Exchange (ETDEWEB)

Liu, Jie; Wang, Dapeng; Gao, Lixin; Zhang, Daquan, E-mail: zhdq@sh163.net

2016-12-15

Highlights: • Effectively prevent corrosion of AA5052 alloy by using the mixture of cerium nitrate and sodium dodecylbenzenesulfonate. • Synergistic mechanism of the combination of cerium nitrate and sodium dodecylbenzenesulfonate. • Structure of the complex formed between cerium ions and dodecylbenzenesulfonate. • The optimal adsorption model of dodecylbenzenesulfonate on the Al{sub 2}O{sub 3} and CeO{sub 2} surface. - Abstract: The synergistic inhibition effect of rare earth cerium nitrate and sodium dodecylbenzenesulfonate (DBS) on corrosion of AA5052 aluminium alloy in 3 wt.% NaCl solution was investigated by electrochemical impedance spectroscopy (EIS), potentiodynamic polarization curve, scanning electron microscope (SEM) and Fourier transform infrared spectroscopy (FT-IR). The results show that the single cerium nitrate or DBS has a limited inhibition effect against corrosion of AA5052 alloy. The combination cerium ions with DBS produced strong synergistic effect on corrosion inhibition for AA5052 alloy and rendered a negaitve shift of the corrosion potential. The formation of the complex of Al(DBS){sub 3} and Ce(DBS){sub 3} stabilized the passive film of Al{sub 2}O{sub 3} and CeO{sub 2}, retarding both the cathodic and anodic processes of AA5052 alloy corrosion reaction significantly.

Aa Ah Nak

Science.gov (United States)

Tha, Na Gya; Wus, Thay

2017-01-01

In this article, Aa Ah Nak, the authors' methodology presents not only various reflections but also diverse contradictions about the Aa Nii language as well as language revitalization. This article explores language foundation and how the Aa Nii language revitalization is inextricably linked to the genocide and resulting historic trauma pervasive…

INVESTIGATION OF EFFECT OF COOLING CONDITIONS ON HARDNESS OF THE AA 2024 AND AA 2014 WROUGHT ALUMINIUM ALLOYS

Directory of Open Access Journals (Sweden)

Hülya KAÇAR DURMUŞ

2003-01-01

Full Text Available Mechanical properties of some aluminum alloys can be changed with precipitation hardening. This intermetallic precipitates are incoherent with the main structure and increased mechanical properties. Cooling rates after solid solution process effects properties after precipitation. In applications, however this is not taken into consideration. In this study, AA 2014 and AA 2024 Aluminium Alloy specimens were hold for one hour at 495±3 0C and formed a solid solution. Specimens were quenched at this temperature with different cooling rtes . later artificial aging was applied at 150 0C and 180 0C. The hardness and microstructure variations of the specimens were investigated depending on the cooling rates and artificial aging temperatures.

Calibration of the ISOLDE acceleration voltage using a high-precision voltage divider and applying collinear fast beam laser spectroscopy

CERN Document Server

Krieger, A.; Catherall, R.; Hochschulz, F.; Kramer, J.; Neugart, R.; Rosendahl, S.; Schipper, J.; Siesling, E.; Weinheimer, Ch.; Yordanov, D.T.; Nortershauser, W.

2011-01-01

A high-voltage divider with accuracy at the ppm level and collinear laser spectroscopy were used to calibrate the highvoltage installation at the radioactive ion beam facility ISOLDE at CERN. The accurate knowledge of this voltage is particularly important for collinear laser spectroscopy measurements. Beam velocity measurements using frequencycomb based collinear laser spectroscopy agree with the new calibration. Applying this, one obtains consistent results for isotope shifts of stable magnesium isotopes measured using collinear spectroscopy and laser spectroscopy on laser-cooled ions in a trap. The long-term stability and the transient behavior during recovery from a voltage dropout were investigated for the different power supplies currently applied at ISOLDE.

Antiproton Accumulator (AA)

CERN Multimedia

Photographic Service

1980-01-01

The AA in its final stage of construction, before it disappeared from view under concrete shielding. Antiprotons were first injected, stochastically cooled and accumulated in July 1980. From 1981 on, the AA provided antiprotons for collisions with protons, first in the ISR, then in the SPS Collider. From 1983 on, it also sent antiprotons, via the PS, to the Low-Energy Antiproton Ring (LEAR). The AA was dismantled in 1997 and shipped to Japan.

Calibration of the ISOLDE acceleration voltage using a high-precision voltage divider and applying collinear fast beam laser spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Krieger, A., E-mail: kriegea@uni-mainz.d [Institut fuer Kernchemie, Johannes Gutenberg, Universitaet Mainz, Fritz-Strassmann-Weg 2, 55128 Mainz (Germany); Geppert, Ch. [Institut fuer Kernchemie, Johannes Gutenberg, Universitaet Mainz, Fritz-Strassmann-Weg 2, 55128 Mainz (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Catherall, R. [CERN, CH-1211 Geneve 23 (Switzerland); Hochschulz, F. [Institut fuer Kernphysik, Universitaet Muenster, 48149 Muenster (Germany); Kraemer, J.; Neugart, R. [Institut fuer Kernchemie, Johannes Gutenberg, Universitaet Mainz, Fritz-Strassmann-Weg 2, 55128 Mainz (Germany); Rosendahl, S. [Institut fuer Kernphysik, Universitaet Muenster, 48149 Muenster (Germany); Schipper, J.; Siesling, E. [CERN, CH-1211 Geneve 23 (Switzerland); Weinheimer, Ch. [Institut fuer Kernphysik, Universitaet Muenster, 48149 Muenster (Germany); Yordanov, D.T. [Max-Planck-Institut fuer Kernphysik, 69117 Heidelberg (Germany); Noertershaeuser, W. [Institut fuer Kernchemie, Johannes Gutenberg, Universitaet Mainz, Fritz-Strassmann-Weg 2, 55128 Mainz (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany)

2011-03-11

A high-voltage divider with accuracy at the ppm level and collinear laser spectroscopy were used to calibrate the high-voltage installation at the radioactive ion beam facility ISOLDE at CERN. The accurate knowledge of this voltage is particularly important for collinear laser spectroscopy measurements. Beam velocity measurements using frequency-comb based collinear laser spectroscopy agree with the new calibration. Applying this, one obtains consistent results for isotope shifts of stable magnesium isotopes measured using collinear spectroscopy and laser spectroscopy on laser-cooled ions in a trap. The long-term stability and the transient behavior during recovery from a voltage dropout were investigated for the different power supplies currently applied at ISOLDE.

Constitutive behavior of as-cast AA1050, AA3104, and AA5182

Science.gov (United States)

van Haaften, W. M.; Magnin, B.; Kool, W. H.; Katgerman, L.

2002-07-01

Recent thermomechanical modeling to calculate the stress field in industrially direct-chill (DC) cast-aluminum slabs has been successful, but lack of material data limits the accuracy of these calculations. Therefore, the constitutive behavior of three aluminum alloys (AA1050, AA3104, and AA5182) was determined in the as-cast condition using tensile tests at low strain rates and from room temperature to solidus temperature. The parameters of two constitutive equations, the extended Ludwik equation and a combination of the Sellars-Tegart equation with a hardening law, were determined. In order to study the effect of recovery, the constitutive behavior after prestraining at higher temperatures was also investigated. To evaluate the quantified constitutive equations, tensile tests were performed simulating the deformation and cooling history experienced by the material during casting. It is concluded that both constitutive equations perform well, but the combined hardening-Sellars-Tegart (HST) equation has temperature-independent parameters, which makes it easier to implement in a DC casting model. Further, the deformation history of the ingot should be taken into account for accurate stress calculations.

The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

Energy Technology Data Exchange (ETDEWEB)

Kubota, Akira [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Bainy, Afonso C.D. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Departamento de Bioquímica, CCB, Universidade Federal de Santa Catarina, Florianopolis, SC 88040-900 (Brazil); Woodin, Bruce R.; Goldstone, Jared V. [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States); Stegeman, John J., E-mail: jstegeman@whoi.edu [Biology Department, Woods Hole Oceanographic Institution, Woods Hole, MA 02543 (United States)

2013-10-01

The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

The cytochrome P450 2AA gene cluster in zebrafish (Danio rerio): Expression of CYP2AA1 and CYP2AA2 and response to phenobarbital-type inducers

International Nuclear Information System (INIS)

Kubota, Akira; Bainy, Afonso C.D.; Woodin, Bruce R.; Goldstone, Jared V.; Stegeman, John J.

2013-01-01

The cytochrome P450 (CYP) 2 gene family is the largest and most diverse CYP gene family in vertebrates. In zebrafish, we have identified 10 genes in a new subfamily, CYP2AA, which does not show orthology to any human or other mammalian CYP genes. Here we report evolutionary and structural relationships of the 10 CYP2AA genes and expression of the first two genes, CYP2AA1 and CYP2AA2. Parsimony reconstruction of the tandem duplication pattern for the CYP2AA cluster suggests that CYP2AA1, CYP2AA2 and CYP2AA3 likely arose in the earlier duplication events and thus are most diverged in function from the other CYP2AAs. On the other hand, CYP2AA8 and CYP2AA9 are genes that arose in the latest duplication event, implying functional similarity between these two CYPs. A molecular model of CYP2AA1 showing the sequence conservation across the CYP2AA cluster reveals that the regions with the highest variability within the cluster map onto CYP2AA1 near the substrate access channels, suggesting differing substrate specificities. Zebrafish CYP2AA1 transcript was expressed predominantly in the intestine, while CYP2AA2 was most highly expressed in the kidney, suggesting differing roles in physiology. In the liver CYP2AA2 expression but not that of CYP2AA1, was increased by 1,4-bis [2-(3,5-dichloropyridyloxy)] benzene (TCPOBOP) and, to a lesser extent, by phenobarbital (PB). In contrast, pregnenolone 16α-carbonitrile (PCN) increased CYP2AA1 expression, but not CYP2AA2 in the liver. The results identify a CYP2 subfamily in zebrafish that includes genes apparently induced by PB-type chemicals and PXR agonists, the first concrete in vivo evidence for a PB-type response in fish. - Highlights: • A tandemly duplicated cluster of ten CYP2AA genes was described in zebrafish. • Parsimony and duplication analyses suggest pathways to CYP2AA diversity. • Homology models reveal amino acid positions possibly related to functional diversity. • The CYP2AA locus does not share synteny with

Microstructure Stability During Creep of Friction Stir Welded AA2024-T3 Alloy

Science.gov (United States)

Regev, Michael; Rashkovsky, Tal; Cabibbo, Marcello; Spigarelli, Stefano

2018-01-01

The poor weldability of the AA2024 aluminum alloy limits its use in industrial applications. Because friction stir welding (FSW) is a non-fusion welding process, it seems to be a promising solution for welding this alloy. In the current study, FSW was applied to butt weld AA2024-T3 aluminum alloy plates. Creep tests were conducted at 250 and at 315 °C on both the parent material and the friction stir welded specimens. The microstructures of the welded and non-welded AA2024-T3 specimens before and after the creep tests were studied and compared. A comprehensive transmission electron microscopy study together with a high-resolution scanning electron microscopy study and energy-dispersive x-ray spectroscopy analysis was conducted to investigate the microstructure stability. The parent material seems to contain two kinds of Cu-rich precipitates—coarse precipitates of a few microns each and uniformly dispersed fine nanosized precipitates. Unlike the parent material, the crept specimens were found to contain the two kinds of precipitates mentioned above together with platelet-like precipitates. In addition, extensive decoration of the grain boundaries with precipitates was clearly observed in the crept specimens. Controlled aging experiments for up to 280 h at the relevant temperatures were conducted on both the parent material and the welded specimens in order to isolate the contribution of exposure to high temperatures to the microstructure changes. TEM study showed the development of dislocation networks into a cellular dislocation structure in the case of the parent metal. Changes in the dislocation structure as a function of the creep strain and the FSW process were recorded. A detailed creep data analysis was conducted, taking into account the instability of the microstructure.

Dielectric spectroscopy technique applied to study the behaviour of irradiated polymer

International Nuclear Information System (INIS)

Saoud, R.; Soualmia, A.; Guerbi, C.A.; Benrekaa, N.

2006-01-01

Relaxation spectroscopy provides an excellent method for the study of motional processes in materials and has been widely applied to macromolecules and polymers. The technique is potentially of most interest when applied to irradiated systems. Application to the study of the structure beam-irradiated Teflon is thus an outstanding opportunity for the dielectric relaxation technique, particularly as this material exhibits clamping problems when subjected to dynamic mechanical relaxation studies. A very wide frequency range is necessary to resolve dipolar effects. In this paper, we discuss some significant results about the behavior and the modification of the structure of Teflon submitted to weak energy radiations

Longitudinal study of experimental induction of AA amyloidosis in mice seeded with homologous and heterologous AA fibrils.

Science.gov (United States)

Muhammad, Naeem; Murakami, Tomoaki; Inoshima, Yasuo; Ishiguro, Naotaka

2016-09-01

To investigate pathogenesis and kinetics of experimentally induced murine AA amyloidosis seeded with homologous (murine) and heterologous (bovine) AA fibrils. Experimental AA amyloidosis was induced by administration of inflammatory stimulus and preformed AA fibrils to a total of 111 female C57/Black mice. In this longitudinal study, heterologous (bovine) as well as homologous (murine) AA fibrils were injected intraperitoneally to mice in various combinations. Re-stimulation was done at 120 or 300 days post first inoculation. To analyze the intensity of amyloid depositions in mice organs, immunohistochemical techniques and image J software were used. Assessment of cytokines level in sera was done using a Mouse Th1/Th2/Th17 Cytokine CBA Kit. Incidence and severity of AA amyloidosis were quite low in mice inoculated with heterologous bovine AA fibrils than homologous murine one. Homologous AA fibrils administration at first and second inoculation caused maximum amount of amyloid depositions and severe systemic form of amyloidosis. Increase in the level of pro-inflammatory cytokine IL-6 was observed after first inoculation, while second inoculation caused a further increase in the level of anti-inflammatory cytokine IL-10. AA amyloidosis can be induced by heterologous as well as homologous AA fibrils. Severity of AA amyloidosis induced with homologous AA fibrils is higher compared to heterologous AA fibrils.

Minerals from Macedonia. XII. The dependence of quartz and opal color on trace element composition - AAS, FT IR and micro-Raman spectroscopy study

International Nuclear Information System (INIS)

Makreski, Petre; Jovanovski, Gligor; Stafilov, Trajce; Boev, Blazho

2004-01-01

The dependence of the color of quartz and opal natural minerals, collected from different localities in the Republic of Macedonia (Alinci, Belutche, Budinarci, Mariovo, Sasa, Sazhdevo, Chanishte, Cheshinovo, Zletovo) on their element composition is studied using Fourier transform infrared spectroscopy (FT IR), micro-Raman spectroscopy and atomic absorption spectrometry (AAS). In order to determine the content of different trace elements (Al, Cd, Ca, Co, Cr, Cu, Fe, K, Mg, Mn, Na, Ni, Pb and Zn), 15 quartz and 2 opal mineral samples, using flame atomic absorption spectrometry (FAAS) and Zeeman electrothermal atomic absorption spectrometry (ETAAS) are studied. To avoid matrix interferences, the method for elimination of silicium is proposed. Optimal instrumental parameters for ETAAS determination (temperature and time for drying, pyrolysis and atomizing) are established by extensive testing for each investigated element. It is found that the milky white color of quartz minerals is due to the presence of traces of Ca, the appearance of black color is the result of the existence of Pb, Mn and Al impurities, and the occurrence of Fe and Cr introduce appearance of red and green color, respectively. Preliminary identification of the minerals is based on the comparison of our results, obtained by using the infrared and Raman vibrational spectroscopy, with the corresponding literature data for the analogous mineral species originating all over the world. An overview of the basic morphological and physico-chemical characteristics of the quartz and opal minerals and the geology of the localities is given. The colored pictures of the studied quartz and opal minerals are presented as well. (Author)

A.A., constructivism, and reflecting teams.

Science.gov (United States)

Nevels, B

1997-12-01

Numerous studies and clinical anecdotes reveal a relationship between attendance at A.A. meetings and/or degree of involvement in A.A. and maintenance of sobriety. Hypotheses as to how A.A. and/or the A.A. meeting is helpful to its members have ranged from a focus on factors common to all therapy groups, to aspects of A.A. "treatment" which are behavioral in nature. Presented here is another way of understanding A.A.'s effectiveness within the frame of more recent, constructivistic approaches to family therapy. In particular, the A.A. topic meeting is compared to the reflecting team concept of Tom Anderson.

Comparison of corrosion behaviour of friction stir processed and laser melted AA 2219 aluminium alloy

International Nuclear Information System (INIS)

Surekha, K.; Murty, B.S.; Prasad Rao, K.

2011-01-01

Highlights: → Poor corrosion resistance of AA 2219 can be improved by surface treatments. → FSP and LM leads to dissolution of second phase particles. → No literature available on comparison of corrosion behaviour after FSP and LM. → The study implies FSP is as good as LM in improving the corrosion resistance of AA 2219. -- Abstract: Dissolution of second phase particles (CuAl 2 ) present in AA 2219 aluminium improves the corrosion resistance of the alloy. Two surface treatment techniques, viz., solid state friction stir processing and fusion based laser melting lead to the reduction in CuAl 2 content and the effect of these processes on the corrosion behaviour of the alloy is compared in this study. Potentiodynamic polarization and electrochemical impedance spectroscopy tests were carried out to compare corrosion behaviour. The corrosion resistance achieved by friction stir processing is comparable to that obtained by the laser melting technique.

Detection of AA76, a Common Form of Amyloid A Protein, as a Way of Diagnosing AA Amyloidosis.

Science.gov (United States)

Sato, Junji; Okuda, Yasuaki; Kuroda, Takeshi; Yamada, Toshiyuki

2016-01-01

Reactive amyloid deposits consist of amyloid A (AA) proteins, the degradation products of serum amyloid A (SAA). Since the most common species of AA is the amino terminal portion produced by cleavage between residues 76 and 77 of SAA (AA76), the presence of AA76 in tissues could be a consequence of AA amyloid deposition. This study assessed the diagnostic significance of the detection of AA76 for AA amyloidosis using two different approaches. Biopsy specimens (n=130 from 54 subjects) from gastroduodenal mucosa or abdominal fat (n=9 from 9 subjects) of patients who had already been diagnosed with or were suspected of having AA amyloidosis were used. Fixed mucosal sections were subjected to immunohistochemistry using a newly developed antibody recognizing the carboxyl terminal end of AA76 (anti-AA76). The non-fixed materials from gastroduodenal mucosa or abdominal fat were subjected to immunoblotting for detection of the size of AA76. Among the gastroduodenal specimens (n=115) from already diagnosed patients, the positive rates of Congo red staining, immunohistochemistry using anti-AA76, and immunoblotting were 68.4%, 73.0%, and 92.2%, respectively. The anti-AA76 did not stain the supposed SAA in the blood or leakage, which was stained by anti-SAA antibody. AA76 was not detected either by immunohistochemistry or by immunoblot in the materials from patients in whom AA amyloidosis had been ruled out. In the abdominal fat, the immunoblot detected AA76 in 8 materials from 8 already diagnosed patients and did not in 1 patient whose gastroduodenal mucosa was negative. In conclusion, the detection of AA76 may alter the ability to diagnose AA amyloidosis. In immunohistochemistry for fixed specimens, the new anti-AA76 antibody can improve the specificity. Immunoblot for non-fixed materials, which can considerably improve the sensitivity, should be beneficial for small materials like abdominal fat. © 2016 by the Association of Clinical Scientists, Inc.

Modelling and Pareto optimization of mechanical properties of friction stir welded AA7075/AA5083 butt joints using neural network and particle swarm algorithm

International Nuclear Information System (INIS)

Shojaeefard, Mohammad Hasan; Behnagh, Reza Abdi; Akbari, Mostafa; Givi, Mohammad Kazem Besharati; Farhani, Foad

2013-01-01

Highlights: ► Defect-free friction stir welds have been produced for AA5083-O/AA7075-O. ► Back-propagation was sufficient for predicting hardness and tensile strength. ► A hybrid multi-objective algorithm is proposed to deal with this MOP. ► Multi-objective particle swarm optimization was used to find the Pareto solutions. ► TOPSIS is used to rank the given alternatives of the Pareto solutions. -- Abstract: Friction Stir Welding (FSW) has been successfully used to weld similar and dissimilar cast and wrought aluminium alloys, especially for aircraft aluminium alloys, that generally present with low weldability by the traditional fusion welding process. This paper focuses on the microstructural and mechanical properties of the Friction Stir Welding (FSW) of AA7075-O to AA5083-O aluminium alloys. Weld microstructures, hardness and tensile properties were evaluated in as-welded condition. Tensile tests indicated that mechanical properties of the joint were better than in the base metals. An Artificial Neural Network (ANN) model was developed to simulate the correlation between the Friction Stir Welding parameters and mechanical properties. Performance of the ANN model was excellent and the model was employed to predict the ultimate tensile strength and hardness of butt joint of AA7075–AA5083 as functions of weld and rotational speeds. The multi-objective particle swarm optimization was used to obtain the Pareto-optimal set. Finally, the Technique for Order Preference by Similarity to the Ideal Solution (TOPSIS) was applied to determine the best compromised solution.

Development of continuous cooling precipitation diagrams for aluminium alloys AA7150 and AA7020

Energy Technology Data Exchange (ETDEWEB)

Zhang, Y., E-mail: yong.zhang@outlook.com [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia); Milkereit, B. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Kessler, O. [University of Rostock, Faculty of Mechanical Engineering and Marine Technology, Chair of Materials Science, 18051 Rostock (Germany); Schick, C. [University of Rostock, Institute of Physics, Polymer Physics Group, 18051 Rostock (Germany); Rometsch, P.A. [ARC Centre of Excellence for Design in Light Metals, Department of Materials Engineering, Monash University, Clayton, VIC 3800 (Australia)

2014-01-25

Highlights: • The DSC method was used for developing continuous cooling precipitation diagrams. • The quench-induced particles were observed by SEM for alloys AA7150 and AA7020. • There were more quench-induced particles in alloy AA7150. • Quench sensitivity of Al alloys can be evaluated by using the CCP diagrams. -- Abstract: Two commercial 7xxx series aluminium alloys with different solute contents and different quench-induced precipitation behaviour have been investigated by using a specialised differential scanning calorimetry (DSC) technique to record exothermal heat outputs during continuous cooling. Together with hardness testing and microstructural analysis, this DSC method was used to develop continuous cooling precipitation (CCP) diagrams for alloys AA7150 and AA7020. The results show that the total precipitation heat for each alloy decreases with increasing cooling rate. However, the excess specific heat at a given cooling rate in alloy AA7150 is much higher than that in alloy AA7020. It is evident that there are atleast three different quench-induced reactions in different temperature regimes for alloy AA7150 cooled at various linear cooling rates, but only equilibrium MgZn{sub 2} (η-phase) and Al{sub 2}CuMg (S-phase) particles were observed by scanning electron microscopy (SEM). There are at least two main precipitation peaks that can be found for alloy AA7020, which correspond to Mg{sub 2}Si and MgZn{sub 2} (η-phase). Furthermore, a method is developed to evaluate the quench sensitivity of an alloy based on a determination of the critical cooling rate. The maximum hardness values are reached at cooling rates that are faster than or similar to the critical cooling rate.

T6 and T78 tempers of AA6065 alloy: a quantitative TEM study

Energy Technology Data Exchange (ETDEWEB)

Tanaka, M.; Warner, T. [Compagnie de Produits Chimiques et Electrometallurgiques Pechiney, Centre de Recherches de Voreppe, 38 (France)

2000-07-01

Quantitative transmission electron microscopy is used to characterize the microstructure of an industrial Al-Mg-Si-Cu alloy (AA6056) in a state (T78 temper) desensitized to intergranular corrosion in comparison with the peak aged state (T6 temper). Analysis of dark-field images and of zero-loss filtered selected-area-diffraction patterns, along with EDX spectroscopy, indicates an advanced precipitation of the quaternary phase containing Si and Cu in the T78-tempered alloy compared to the T6 one. This supports the current theory of the desensitization of AA6056 alloy. However, the application of EDX analysis to provide direct evidence of the chemical composition variation in the solid solution across the grain boundary appears less satisfactory. (orig.)

[Risk control of traditional Chinese medicines containing aristolochis acids (AAs) based on influencing factors of content of AAs].

Science.gov (United States)

Tian, Jing-Zhuo; Liang, Ai-Hua; Liu, Jing; Zhang, Bo-Li

2017-12-01

Aristolochic acids (AAs) widely exist in such plants as Aristolochia and Asarum. The renal toxicity of AAs as well as its carcinogenicity to urinary system have been widely known. In 2003 and 2004, China prohibited the use of Aristolochiae Radix, Aristolochiae Manshuriensis Caulis and Aristolochiae Fangchi Radix, and required administering other AAs-containing medicines in accordance with the regulations for prescription drugs. In this paper, we retrieved literatures on the content determination of AAs in recent 10 years in China. It suggested that the AAs content is lower in Asarum herb, especially in its roots and rhizomes, and most of which do not show detectable amount of AA-I. Some of traditional Chinese medicines show fairly small amount of detectable AA-I. The AAs content in Aristolochia herb (including Fructus Aristolochiae, kaempfer dutchmanspipe root) is relatively high; however, there are fewer literatures for studying the content determination of AAs in Chinese patent medicines. There were many factors affecting AAs content, including the parts used, origins, processing methods, extraction process. It suggested that we should pay attention to the toxicity of Chinese medicines containing AAs and use these decoction pieces and traditional Chinese medicines cautiously. In addition, basic studies for the origins, processing methods and extraction process of Chinese patent medicines containing AAs, as well as supervision and detection of AAs content in traditional Chinese medicinal materials, decoction pieces and Chinese patent medicines shall be strengthened for reducing medication risk and guaranteeing clinical medication safety. Copyright© by the Chinese Pharmaceutical Association.

Development of an alternative route for recycling AA2050 aluminum alloy by powder metallurgy; Desenvolvimento de uma rota alternativa para reciclagem da liga de aluminio AA2050 via metalurgia do po

Energy Technology Data Exchange (ETDEWEB)

Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R., E-mail: vane.guid@gmail.com [Universidade Federal de Sao Paulo (USP), Sao Jose dos Campos, SP (Brazil). Instituto de Ciencia e Tecnologia

2014-07-01

This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)

Monitoring of some heavy metal in egypt using different spectroscopic technique ICP-AES and AAS-GF

International Nuclear Information System (INIS)

El-Sayed, A.A.

2005-01-01

Heavy metals include both toxic and/or non toxic elements egyptian aquatic environment were monitored using inductivly coupled plasma-atomic emission spectroscopy; ICP-AES and graphite furnace-atomic absorption spectroscopy; GF-AAS. Water and aquatic weeds (waterhyathins) are of different categories specified for such monitoring form the canals. The locations of sampling sites the river nile in egypt. These sites were chosen based on the industrial activity comparing to the cleansite and the other cultivated one. Bioavailability and related effects were defined so as to specify actually the higher concentration more contaminated areas

AA under construction

CERN Multimedia

CERN PhotoLab

1979-01-01

The AA at an early stage of construction, in the newly built AA-Hall. Cable-trays already outline the shape of the accumulator ring. To the right are huge cable-drums for the pulse-forming-network (PFN) of the injection kicker. Seeing this picture, can one imagine that only 8 months later beams were circulating in the completed accumulator ring ?

Pengaruh Rapat Arus Anodizing terhadap Nilai Kekerasan pada Plat Aluminium Paduan Aa Seri 2024-t3

OpenAIRE

Fajar Nugroho

2015-01-01

Aluminum alloy AA 2024-T3 is widely applied in the aircraft industry because it has good mechanical properties such as; light weight, good conductivity and the corrosion resistance. However Aluminium 2024-T3 susceptible to wearing. One method to improve the wear resistance o f AA 2024-T3 is the anodizing process. The aims of this research to study the effect of current density and anodizing time against the hardness of aluminum alloy AA 2024-T3. The process of anodizing was carried out using ...

Development of an alternative route for recycling AA2050 aluminum alloy by powder metallurgy

International Nuclear Information System (INIS)

Guido, V.; Oliveira, A.C. de; Travessa, D.N.; Cardoso, K.R.

2014-01-01

This paper presents an alternative solid state route to recycling AA2050 aeronautical aluminium alloy chips. The first stage in the recycling process, reported in this work, is the obtainment of the alloy powder by high energy ball milling to subsequent cold pressing and hot extrusion. The process started with the cleaning of chips with the aim of contaminant removing from machining process and transport, followed by the high energy ball milling to result in the AA2050 alloy powder. The powder obtained was characterized by laser size particle analysis, scanning electron microscopy (SEM), X-Ray diffraction (DRX) and inductively coupled plasma atomic emission spectroscopy (ICP-AES). The results show the feasibility of obtaining a powder having appropriate particle size and chemical composition in accordance with the specification for alloy. (author)

Determination of Ethanol in Blood Samples Using Partial Least Square Regression Applied to Surface Enhanced Raman Spectroscopy.

Science.gov (United States)

Açikgöz, Güneş; Hamamci, Berna; Yildiz, Abdulkadir

2018-04-01

Alcohol consumption triggers toxic effect to organs and tissues in the human body. The risks are essentially thought to be related to ethanol content in alcoholic beverages. The identification of ethanol in blood samples requires rapid, minimal sample handling, and non-destructive analysis, such as Raman Spectroscopy. This study aims to apply Raman Spectroscopy for identification of ethanol in blood samples. Silver nanoparticles were synthesized to obtain Surface Enhanced Raman Spectroscopy (SERS) spectra of blood samples. The SERS spectra were used for Partial Least Square (PLS) for determining ethanol quantitatively. To apply PLS method, 920~820 cm -1 band interval was chosen and the spectral changes of the observed concentrations statistically associated with each other. The blood samples were examined according to this model and the quantity of ethanol was determined as that: first a calibration method was established. A strong relationship was observed between known concentration values and the values obtained by PLS method (R 2 = 1). Second instead of then, quantities of ethanol in 40 blood samples were predicted according to the calibration method. Quantitative analysis of the ethanol in the blood was done by analyzing the data obtained by Raman spectroscopy and the PLS method.

Proton Induced X-Rays Emission (PIXE) and Atomic Absorption Spectrometry (AAS) applied in the environmental sample analysis

International Nuclear Information System (INIS)

Popescu, Ion V.; Iordan, M.; Stihi, C.; Bancuta, A.; Dima, G.; Busuioc, G.; Ciupina, V.; Belc, M.; Badica, T.

2003-01-01

The aim of this work is to determine the elemental composition of tree leaves using Proton-Induced X-Rays Emission (PIXE) and Atomic Absorption Spectrophotometry (AAS) methods. By PIXE Spectrometry we identified and determined the concentration of S, Cl, K, Ca, Ti, Cr, Mn, Fe, Co, Ni, Cu Zn, As, Br, Sr and by AAS method the concentration of elements: Cr, Mn, Fe, Co, Cu, Zn, Se, Cd. Pb was identified in only 2 samples from 29. For tree leave samples collected at a large distance to the polluting source the Sr concentration decreased and the Mg, Ca, Se, Zn and Fe concentrations increased. Also, we can observe a small affinity of these leaves for the environmental Pb which was detected for two samples at a small distance to polluting source. (authors)

Laboratory Astrophysics Division of The AAS (LAD)

Science.gov (United States)

Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

2012-10-01

The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

Laboratory Astrophysics Division of the AAS (LAD)

Science.gov (United States)

Salama, Farid; Drake, R. P.; Federman, S. R.; Haxton, W. C.; Savin, D. W.

2012-01-01

The purpose of the Laboratory Astrophysics Division (LAD) is to advance our understanding of the Universe through the promotion of fundamental theoretical and experimental research into the underlying processes that drive the Cosmos. LAD represents all areas of astrophysics and planetary sciences. The first new AAS Division in more than 30 years, the LAD traces its history back to the recommendation from the scientific community via the White Paper from the 2006 NASA-sponsored Laboratory Astrophysics Workshop. This recommendation was endorsed by the Astronomy and Astrophysics Advisory Committee (AAAC), which advises the National Science Foundation (NSF), the National Aeronautics and Space Administration (NASA), and the U.S. Department of Energy (DOE) on selected issues within the fields of astronomy and astrophysics that are of mutual interest and concern to the agencies. In January 2007, at the 209th AAS meeting, the AAS Council set up a Steering Committee to formulate Bylaws for a Working Group on Laboratory Astrophysics (WGLA). The AAS Council formally established the WGLA with a five-year mandate in May 2007, at the 210th AAS meeting. From 2008 through 2012, the WGLA annually sponsored Meetings in-a-Meeting at the AAS Summer Meetings. In May 2011, at the 218th AAS meeting, the AAS Council voted to convert the WGLA, at the end of its mandate, into a Division of the AAS and requested draft Bylaws from the Steering Committee. In January 2012, at the 219th AAS Meeting, the AAS Council formally approved the Bylaws and the creation of the LAD. The inaugural gathering and the first business meeting of the LAD were held at the 220th AAS meeting in Anchorage in June 2012. You can learn more about LAD by visiting its website at http://lad.aas.org/ and by subscribing to its mailing list.

New enhanced sensitivity infrared laser spectroscopy techniques applied to reactive plasmas and trace gas detection

NARCIS (Netherlands)

Welzel, S.

2009-01-01

Infrared laser absorption spectroscopy (IRLAS) employing both tuneable diode and quantum cascade lasers (TDLs, QCLs) has been applied with both high sensitivity and high time resolution to plasma diagnostics and trace gas measurements. TDLAS combined with a conventional White type multiple pass cell

NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-04-0001 gb|AAS74960.1| 5-HT2 [Drosophila melanogaster] gb|AAS74962.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74964.1| 5-HT2 [Drosophila melanogaster] gb|AAS74966.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74970.1| 5-HT2 [Drosophila melanogaster] gb|AAS74972.1| 5-HT2 [Drosophila melanogaster]... gb|AAS74976.1| 5-HT2 [Drosophila melanogaster] gb|AAS74978.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS74979.1| 5-HT2 [Drosophila melanogaster] gb|AAS74980.1| 5-HT2 [Drosophila melanogaster

NCBI nr-aa BLAST: CBRC-DSIM-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-156 96% ...

NCBI nr-aa BLAST: CBRC-DMEL-04-0001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-04-0001 gb|AAS74999.1| 5-HT2 [Drosophila melanogaster] gb|AAS75013.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75024.1| 5-HT2 [Drosophila melanogaster] gb|AAS75026.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75043.1| 5-HT2 [Drosophila melanogaster] gb|AAS75052.1| 5-HT2 [Drosophila melanogaster]... gb|AAS75056.1| 5-HT2 [Drosophila melanogaster] gb|AAS75073.1| 5-HT2 [Drosophila mela...nogaster] gb|AAS75095.1| 5-HT2 [Drosophila melanogaster] AAS74999.1 1e-165 100% ...

NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0049 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0053 gb|AAS74380.1| 5-HT1B [Drosophila melanogaster] gb|AAS74382.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74389.1| 5-HT1B [Drosophila melanogaster] gb|AAS74402.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74403.1| 5-HT1B [Drosophila melanogaster] gb|AAS74405.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74406.1| 5-HT1B [Drosophila melanogaster] gb|AAS74411.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74412.1| 5-HT1B [Drosophila melanogaster] gb|AAS74413.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DYAK-02-0049 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0049 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DMEL-02-0053 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0053 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0056 gb|AAS74384.1| 5-HT1B [Drosophila melanogaster] gb|AAS74386.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74388.1| 5-HT1B [Drosophila melanogaster] gb|AAS74390.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74392.1| 5-HT1B [Drosophila melanogaster] gb|AAS74394.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74395.1| 5-HT1B [Drosophila melanogaster] gb|AAS74396.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74404.1| 5-HT1B [Drosophila melanogaster] gb|AAS74408.1| 5-HT1B [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74185.1| 5-HT1A [Drosophila melanogaster] gb|AAS74209.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74210.1| 5-HT1A [Drosophila melanogaster] gb|AAS74211.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74224.1| 5-HT1A [Drosophila melanogaster] gb|AAS74234.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74254.1| 5-HT1A [Drosophila melanogaster] gb|AAS74258.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74262.1| 5-HT1A [Drosophila melanogaster] gb|AAS74278.1| 5-HT1A [Drosophila mela

NCBI nr-aa BLAST: CBRC-DSIM-02-0056 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0056 gb|AAS74383.1| 5-HT1B [Drosophila melanogaster] gb|AAS74385.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74397.1| 5-HT1B [Drosophila melanogaster] gb|AAS74398.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74401.1| 5-HT1B [Drosophila melanogaster] gb|AAS74414.1| 5-HT1B [Drosophila melanog...aster] gb|AAS74416.1| 5-HT1B [Drosophila melanogaster] gb|AAS74418.1| 5-HT1B [Drosophila mela...nogaster] gb|AAS74419.1| 5-HT1B [Drosophila melanogaster] gb|AAS74424.1| 5-HT1B [Drosophila mela

AA magnet measurement team

CERN Multimedia

CERN PhotoLab

1978-01-01

Quickly improvised measurement equipment for the AA (Antiproton Accumulator) was all the tight schedule permitted, but the high motivation of the team made up for the lack of convenience. From left to right: Roy Billinge (Joint AA Project Leader, the other one was Simon van der Meer); Bruno Autin, Brian Pincott, Colin Johnson.

A synergistic combination of tetraethylorthosilicate and multiphosphonic acid offers excellent corrosion protection to AA1100 aluminum alloy

Science.gov (United States)

Dalmoro, Viviane; dos Santos, João H. Z.; Armelin, Elaine; Alemán, Carlos; Azambuja, Denise S.

2013-05-01

This work describes a new mechanism for the incorporation of organophosphonic acid into silane self-assembly monolayers, which has been used to protect AA1100 aluminum alloy. The protection improvement has been attributed to the fact that phosphonic structures promote the formation of strongly bonded and densely packed monolayer films, which show higher surface coverage and better adhesion than conventional silane systems. In order to evaluate the linking chemistry offered by phosphonic groups, two functionalized organophosphonic groups have been employed, 1,2-diaminoethanetetrakis methylenephosphonic acid (EDTPO) and aminotrimethylenephosphonic acid (ATMP), and combined with tetraethylorthosilicate (TEOS) films prepared by sol-gel synthesis. Results suggest that phosphonic acids may interact with the surface through a monodentate and bidentate coordination mode and, in addition, form one or more strong and stable linkages with silicon through non-hydrolysable bonds. Therefore, the incorporation of a very low concentration of phosphonic acids on TEOS solutions favors the complete coverage of the aluminum substrate during the silanization process, which is not possible using TEOS alone. The linking capacity of phosphonic acid has been investigated by FTIR-RA spectroscopy, SEM and EDX analysis, X-ray photoelectron spectroscopy (XPS), and quantum mechanical calculations. Finally, electrochemical impedance spectroscopy has been used to study the corrosion protection revealing that EDTPO-containing films afforded more protection to the AA1100 substrate than ATMP-containing films.

A synergistic combination of tetraethylorthosilicate and multiphosphonic acid offers excellent corrosion protection to AA1100 aluminum alloy

Energy Technology Data Exchange (ETDEWEB)

Dalmoro, Viviane [Instituto de Química, Universidade Federal do Rio Grande do Sul (UFRGS) Av. Bento Gonçalves 9500 - CEP 91501-970, Porto Alegre, RS (Brazil); Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); Santos, João H.Z. dos [Instituto de Química, Universidade Federal do Rio Grande do Sul (UFRGS) Av. Bento Gonçalves 9500 - CEP 91501-970, Porto Alegre, RS (Brazil); Armelin, Elaine, E-mail: elaine.armelin@upc.edu [Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); Alemán, Carlos, E-mail: carlos.aleman@upc.edu [Departament d’Enginyeria Química, ETSEIB, Universitat Politècnica de Catalunya (UPC), Avda. Diagonal 647, Barcelona E-08028 (Spain); Center for Research in Nano-Engineering (CRnE), Universitat Politècnica de Catalunya (UPC), Campus Sud, Edifici C’, C/Pasqual i Vila s/n, Barcelona E-08028 (Spain); and others

2013-05-15

This work describes a new mechanism for the incorporation of organophosphonic acid into silane self-assembly monolayers, which has been used to protect AA1100 aluminum alloy. The protection improvement has been attributed to the fact that phosphonic structures promote the formation of strongly bonded and densely packed monolayer films, which show higher surface coverage and better adhesion than conventional silane systems. In order to evaluate the linking chemistry offered by phosphonic groups, two functionalized organophosphonic groups have been employed, 1,2-diaminoethanetetrakis methylenephosphonic acid (EDTPO) and aminotrimethylenephosphonic acid (ATMP), and combined with tetraethylorthosilicate (TEOS) films prepared by sol–gel synthesis. Results suggest that phosphonic acids may interact with the surface through a monodentate and bidentate coordination mode and, in addition, form one or more strong and stable linkages with silicon through non-hydrolysable bonds. Therefore, the incorporation of a very low concentration of phosphonic acids on TEOS solutions favors the complete coverage of the aluminum substrate during the silanization process, which is not possible using TEOS alone. The linking capacity of phosphonic acid has been investigated by FTIR-RA spectroscopy, SEM and EDX analysis, X-ray photoelectron spectroscopy (XPS), and quantum mechanical calculations. Finally, electrochemical impedance spectroscopy has been used to study the corrosion protection revealing that EDTPO-containing films afforded more protection to the AA1100 substrate than ATMP-containing films.

A synergistic combination of tetraethylorthosilicate and multiphosphonic acid offers excellent corrosion protection to AA1100 aluminum alloy

International Nuclear Information System (INIS)

Dalmoro, Viviane; Santos, João H.Z. dos; Armelin, Elaine; Alemán, Carlos

2013-01-01

This work describes a new mechanism for the incorporation of organophosphonic acid into silane self-assembly monolayers, which has been used to protect AA1100 aluminum alloy. The protection improvement has been attributed to the fact that phosphonic structures promote the formation of strongly bonded and densely packed monolayer films, which show higher surface coverage and better adhesion than conventional silane systems. In order to evaluate the linking chemistry offered by phosphonic groups, two functionalized organophosphonic groups have been employed, 1,2-diaminoethanetetrakis methylenephosphonic acid (EDTPO) and aminotrimethylenephosphonic acid (ATMP), and combined with tetraethylorthosilicate (TEOS) films prepared by sol–gel synthesis. Results suggest that phosphonic acids may interact with the surface through a monodentate and bidentate coordination mode and, in addition, form one or more strong and stable linkages with silicon through non-hydrolysable bonds. Therefore, the incorporation of a very low concentration of phosphonic acids on TEOS solutions favors the complete coverage of the aluminum substrate during the silanization process, which is not possible using TEOS alone. The linking capacity of phosphonic acid has been investigated by FTIR-RA spectroscopy, SEM and EDX analysis, X-ray photoelectron spectroscopy (XPS), and quantum mechanical calculations. Finally, electrochemical impedance spectroscopy has been used to study the corrosion protection revealing that EDTPO-containing films afforded more protection to the AA1100 substrate than ATMP-containing films.

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74195.1| 5-HT1A [Drosophila melanogaster] gb|AAS74276.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74292.1| 5-HT1A [Drosophila melanogaster] gb|AAS74298.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74303.1| 5-HT1A [Drosophila melanogaster] gb|AAS74304.1| 5-HT1A [Drosophila melanog...aster] gb|AAS74321.1| 5-HT1A [Drosophila melanogaster] gb|AAS74359.1| 5-HT1A [Drosophila melanogaster] AAS74195.1 1e-176 97% ...

Application of full factorial design to study the tribological properties of AA6061-B4C and AA6061-B4C-MoS2 composites

Directory of Open Access Journals (Sweden)

Monikandan V. V.

2018-03-01

Full Text Available This study statistically analyzes the tribological properties of AA6061-10 wt. % B4C mono composite and AA6061-10 wt.% B4C-7.5 wt. % MoS2 hybrid composite. The tribological behavior of the composites was studied at atmospheric conditions using a pin-on-disk tribo-tester. The tribological experiments were conducted as per the full factorial design (FFD experimental scheme. The ANOVA analysis of the wear rate revealed that the three factors, A (MoS2 particles addition, B (applied load, and D (sliding distance presented the physical and statistical significance on the wear rate. The ANOVA analysis of the friction coefficient revealed that the factors B (applied load and C (sliding speed and interaction AB (interaction of MoS2 particles addition and applied load presented the physical and statistical significance on the friction coefficient. It is observed from the main effects plots of the wear rate and friction coefficient that the increase in the levels of factors B (applied load and D (sliding distance increased the wear rate and friction coefficient. However, the wear rate and friction coefficient decreased with the increase in the level of factor A (MoS2 particles addition.

40 CFR Appendix A to Subpart Aa of... - Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA

Science.gov (United States)

2010-07-01

... (40 CFR Part 63, Subpart A) to Subpart AA A Appendix A to Subpart AA of Part 63 Protection of... Hazardous Air Pollutants From Phosphoric Acid Manufacturing Plants Pt. 63, Subpt. AA, App. A Appendix A to Subpart AA of Part 63—Applicability of General Provisions (40 CFR Part 63, Subpart A) to Subpart AA 40 CFR...

Effect of supplementation of arachidonic acid (AA) or a combination of AA plus docosahexaenoic acid on breastmilk fatty acid composition

NARCIS (Netherlands)

Smit, EN; Koopmann, M; Boersma, ER; Muskiet, FAJ

We investigated whether supplementation with arachidonic acid (20:4 omega 6; AA), ora combination of AA and docosahexaenoic acid (22:6 omega 3; DHA) would affect human milk polyunsaturated fatty acid (PUFA) composition. Ten women were daily supplemented with 300 mg AA, eight with 300 mg AA, 110 mg

Activity of vegetative insecticidal proteins Vip3Aa58 and Vip3Aa59 of Bacillus thuringiensis against lepidopteran pests.

Science.gov (United States)

Baranek, Jakub; Kaznowski, Adam; Konecka, Edyta; Naimov, Samir

2015-09-01

Vegetative insecticidal proteins (Vips) secreted by some isolates of Bacillus thuringiensis show activity against insects and are regarded as insecticides against pests. A number of B. thuringiensis strains harbouring vip3A genes were isolated from different sources and identified by using a PCR based approach. The isolates with the highest insecticidal activity were indicated in screening tests, and their vip genes were cloned and sequenced. The analysis revealed two polymorphic Vip protein forms, which were classified as Vip3Aa58 and Vip3Aa59. After expression of the vip genes, the proteins were isolated and characterized. The activity of both toxins was estimated against economically important lepidopteran pests of woodlands (Dendrolimus pini), orchards (Cydia pomonella) and field crops (Spodoptera exigua). Vip3Aa58 and Vip3Aa59 were highly toxic and their potency surpassed those of many Cry proteins used in commercial bioinsecticides. Vip3Aa59 revealed similar larvicidal activity as Vip3Aa58 against S. exigua and C. pomonella. Despite 98% similarity of amino acid sequences of both proteins, Vip3Aa59 was significantly more active against D. pini. Additionally the effect of proteolytic activation of Vip58Aa and Vip3Aa59 on toxicity of D. pini and S. exigua was studied. Both Vip3Aa proteins did not show any activity against Tenebrio molitor (Coleoptera) larvae. The results suggest that the Vip3Aa58 and Vip3Aa59 toxins might be useful for controlling populations of insect pests of crops and forests. Copyright © 2015 Elsevier Inc. All rights reserved.

Syntheses, crystal structures, NMR spectroscopy, and vibrational spectroscopy of Sr(PO{sub 3}F).H{sub 2}O and Sr(PO{sub 3}F)

Energy Technology Data Exchange (ETDEWEB)

Jantz, Stephan G.; Hoeppe, Henning A. [Lehrstuhl fuer Festkoerperchemie, Institut fuer Physik, Universitaet Augsburg (Germany); Wuellen, Leo van; Fischer, Andreas [Lehrstuhl fuer Chemische Physik und Materialwissenschaften, Institut fuer Physik, Universitaet Augsburg (Germany); Libowitzky, Eugen [Institute for Mineralogy and Crystallography, Faculty of Geosciences, Geography and Astronomy, University of Vienna (Austria); Baran, Enrique J. [Centro de Quimica Inorganica (CEQUINOR/CONICET, UNLP), Facultad de Ciencias Exactas, Universidad Nacional de La Plata (Argentina); Weil, Matthias [Institute for Chemical Technologies and Analytics, Division Structural Chemistry, Vienna University of Technology (Austria)

2016-03-15

Single crystals of Sr(PO{sub 3}F).H{sub 2}O {P2_1/c, Z = 4, a = 7.4844(2) Aa, b = 7.0793(2) Aa, c = 8.4265(2) Aa, β = 108.696(1) , V = 422.91(2) Aa"3, 2391 F_o"2, 70 parameters, R_1[F"2 > 2σ(F"2)] = 0.036; wR_2(F"2 all) = 0.049, S = 1.054} were grown from an aqueous solution by a metathesis reaction. The structure comprises [SrO{sub 8}] polyhedra and PO{sub 3}F tetrahedra that form a layered arrangement parallel to (100). The topotactic dehydration of this phase proceeds between 80 and 140 C to afford Sr(PO{sub 3}F). The monazite-type crystal structure of Sr(PO{sub 3}F) was elucidated from the X-ray powder data by simulated annealing [P2{sub 1}/c, Z = 4, a = 6.71689(9) Aa, b = 7.11774(11) Aa, c = 8.66997(13) Aa, β = 128.0063(7) , V = 326.605(8) Aa{sup 3}, R{sub p} = 0.010, R{sub wp} = 0.015, R{sub F} = 0.030]. During dehydration, the structure of Sr(PO{sub 3}F) .H{sub 2}O collapses along [100] from a layered arrangement into a framework structure, accompanied by a change of the coordination number of the Sr{sup 2+} ions from eight to nine. The magic-angle spinning (MAS) NMR and vibrational spectroscopy data of both phases are discussed. (Copyright copyright 2016 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

NCBI nr-aa BLAST: CBRC-DMEL-02-0054 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DMEL-02-0054 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 0.0 100% ...

NCBI nr-aa BLAST: CBRC-DYAK-02-0048 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-02-0048 gb|AAS74186.1| 5-HT1A [Drosophila melanogaster] gb|AAS74187.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74231.1| 5-HT1A [Drosophila melanogaster] gb|AAS74233.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74373.1| 5-HT1A [Drosophila melanogaster] AAS74186.1 1e-163 91% ...

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74196.1| 5-HT1A [Drosophila melanogaster] gb|AAS74220.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74309.1| 5-HT1A [Drosophila melanogaster] gb|AAS74310.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74335.1| 5-HT1A [Drosophila melanogaster] AAS74196.1 1e-176 97% ...

NCBI nr-aa BLAST: CBRC-DSIM-02-0057 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-02-0057 gb|AAS74184.1| 5-HT1A [Drosophila melanogaster] gb|AAS74194.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74236.1| 5-HT1A [Drosophila melanogaster] gb|AAS74326.1| 5-HT1A [Drosophila mela...nogaster] gb|AAS74372.1| 5-HT1A [Drosophila melanogaster] AAS74184.1 1e-177 97% ...

Noise-immune cavity-enhanced analytical atomic spectrometry — NICE-AAS — A technique for detection of elements down to zeptogram amounts

International Nuclear Information System (INIS)

Axner, Ove; Ehlers, Patrick; Hausmaninger, Thomas; Silander, Isak; Ma, Weiguang

2014-01-01

Noise-immune cavity-enhanced optical heterodyne molecular spectroscopy (NICE-OHMS) is a powerful technique for detection of molecular compounds in gas phase that is based on a combination of two important concepts: frequency modulation spectroscopy (FMS) for reduction of noise, and cavity enhancement, for prolongation of the interaction length between the light and the sample. Due to its unique properties, it has demonstrated unparalleled detection sensitivity when it comes to detection of molecular constituents in the gas phase. However, despite these, it has so far not been used for detection of atoms, i.e. for elemental analysis. The present work presents an assessment of the expected performance of Doppler-broadened (Db) NICE-OHMS for analytical atomic spectrometry, then referred to as noise-immune cavity-enhanced analytical atomic spectrometry (NICE-AAS). After a description of the basic principles of Db-NICE-OHMS, the modulation and detection conditions for optimum performance are identified. Based on a previous demonstrated detection sensitivity of Db-NICE-OHMS of 5 × 10 −12 cm −1 Hz −1∕2 (corresponding to a single-pass absorbance of 7 × 10 −11 over 10 s), the expected limits of detection (LODs) of Hg and Na by NICE-AAS are estimated. Hg is assumed to be detected in gas phase directly while Na is considered to be atomized in a graphite furnace (GF) prior to detection. It is shown that in the absence of spectral interferences, contaminated sample compartments, and optical saturation, it should be feasible to detect Hg down to 10 zg/cm 3 (10 fg/m 3 or 10 −5 ng/m 3 ), which corresponds to 25 atoms/cm 3 , and Na down to 0.5 zg (zg = zeptogram = 10 −21 g), representing 50 zg/mL (parts-per-sextillion, pps, 1:10 21 ) in liquid solution (assuming a sample of 10 μL) or solely 15 atoms injected into the GF, respectively. These LODs are several orders of magnitude lower (better) than any previous laser-based absorption technique previously demonstrated

Comparison of susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys in neutral chloride solutions using electrochemical noise analysis

International Nuclear Information System (INIS)

Na, Kyung-Hwan; Pyun, Su-Il

2008-01-01

The susceptibility to pitting corrosion of AA2024-T4, AA7075-T651 and AA7475-T761 aluminium alloys was investigated in aqueous neutral chloride solution for the purpose of comparison using electrochemical noise measurement. The experimentally measured electrochemical noises were analysed based upon the combined stochastic theory and shot-noise theory using the Weibull distribution function. From the occurrence of two linear regions on one Weibull probability plot, it was suggested that there existed two stochastic processes of uniform corrosion and pitting corrosion; pitting corrosion was distinguished from uniform corrosion in terms of the frequency of events in the stochastic analysis. Accordingly, the present analysis method allowed us to investigate pitting corrosion independently. The susceptibility to pitting corrosion was appropriately evaluated by determining pit embryo formation rate in the stochastic analysis. The susceptibility was decreased in the following order: AA2024-T4 (the naturally aged condition), AA7475-T761 (the overaged condition) and AA7075-T651 (the near-peak-aged condition)

Microstructural features of friction stir welded dissimilar Aluminium alloys AA2219-AA7475

Science.gov (United States)

Zaman Khan, Noor; Ubaid, Mohammed; Siddiquee, Arshad Noor; Khan, Zahid A.; Al-Ahmari, Abdulrahman; Chen, Xizhang; Haider Abidi, Mustufa

2018-05-01

High strength, good corrosion resistance, light weight make aluminium alloys a material of choice in many industrial sectors like aerospace, marine etc. Problems associated with welding of these alloys by fusion welding processes restricted their use in various industries. Friction stir welding (FSW), a clean solid-state joining process, easily overcomes various difficulties encountered during conventional fusion welding processes. In the present work, the effect of rotational speed (710 rpm, 900 rpm and 1120 rpm) on micro-hardness distribution and microstructure of FSWed dissimilar aluminium alloy joints were analyzed. Plates of AA7475-T761 and AA2219-O having thickness of 2.5 mm were welded by fixing AA7475 on retreating side (RS) and AA2219 on advancing side (AS). Welded joints were characterized by Vickers micro-hardness testing, scanning electron microscopy (SEM) and optical microscopy (OM). Results revealed that rotational speed significantly affects the micro-hardness due to increase in grain size, coarsening and dissolution of strengthening precipitates and re-precipitation. Higher micro-hardness values were observed in stir zone due to grain refinement and re-precipitation. Minimum micro-hardness value was observed at the TMAZ/HAZ of advancing side due to thermal softening.

Determination of water quality of ground water in selected Payatas residential areas using ion-selective electrodes (ISE) and atomic absorption spectroscopy (AAS) (determination of NO3, Cl, Pb, Cd, Zn)

International Nuclear Information System (INIS)

Tahir, Samsudin A.; Roque, Willie P.; Arididon, Bonifacio D. Jr.; Gardon, Ruel W.

2003-01-01

This study aims to determine the water-soluble ions using ion-selective electrodes (ISE) and trace metals using atomic absorption spectroscopy (AAS). Seven water samples were chosen from the thirteen sites, which were gathered from the selected Payatas residential areas in Quezon City. For the trace metals the lowest detection of AAS in lead was obtained in La Brea site and was found to be -0.5 ppm. Lead content has a value of -0.04 ppm and was found to be below the detection limit of 0.1 ppm. The remaining sites obtained high value of lead concentrations in AAS reading. The range of concentration for lead was from 0.5 ppm for La Brea site to 1.4 ppm for Velasco site. The cadmium as trace metal in groundwater samples from Payatas residential area was found to be below the lowest limit of detection ( 3 which is 15.6 ppm and it was obtained by the used of ion selective electrodes (ISE) Horiba model type. Second to it was the La Brea site, which is 10.04 ppm All the other samples do not exceeds to the maximum allowable concentration of nitrate (50.0 ppm), and it ranged from 4.10 ppm for open-well site to 15.6 ppm for Lopez site. In chloride determination, Lagro High School obtained a reading of 57.6 ppm using ISE and it was the highest concentration amount present in seven samples. Next to it was the Ungrin site (36.8 ppm), samples ranged from 6.7 ppm for La Brea site to 57.6 ppm for Lagro high school site. All the samples do not exceeds to the maximum allowable concentration for chloride, which is 250 ppm. (Authors)

AA Index

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa index provides a long climatology of global geomagnetic activity using 2 antipodal observatories at Greenwich and Melbourne- IAGA Bulletin 37,...

Experimental investigation of hardness of FSW and TIG joints of Aluminium alloys of AA7075 and AA6061

Directory of Open Access Journals (Sweden)

Chetan Patil

2016-07-01

Full Text Available This paper reports hardness testing conducted on welded butt joints by FSW and TIG welding process on similar and dissimilar aluminium alloys. FSW joints were produced for similar alloys of AA7075T651 and dissimilar alloys of AA7075T651- AA6061T6. The Friction stir welds of AA7075 & AA6061 aluminium alloy were produced at different tool rotational speeds of 650,700, 800, 900, 1000 and transverse speed of 30, 35, 40 mm/min. TIG welding was conducted along the rolling direction of similar and dissimilar aluminium plates. The Brinell hardness testing techniques were employed to conduct the tests; these tests were conducted on the welds to ascertain the joint integrity before characterization to have an idea of the quality of the welds

Experimental transmission of AA amyloidosis by injecting the AA amyloid protein into interleukin-1 receptor antagonist knockout (IL-1raKO) mice.

Science.gov (United States)

Watanabe, K; Uchida, K; Chambers, J K; Tei, M; Shoji, A; Ushio, N; Nakayama, H

2015-05-01

The incidence of AA amyloidosis is high in humans with rheumatoid arthritis and several animal species, including cats and cattle with prolonged inflammation. AA amyloidosis can be experimentally induced in mice using severe inflammatory stimuli and a coinjection of AA amyloid; however, difficulties have been associated with transmitting AA amyloidosis to a different animal species, and this has been attributed to the "species barrier." The interleukin-1 receptor antagonist knockout (IL-1raKO) mouse, a rodent model of human rheumatoid arthritis, has been used in the transmission of AA amyloid. When IL-1raKO and BALB/c mice were intraperitoneally injected with mouse AA amyloid together with a subcutaneous pretreatment of 2% AgNO3, all mice from both strains that were injected with crude or purified murine AA amyloid developed AA amyloidosis. However, the amyloid index, which was determined by the intensity of AA amyloid deposition, was significantly higher in IL-1raKO mice than in BALB/c mice. When IL-1raKO and BALB/c mice were injected with crude or purified bovine AA amyloid together with the pretreatment, 83% (5/6 cases) and 38% (3/8 cases) of IL-1raKO mice and 17% (1/6 cases) and 0% (0/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. Similarly, when IL-1raKO and BALB/c mice were injected with crude or purified feline AA amyloid, 33% (2/6 cases) and 88% (7/8 cases) of IL-1raKO mice and 0% (0/6 cases) and 29% (2/6 cases) of BALB/c mice, respectively, developed AA amyloidosis. These results indicated that IL-1raKO mice are a useful animal model for investigating AA amyloidogenesis. © The Author(s) 2014.

Partially melted zone cracking in AA6061 welds

International Nuclear Information System (INIS)

Prasad Rao, K.; Ramanaiah, N.; Viswanathan, N.

2008-01-01

Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043

Partially melted zone cracking in AA6061 welds

Energy Technology Data Exchange (ETDEWEB)

Prasad Rao, K. [Department of Metallurgical and Materials Engineering, Indian Institute of Technology Madras, Chennai (India)], E-mail: kpr@iitm.ac.in; Ramanaiah, N. [Sri Kalahasteeswara Institute of Technology, Srikalahasti (India); Viswanathan, N. [Defence Research and Development Laboratory, Hyderabad (India)

2008-07-01

Partially melted zone (PMZ) cracking susceptibility in AA6061 alloy was studied. Role of prior thermal history, gas tungsten arc welding techniques such as continuous current (CC) and pulsed current (PC) and use of different fillers (AA4043 and AA5356) were studied. Role of different grain refiners such as scandium, zirconium and Tibor in the above fillers was studied. Varestraint test was used to study the PMZ cracking susceptibility. Metallurgical analysis was done to corroborate the results. PMZ cracking was severe in T6 temper than in T4 irrespective of filler material. PMZ cracking susceptibility was more with AA5356 than in AA4043. It was less with pulsed current GTAW. PMZ cracking susceptibility was reduced with addition of grain refiners. Out of all, lowest PMZ cracking susceptibility was observed with 0.5%Sc addition to fusion zone through AA4043 filler and PC technique. The concentrations of magnesium and silicon were reduced at the PMZ grain boundaries with grain refiner additions to fusion zone through AA5356 or AA4043.

Analysis of some herbal plants from India used in the control of diabetes mellitus by NAA and AAS techniques

International Nuclear Information System (INIS)

Rajurkar, N.S.; Pardeshi, B.M.

1997-01-01

Elemental analysis of some herbal plants used in the control of diabetes has been done by the techniques of Neutron Activation Analysis (NAA) and Atomic Absorption Spectroscopy (AAS). The elements Mn, Na, K, Cl, Al, Cu, Co, Pb, Ni, Cr, Cd, Fe, Ca, Zn and Hg are found to be present in different plants in various proportions. (Author)

The AA disappearing under concrete shielding

CERN Multimedia

CERN PhotoLab

1982-01-01

When the AA started up in July 1980, the machine stood freely in its hall, providing visitors with a view through the large window in the AA Control Room. The target area, in which the high-intensity 26 GeV/c proton beam from the PS hit the production target, was heavily shielded, not only towards the outside but also towards the AA-Hall. However, electrons and pions emanating from the target with the same momentum as the antiprotons, but much more numerous, accompanied these through the injection line into the AA ring. The pions decayed with a half-time corresponding to approximately a revolution period (540 ns), whereas the electrons lost energy through synchrotron radiation and ended up on the vacuum chamber wall. Electrons and pions produced the dominant component of the radiation level in the hall and the control room. With operation times far exceeding original expectations, the AA had to be buried under concrete shielding in order to reduce the radiation level by an order of magnitude.

Rare earth conversion coatings grown on AA6061 aluminum alloys. Corrosion studies

Energy Technology Data Exchange (ETDEWEB)

Brachetti S, S. B. [Instituto Tecnologico de Ciudad Madero, Av. 1o. de Mayo y Sor Juana I. de la Cruz, Col. Los Mangos, 89440 Ciudad Madero, Tanaulipas (Mexico); Dominguez C, M. A.; Torres H, A. M.; Onofre B, E. [IPN, Centro de Investigacion en Ciencia Aplicada y Tecnologia Avanzada - Altamira, Carretera Tampico-Puerto Industrial Altamira Km. 14.5, 89600 Altamira, Tamaulipas (Mexico); De la Cruz H, W., E-mail: mdominguezc@ipn.mx [UNAM, Centro de Nanociencias y Nanotecnologia, Apdo. Postal 2681, 22800 Ensenada, Baja California (Mexico)

2014-07-01

The present work is aimed to investigate the corrosion resistance of rare earth protective coatings deposited by spontaneous deposition on AA6061 aluminum alloy substrates. Coatings were deposited from water-based Ce(NO{sub 3}){sub 3} and La(NO{sub 3}){sub 3} solutions by varing parameters such as rare earth solution concentration, bath temperature and immersion time. The values of the Tafel slopes indicate that the cathodic process is favored by concentration polarization rather than activation polarization. Chemical and morphological characterizations of the surface before and after electrochemical evaluations were performed by X-ray photoelectron spectroscopy and scanning electron microscopy. (Author)

Rare earth conversion coatings grown on AA6061 aluminum alloys. Corrosion studies

International Nuclear Information System (INIS)

Brachetti S, S. B.; Dominguez C, M. A.; Torres H, A. M.; Onofre B, E.; De la Cruz H, W.

2014-01-01

The present work is aimed to investigate the corrosion resistance of rare earth protective coatings deposited by spontaneous deposition on AA6061 aluminum alloy substrates. Coatings were deposited from water-based Ce(NO 3 ) 3 and La(NO 3 ) 3 solutions by varing parameters such as rare earth solution concentration, bath temperature and immersion time. The values of the Tafel slopes indicate that the cathodic process is favored by concentration polarization rather than activation polarization. Chemical and morphological characterizations of the surface before and after electrochemical evaluations were performed by X-ray photoelectron spectroscopy and scanning electron microscopy. (Author)

Obesity is a significant susceptibility factor for idiopathic AA amyloidosis.

Science.gov (United States)

Blank, Norbert; Hegenbart, Ute; Dietrich, Sascha; Brune, Maik; Beimler, Jörg; Röcken, Christoph; Müller-Tidow, Carsten; Lorenz, Hanns-Martin; Schönland, Stefan O

2018-03-01

To investigate obesity as susceptibility factor in patients with idiopathic AA amyloidosis. Clinical, biochemical and genetic data were obtained from 146 patients with AA amyloidosis. Control groups comprised 40 patients with long-standing inflammatory diseases without AA amyloidosis and 56 controls without any inflammatory disease. Patients with AA amyloidosis had either familial Mediterranean fever (FMF) or long-standing rheumatic diseases as underlying inflammatory disease (n = 111, median age 46 years). However, in a significant proportion of patients with AA amyloidosis no primary disease was identified (idiopathic AA; n = 37, median age 60 years). Patients with idiopathic AA amyloidosis were more obese and older than patients with AA amyloidosis secondary to FMF or rheumatic diseases. Serum leptin levels correlated with the body mass index (BMI) in all types of AA amyloidosis. Elevated leptin levels of more than 30 µg/l were detected in 18% of FMF/rheumatic + AA amyloidosis and in 40% of patients with idiopathic AA amyloidosis (p = .018). Finally, the SAA1 polymorphism was confirmed as a susceptibility factor for AA amyloidosis irrespective of the type of the disease. Obesity, age and the SAA1 polymorphism are susceptibility factors for idiopathic AA amyloidosis. Recent advances in treatment of FMF and rheumatic disorders will decrease the incidence of AA amyloidosis due to these diseases. Idiopathic AA, however, might be an emerging problem in the ageing and increasingly obese population.

Developing a Transdisciplinary Teaching Implement for Atomic Absorption Spectroscopy

Science.gov (United States)

Drew, John

2008-01-01

In this article I explain why I wrote the set of teaching notes on Atomic Absorption Spectroscopy (AAS) and why they look the way they do. The notes were intended as a student reference to question, highlight and write over as much as they wish during an initial practical demonstration of the threshold concept being introduced, in this case…

Influence of surface pretreatment in resistance spot welding of aluminum AA1050

DEFF Research Database (Denmark)

Al Naimi, Ihsan K.; Al Saadi, Moneer H.; Daws, Kasim M.

2015-01-01

quality. An experimental study of the influence of pretreatment on weld quality in RSW of AA1050 sheets with three thicknesses, comparing welding of as-received sheet with pretreated sheet by either pickling in NaOH or glass-blasting were investigated. Different weld settings were applied with low...

Experimental immunologically mediated aplastic anemia (AA) in mice: cyclosporin A fails to protect against AA

International Nuclear Information System (INIS)

Knospe, W.H.; Steinberg, D.; Gratwohl, A.; Speck, B.

1984-01-01

Immunologically mediated aplastic anemia (AA) in mice was induced by the i.v. injection of 10(7) lymph node cells (LNC) from H-2k identical but Mls mismatched CBA/J donor mice into previously irradiated (600 rad total body gamma) C3H/HeJ mice. Cyclosporin A (CsA), 25 mg/kg, was administered subcutaneously from day -1 to day 30. Control mice included C3H/HeJ mice which received 600 rad alone, C3H/HeJ mice which received 600 rad plus CsA as above, and C3H/HeJ mice which received 600 rad total body irradiation followed by 10(7) LNC from CBA/J donors. CsA failed to prevent lethal AA. These results suggest that the pathogenetic mechanisms operating in immunologically mediated AA differ from the mechanisms operating in rodents transplanted with allogeneically mismatched marrow or spleen cells which develop graft-versus-host disease. The results are consistent with a non-T cell-dependent mechanism causing the AA

Corrosion monitoring of the AA2024 alloy in NaCl solutions by electrochemical noise measurements

International Nuclear Information System (INIS)

Aballe, A.; Bethencourt, M.; Botana, F.J.; Marcos, M.; Rodriguez-Chacon, M.A.

1998-01-01

The behaviour of the AA2024 alloy against corrosion in 3.5% NaCl solution has been monitored. In this environment the alloy can be easily damaged under small anodic polarizations. Linear Polarization, electrochemical impedance, spectroscopy and electrochemical noise measurement have been used as experimental techniques. Data from ENM have been analyzed using statistical parameters and Chaos Theory. The results here obtained suggest that ENM is particularly useful to monitored systems that can be modified using other electrochemical techniques. (Author) 11 refs

Application of Fourier transform infrared (FT-IR) spectroscopy to the study of the modification of epoxidized sunflower oil by acrylation.

Science.gov (United States)

Irinislimane, Ratiba; Belhaneche-Bensemra, Naima

2012-12-01

Commercial sunflower oil was epoxidized at the laboratory-scale. The epoxidized sunflower oil (ESFO) was modified following the acrylation reaction. Modification was carried out simultaneously using acrylic acid (AA) and triethylamine (TEA). To optimize the reaction conditions, the effects of four temperatures (40, 60, 80, and 100 °C), the ESFO:AA (100:100) ratio, and 0.2% TEA were investigated. The rate of conversion was analyzed with both FT-IR and titration of the oxirane ring. After that, the temperature with the highest conversion was selected and used throughout for all modification reactions. Then, four ratios (100:100, 100:90, 100:80, and 100:75) of ESFO:AA were analyzed at four different concentrations of TEA (0.2, 0.3, 0.4, and 0.5%) to determine the best estimate for both the ESFO:AA ratio and the catalyst concentration. Conversion rate was analyzed using FT-IR spectroscopy by measuring the concentrations of ester, carbonyl, and alcohol groups. Moreover, oxirane-ring concentration was estimated using the titration method (with gentian violet as indicator) and FT-IR spectroscopy (epoxy ring absorptions at 1270 cm(-1) and 877 cm(-1)). Based on conversion yield, the optimum ESFO:AA ratio corresponds to 100:80; the best temperature reaction was at 60 °C, and the best TEA concentration was 0.2%. The critical amounts of reactants needed to reach maximum conversion were established. The final acid value of the acrylated ESFO after washing (pH = 7) was 2.1 mg potassium hydroxide (KOH)·g(-1). All results show that FT-IR spectroscopy is a simple, low-cost, rapid method for investigating the kinetics of a reaction.

The Antiproton Accumulator (AA)

CERN Multimedia

1980-01-01

A section of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A large vacuum-tank, a quadrupole (QDN09*), a bending magnet (BST08), another vacuum-tank, a wide quadrupole (QFW08) and (in the background) a further bending magnet (BST08). The tanks are covered with heating tape for bake-out. The tank left of QDN09 contained the kickers for stochastic pre-cooling (see 790621, 8002234, 8002637X), the other one served mainly as vacuum chamber in the region where the beam was large. Peter Zettwoch works on QFW08. * see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984) See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

X-ray emission spectroscopy applied to glycine adsorbed on Cu(110): An atom and symmetry projected view

Energy Technology Data Exchange (ETDEWEB)

Hasselstroem, J.; Karis, O.; Weinelt, M. [Uppsala Univ. (Sweden)] [and others

1997-04-01

When a molecule is adsorbed on a metal surface by chemical bonding new electronic states are formed. For noble and transition metals these adsorption-induced states overlap with the much more intense metal d-valence band, making them difficult to probe by for instance direct photoemission. However, it has recently been shown that X-ray emission spectroscopy (XES) can be applied to adsorbate systems. Since the intermediate state involves a core hole, this technique has the power to project out the partial density of states around each atomic site. Both the excitation and deexcitation processes are in general governed by the dipole selection rules. For oriented system, it is hence possible to obtain a complete separation into 2p{sub x}, 2p{sub y} and 2p{sub z} contributions using angular resolved measurements. The authors have applied XES together with other core level spectroscopies to glycine adsorption on Cu(110). Glycine (NH{sub 2}CH{sub 2}COOH) is the smallest amino acid and very suitable to study by core level spectroscopy since it has several functional groups, all well separated in energy by chemical shifts. Its properties are futhermore of biological interest. In summary, the authors have shown that it is possible to apply XES to more complicated molecular adsorbates. The assignment of different electronic states is however not as straight forward as for simple diatomic molecules. For a complete understanding of the redistribution and formation of new electronic states associated with the surface chemical bond, experimental data must be compared to theoretical calculations.

Raman spectroscopy and capillary electrophoresis applied to forensic colour inkjet printer inks analysis.

Science.gov (United States)

Król, Małgorzata; Karoly, Agnes; Kościelniak, Paweł

2014-09-01

Forensic laboratories are increasingly engaged in the examination of fraudulent documents, and what is important, in many cases these are inkjet-printed documents. That is why systematic approaches to inkjet printer inks comparison and identification have been carried out by both non-destructive and destructive methods. In this study, micro-Raman spectroscopy and capillary electrophoresis (CE) were applied to the analysis of colour inkjet printer inks. Micro-Raman spectroscopy was used to study the chemical composition of colour inks in situ on a paper surface. It helps to characterize and differentiate inkjet inks, and can be used to create a spectra database of inks taken from different cartridge brands and cartridge numbers. Capillary electrophoresis in micellar electrophoretic capillary chromatography mode was applied to separate colour and colourless components of inks, enabling group identification of those components which occur in a sufficient concentration (giving intensive peaks). Finally, on the basis of the obtained results, differentiation of the analysed inks was performed. Twenty-three samples of inkjet printer inks were examined and the discriminating power (DP) values for both presented methods were established in the routine work of experts during the result interpretation step. DP was found to be 94.0% (Raman) and 95.6% (CE) when all the analysed ink samples were taken into account, and it was 96.7% (Raman) and 98.4% (CE), when only cartridges with different index numbers were considered. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Positron annihilation lifetime spectroscopy (PALS) application in metal barrier layer integrity for porous low- k materials

CERN Document Server

Simon, Lin; Gidley, D W; Wetzel, J T; Monnig, K A; Ryan, E T; Simon, Jang; Douglas, Yu; Liang, M S; En, W G; Jones, E C; Sturm, J C; Chan, M J; Tiwari, S C; Hirose, M

2002-01-01

Positron Annihilation Lifetime Spectroscopy (PALS) is a useful tool to pre-screen metal barrier integrity for Si-based porous low-k dielectrics. Pore size of low-k, thickness of metal barrier Ta, positronium (Ps) leakage from PALS, trench sidewall morphology, electrical test from one level metal (1LM) pattern wafer and Cu diffusion analysis were all correlated. Macro-porous low-k (pore size >=200 AA) and large scale meso-porous low-k (>50~200 AA) encounter both Ps leakage and Cu diffusion into low-k dielectric in the 0.25 mu mL/0.3 mu mS structures when using SEMATECH in-house PVD Ta 250 AA as barrier layer. For small scale meso-porous (>20~50 AA) and micro- porous (<=20 AA) low-k, no Ps leakage and no Cu diffusion into low-k were observed even with PVD Ta 50 AA, which is proved also owing to sidewall densification to seal all sidewall pores due to plasma etch and ash. For future technology, smaller pore size of porous Si-based low-k (=<50 AA) will be preferential for dense low-k like trench sidewall to...

Dissimilar friction stir welds in AA5083-AA6082: The effect of process parameters on residual stress

International Nuclear Information System (INIS)

Steuwer, A.; Peel, M.J.; Withers, P.J.

2006-01-01

The effect of tool traverse and rotation speeds on the residual stresses are quantified for welds between non-age-hardening AA5083 and age-hardening AA6082 and compared to single alloy joints made from each of the two constituents. The residual stresses have been characterised non-destructively by neutron diffraction and synchrotron X-ray diffraction. The region around the weld line was characterised by significant tensile residual stress fields which are balanced by compressive stresses in the parent material. The rotation speed of the tool has been found to have a substantially greater influence than the transverse speed on the properties and residual stresses in the welds, particularly on the AA5083 side where the location of the peak stress moves from the stir zone to beyond the edge of the tool shoulder. The changes in residual stress are related to microstructural and hardness changes as determined in a previous study . In particular the larger stresses under the weld tool on the AA5083 side compared to the AA6082 side are related to a transient reduction in yield stress due to dissolution of the hardening precipitates during welding prior to natural aging after welding

Ascorbic acid (AA) metabolism in protection against radiation damage

International Nuclear Information System (INIS)

Rose, R.C.; Koch, M.J.

1986-01-01

The possibility is considered that AA protects tissues against radiation damage by scavenging free radicals that result from radiolysis of water. A physiologic buffer (pH 6.7) was incubated with 14 C-AA and 1 mM thiourea (to slow spontaneous oxidation of AA). Aliquots were assayed by HPLC and scintillation spectrometry to identify the 14 C-label. Samples exposed to Cobalt-60 radiation had a half time of AA decay of 30 minutes) indicating that AA scavenges radiation-induced free radicals and forms the ascorbate free radical (AFR). Pairs of 14 C-AFR disproportionate, with the net effect of 14 C-dehydroascorbic acid formation from 14 C-AA. Having established that AFR result from ionizing radiation in an aqueous solution, the possibility was evaluated that a tissue factor reduces AFR. Cortical tissue from the kidneys of male rats was minced, homogenized in buffer and centrifuged at 8000 xg. The supernatant was found to slow the rate of radiation-induced AA degradation by > 90% when incubated at 23 0 C in the presence of 15 μM 14 C-AA. Samples of supernatant maintained at 100 0 C for 10 minutes or precipitated with 5% PCA did not prevent radiation-induced AA degradation. AA may have a specific role in scavenging free radicals generated by ionizing radiation and thereby protect body tissues

Analysis of an Air Conditioning Coolant Solution for Metal Contamination Using Atomic Absorption Spectroscopy: An Undergraduate Instrumental Analysis Exercise Simulating an Industrial Assignment

Science.gov (United States)

Baird, Michael J.

2004-01-01

A real-life analytical assignment is presented to students, who had to examine an air conditioning coolant solution for metal contamination using an atomic absorption spectroscopy (AAS). This hands-on access to a real problem exposed the undergraduate students to the mechanism of AAS, and promoted participation in a simulated industrial activity.

The Lived Experience of Applied Science Graduates Who Complete the Applied Baccalaureate

Science.gov (United States)

Kujawa, Tricia A.

2012-01-01

The enrollment and transfer behaviors of college students are diverse. As a result college students travel various pathways to the baccalaureate degree. The purpose of this qualitative study was to better understand the lived experience of students who entered higher education through an associate of applied science (AAS) program and then…

Influence of Retrogression and Re-aging on the Exfoliation Corrosion Behavior of AA 7085 Sheets

Energy Technology Data Exchange (ETDEWEB)

Krishnan, Ajay; Raja, V. S. [Indian Institute of Technology Bombay, Mumbai (India); Mukhopadhyay, A. K. [Defence Metallurgical Research Laboratory, Hyderabad (India)

2016-08-15

An attempt has been made to understand the influence of retrogression and re-aging (RRA) on the exfoliation corrosion behaviour of AA 7085 alloy in comparison with the peak aged condition (PA). Immersion tests using ASTM G34 and studies involving electrochemical impedance spectroscopy showed that the RRA treated alloy provided higher resistance to exfoliation corrosion than the PA treated alloy. The improved resistance was attributed to the enhanced Cu content and the discontinuous nature of the grain boundary precipitate, which was revealed through transmission electron microscopy.

Side effects of AAS abuse: an overview.

Science.gov (United States)

Turillazzi, E; Perilli, G; Di Paolo, M; Neri, M; Riezzo, I; Fineschi, V

2011-05-01

Anabolic - androgenic steroids (AAS) were originally developed to promote growth of skeletal muscle. AAS abuse is commonly associated with bodybuilders, weightlifters, and other athletes. The issue of AAS toxicity is not yet completely understood since the adverse effects outline a varied scenario with side effects reported affecting many organs and systems in humans. The true incidence of AAS related medical problems is not known, due to several drawbacks in human studies. The entity of side effects depends on the sex, the dose, the duration of treatment, whether they are taken during exercise training or under sedentary conditions, and the susceptibility of the individuals themselves to androgen exposure partly depending on genetic factors. Both the acute and the chronic effects can lead to toxicity, but generally the serious and even fatal effects depend on the time and the duration of AAS administration. A limitation of human studies is represented by the fact that information about the intake of steroids are, generally, self reported and it is hardly possible to assess the exact dosage. AAS are often used in combination with other dugs or substances, so it is difficult to separate their toxic effects from those caused by the other drugs abused. Hence experimental studies conducted on animal models are mandatory to investigate the mechanisms underlying to AAS toxicity and the organ alterations due to these substances. Finally, clinicians should be aware of the complex and varied pattern of toxicity so as to be able to perform correct diagnoses and treatments.

Newer trace elements measured by RNAA and AAS

International Nuclear Information System (INIS)

Gharib, A.G.

2004-01-01

Very recently, quite attention has been made on a few more trace elements in foodstuff as essential for animal and human health in certain ranges of concentration or intake. These traces are: aluminum, nickel, vanadium and tin. Al and Ni have been measured by atomic absorption spectroscopy (AAS), and the two latter ones measured by radiochemical neutron activation analysis (RNAA) in few references laboratories. Here, scandium was also analysed by instrumental neutron activation analysis (INAA). These measurements were made for the most of the Iranian diets and other participant countries' diets under the framework of a co-ordinated research project (CRP) of the IAEA during the period 1986-1994, but practically it took more years. Here in this work the daily dietary intakes of above mentioned trace elements are given and discussed while the results of 20 other nutritionally important trace elements appeared somewhere else. (author)

First circulating beam in the AA

CERN Multimedia

CERN PhotoLab

1980-01-01

On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.56 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are too numerous to name them all, but the 3 most prominent ones are at the centre (left to right): Roy Billinge (Joint AA Project Leader, with his hand on the control box), Eifionydd Jones (white shirt), Simon van der Meer (spiritus rector and Joint AA Project Leader). The first antiprotons were injected, made to circulate and cooled soon after, on 14 July 1980.

The AAS to BAS Pathway: Heating Up the Educational Aspiration of CTE Students

Science.gov (United States)

Kujawa, Tricia A.

2013-01-01

The enrollment and transfer behaviors of college students are diverse. As a result, college students travel various pathways to the baccalaureate degree. The purpose of this qualitative study was to better understand the lived experience of students who entered higher education through an associate of applied science (AAS) program and then…

(PCL/AA) hydrogel for controlled drug delivery

Indian Academy of Sciences (India)

Administrator

applications, (iii) dental applications, (iv) injectable polymers, (v) ... PCL with AA grafted PCL(PCL-g-AA) on the structure ... porosity. Structure, morphology and crystallinity of PCL/ .... X-ray diffraction patterns were recorded, in reflection,.

Comparison of calculated and experimentally determined SID of CP and AA in complex diets differing in AA contents for grower finisher pigs.

Science.gov (United States)

Büsing, K; Berk, A; Müller, S; Kieckhäven, S; Krüger, K; Zeyner, A

2017-10-01

In practice, the content of standardized ileal digestible AA in complex feeds for pigs is calculated on the basis of tabulated values for individual feedstuffs. It comes into question, however, whether this truly reflects an accurate content based upon the estimate made for the individual feedstuffs. The objective of this study was to compare standardized ileal digestibility (SID) of crude protein (CP) and selected AA in complex feeds for grower and finisher pigs either calculated or experimentally determined. Six diets with increasing AA levels were prepared for grower (BW from 30 to 70 kg) and finisher (BW from 70 to 120 kg) feed. Crystalline L-lys, DL-met and L-thr were added to both diets, L-trp and L-val only to the grower feed. SID of both CP and AA was calculated from feed tables and experimentally determined in six adult minipigs (MINILEWE) with ileorectal anastomosis. With increasing AA levels, experimentally determined SID of supplemented AA increased (p AA via tabulated values for individual feedstuffs, however, seems to be acceptable for practical use. Journal of Animal Physiology and Animal Nutrition © 2017 Blackwell Verlag GmbH.

Corrosion Properties of Cryorolled AA2219 Friction Stir Welded Joints Using Different Tool Pin Profiles

Science.gov (United States)

Kamal Babu, K.; Panneerselvam, K.; Sathiya, P.; Noorul Haq, A.; Sundarrajan, S.; Mastanaiah, P.; Srinivasa Murthy, C. V.

The purpose of this paper is to present the corrosion behavior of the Cryorolled (CR) material and its Friction Stir Welded joints. Due to the thermal cycles of Friction Stir Welding (FSW) process, the corrosion behavior of the material gets affected. Here, the cryorolling process was carried out on AA2219 alloy and CR material was joined by FSW process using four different pin tool profiles such as cylindrical, threaded cylindrical, square and hexagonal pin. The FSW joints were analyzed by corrosion resistance with the help of potentiodynamic polarization test with 3.5% NaCl solution. From the analysis, it is found that CR AA2219 material exhibits good corrosion resistance compared to the base AA2219 material, and also a hexagonal pin profile FSW joint exhibits high corrosion resistance. Among the weld joints created by four different tools, the lowest corrosion resistance was found in the cylindrical pin tool FSW welds. Further, the corroded samples were investigated through metallurgical investigations like OM, Transmission Electron Microscopy (TEM), Energy-Dispersive X-ray Spectroscopy (EDX) and X-Ray Diffraction (XRD). It was found that the amount of dissolution of Al2Cu precipitate was present in the weld nugget. The amount of dissolution of Al2Cu precipitate is higher in the weld nugget produced by hexagonal pin tool. This is due to the enhancement of the corrosion resistance.

Dicty_cDB: FC-AA02 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available FC (Link to library) FC-AA02 (Link to dictyBase) - - - Contig-U16527-1 FC-AA02Z (Li...nk to Original site) - - FC-AA02Z 458 - - - - Show FC-AA02 Library FC (Link to library) Clone ID FC-AA02 (Link to dic...linum small subunit ribosomal RNA gene, partial sequence. 149 2e-47 2 AY179984 |AY179984.1 Uncultured alveo... CP000930_2283( CP000930 |pid:none) Heliobacterium modesticaldum Ic... 33 2.3 AP009386_1894( AP009386 |pid:none) Burkholderia multi... EU955514 |pid:none) Zea mays clone 1535262 hypothetica... 50 2e-05 BA000023_1285

Accurate determination of the composition of Y-Ba-Cu-O superconductor by spectrophotometry, gravimetry and flame AAS

International Nuclear Information System (INIS)

Bruneel, E; Verbauwhede, D; Vyver, D Van de; Schaubroeck, J; Hoste, S; Driessche, I Van

2005-01-01

A procedure for the accurate analytical determination of yttrium, barium and copper in an YBa 2 Cu 3 O x superconductor is described. After dissolution of the material the concentration of Y and Cu was spectrophotometrically determined as an Y-Arsenazo III and a Cu-Nitroso-R-salt complex, respectively. Ba was determined either gravimetrically as BaCrO 4 , after precipitation using a K 2 CrO 4 solution or using flame atomic absorption spectroscopy (AAS). An accuracy better than 0.7% and a coefficient of variation better then 1.2% are obtained. It is illustrated that this analytical procedure can be used to determine the composition of a bulk superconducting YBa 2 Cu 3 O x sample. For determination of Ba in thin films we suggest the use of flame AAS, with an accuracy of 0.03% and a coefficient of variation of 1.7%

Characterization of Campylobacter jejuni applying flaA short variable region sequencing, multilocus sequencing and Fourier transform infrared spectroscopy

DEFF Research Database (Denmark)

Josefsen, Mathilde Hartmann; Bonnichsen, Lise; Larsson, Jonas

flaA short variable region sequencing and phenetic Fourier transform infrared (FTIR) spectroscopy was applied on a collection of 102 Campylobacter jejuni isolated from continuous sampling of organic, free range geese and chickens. FTIR has been shown to serve as a valuable tool in typing...

Lamination sheet of AA BST magnet

CERN Multimedia

CERN PhotoLab

1979-01-01

The AA had 2 types of bending magnets: BLG (window-frame, long and narrow)and BST (H-type, short and wide). The BST had a very wide aperture, 0.564 m of "good field". To demonstrate the size, the petite AA secretary, Val Mansfield, poses with a lamination sheet. See also 7811105, 7906163, 8006050.

Geomagnetic aa Indices

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The geomagnetic aa indices are the continuation of the series beginning in the year 1868. A full description of these indices is given in the International...

States' Flexibility Waiver Plans for Alternate Assessments Based on Alternate Achievement Standards (AA-AAS). Synthesis Report 96

Science.gov (United States)

Lazarus, Sheryl S.; Edwards, Lynn M.; Thurlow, Martha L.; Hodgson, Jennifer R.

2014-01-01

All states have alternate assessments based on alternate achievement standards (AA-AAS) for students with the most significant cognitive disabilities. For accountability purposes, the Elementary and Secondary Education Act (ESEA) allows up to 1% of students to be counted as proficient with this assessment option. In 2011 the U.S. Department of…

[AA amyloidosis: a little-known complication of chronic leg ulcer].

Science.gov (United States)

Waton, J; Fays-Michel, S; Chandeclerc, M L; Corby, S; Cuny, J F; Barbaud, A; Schmutz, J-L

2008-02-01

AA amyloidosis, secondary to inflammatory chronic diseases like rheumatoid arthritis, is often complicated by renal failure. Chronic inflammatory dermatoses constitute rare causes of AA amyloidosis. We describe two cases of AA amyloidosis discovered after renal failure in patients presenting leg ulcers for several years. AL amyloidosis was suspected in both cases because of a history of monoclonal gammopathy in one patient and of plasmocytoma in the other. The diagnosis of AA amyloidosis was confirmed on renal histology through the detection of AA antibodies in amyloid deposits. No extrarenal amyloidosis was seen in either patient and there were no inflammatory diseases other than chronic leg ulcers. AA amyloidosis is caused by serum amyloid protein A (SAA), a reactive inflammatory protein. AA amyloidosis is thus caused by chronic inflammatory diseases, but only rarely by cutaneous inflammatory diseases. To our knowledge, the literature contains only seven other published cases of AA amyloidosis secondary to chronic leg ulcers. A review of the literature does not indicate whether cure of ulcers has any effect on the accompanying renal failure. We imagine that AA amyloidosis secondary to leg ulcer is in fact under-diagnosed. However, since the first specific treatment for AA amyloidosis is currently being evaluated by the Food and Drug Administration, it is essential that this serious complication of chronic leg ulcers be widely recognised.

Abia, AA

African Journals Online (AJOL)

Abia, AA. Vol 4, No 6 (2010) - Articles Studies on the kinetics and intraparticle diffusivities of BOD, colour and TSS reduction from palm oil mill effluent (POME) using boiler fly ash. Abstract PDF. ISSN: 1996-0786. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Microsolvation of the acetanilide cation (AA(+)) in a nonpolar solvent: IR spectra of AA(+)-L(n) clusters (L = He, Ar, N2; n ≤ 10).

Science.gov (United States)

Schmies, Matthias; Patzer, Alexander; Schütz, Markus; Miyazaki, Mitsuhiko; Fujii, Masaaki; Dopfer, Otto

2014-05-07

Infrared photodissociation (IRPD) spectra of mass-selected cluster ions of acetanilide (N-phenylacetamide), AA(+)-Ln, with the ligands L = He (n = 1-2), Ar (n = 1-7), and N2 (n = 1-10) are recorded in the hydride stretch (amide A, νNH, νCH) and fingerprint (amide I-III) ranges of AA(+) in its (2)A'' ground electronic state. Cold AA(+)-Ln clusters are generated in an electron impact ion source, which predominantly produces the most stable isomer of a given cluster ion. Systematic vibrational frequency shifts of the N-H stretch fundamentals (νNH) provide detailed information about the sequential microsolvation process of AA(+) in a nonpolar (L = He and Ar) and quadrupolar (L = N2) solvent. In the most stable AA(+)-Ln clusters, the first ligand forms a hydrogen bond (H-bond) with the N-H proton of trans-AA(+) (t-AA(+)), whereas further ligands bind weakly to the aromatic ring (π-stacking). There is no experimental evidence for complexes with the less stable cis-AA(+) isomer. Quantum chemical calculations at the M06-2X/aug-cc-pVTZ level confirm the cluster growth sequence derived from the IR spectra. The calculated binding energies of De(H) = 720 and 1227 cm(-1) for H-bonded and De(π) = 585 and 715 cm(-1) for π-bonded Ar and N2 ligands in t-AA(+)-L are consistent with the observed photofragmentation branching ratios of AA(+)-Ln. Comparison between charged and neutral AA((+))-L dimers indicates that ionization switches the preferred ion-ligand binding motif from π-stacking to H-bonding. Electron removal from the HOMO of AA(+) delocalized over both the aromatic ring and the amide group significantly strengthens the C[double bond, length as m-dash]O bond and weakens the N-H bond of the amide group.

Nanostructured sol-gel coatings doped with cerium nitrate as pre-treatments for AA2024-T3

International Nuclear Information System (INIS)

Zheludkevich, M.L.; Serra, R.; Montemor, M.F.; Yasakau, K.A.; Salvado, I.M. Miranda; Ferreira, M.G.S.

2005-01-01

Nanostructured hybrid sol-gel coatings doped with cerium ions were investigated in the present work as pre-treatments for the AA2024-T3 alloy. The sol-gel films have been synthesized from tetraethylorthosilicate (TEOS) and 3-glycidoxypropyltrimethoxysilane (GPTMS) precursors. Additionally the hybrid sol was doped with zirconia nanoparticles prepared from hydrolyzed tetra-n-propoxyzirconium (TPOZ). Cerium nitrate, as corrosion inhibitor, was added into the hybrid matrix or into the oxide nanoparticles. The chemical composition and the structure of the hybrid sol-gel films were studied by XPS (X-ray photoelectron spectroscopy) and AFM (atomic force microscopy), respectively. The evolution of the corrosion protection properties of the sol-gel films was studied by EIS (electrochemical impedance spectroscopy), which can provide quantitative information on the role of the different pre-treatments. Different equivalent circuits, for different stages of the corrosion processes, were used in order to model the coating degradation. The models were supported by SEM (scanning electron microscopy) measurements. The results show that the sol-gel films containing zirconia nanoparticles present improved barrier properties. Doping the hybrid nanostructured sol-gel coatings with cerium nitrate leads to additional improvement of the corrosion protection. The zirconia particles present in the sol-gel matrix seem to act as nanoreservoirs providing a prolonged release of cerium ions. The nanostructured sol-gel films doped with cerium nitrate can be proposed as a potential candidate for substitution of the chromate pre-treatments for AA2024-T3

Outcomes From AAS Hack Day at the 227th AAS Meeting

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

FIB-SEM investigation of trapped intermetallic particles in anodic oxide films on AA1050 aluminium

DEFF Research Database (Denmark)

Jariyaboon, Manthana; Møller, Per; Dunin-Borkowski, Rafal E.

2011-01-01

-containing intermetallic particles incorporated into the anodic oxide films on industrially pure aluminium (AA1050, 99.5 per cent) has been investigated. AA1050 aluminium was anodized in a 100?ml/l sulphuric acid bath with an applied voltage of 14?V at 20°C ±2°C for 10 or 120?min. The anodic film subsequently was analyzed......Purpose - The purpose of this investigation is to understand the structure of trapped intermetallics particles and localized composition changes in the anodized anodic oxide film on AA1050 aluminium substrates. Design/methodology/approach - The morphology and composition of Fe......-shaped particles were embedded in the anodic oxide film as a thin strip structure and located near the top surface of the film, whereas the round-shaped particles were trapped in the film with a spherical structure, but partially dissolved and were located throughout the thickness of the anodic film. The Fe...

Accurate determination of the composition of Y-Ba-Cu-O superconductor by spectrophotometry, gravimetry and flame AAS

Energy Technology Data Exchange (ETDEWEB)

Bruneel, E [Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281(S3), 9000 Ghent (Belgium); Verbauwhede, D [Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281(S3), 9000 Ghent (Belgium); Vyver, D Van de [Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281(S3), 9000 Ghent (Belgium); Schaubroeck, J [Departement Industriele Wetenschappen, Hogeschool Gent, Schoonmeerstraat 52 9000 Ghent (Belgium); Hoste, S [Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281(S3), 9000 Ghent (Belgium); Driessche, I Van [Department of Inorganic and Physical Chemistry, Ghent University, Krijgslaan 281(S3), 9000 Ghent (Belgium)

2005-06-01

A procedure for the accurate analytical determination of yttrium, barium and copper in an YBa{sub 2}Cu{sub 3}O{sub x} superconductor is described. After dissolution of the material the concentration of Y and Cu was spectrophotometrically determined as an Y-Arsenazo III and a Cu-Nitroso-R-salt complex, respectively. Ba was determined either gravimetrically as BaCrO{sub 4}, after precipitation using a K{sub 2}CrO{sub 4} solution or using flame atomic absorption spectroscopy (AAS). An accuracy better than 0.7% and a coefficient of variation better then 1.2% are obtained. It is illustrated that this analytical procedure can be used to determine the composition of a bulk superconducting YBa{sub 2}Cu{sub 3}O{sub x} sample. For determination of Ba in thin films we suggest the use of flame AAS, with an accuracy of 0.03% and a coefficient of variation of 1.7%.

Fabrication of AA6061-T6 Plate Type Fuel Assembly Using Electron Beam Welding Process

International Nuclear Information System (INIS)

Kim, Soosung; Seo, Kyoungseok; Lee, Donbae; Park, Jongman; Lee, Yoonsang; Lee, Chongtak

2014-01-01

AA6061-T6 aluminum alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW. However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the nuclear fuel plate fabrication and assembly, a fundamental EBW experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the fuel plate assembly has been also studied by the shrinkage measurement and weld inspection using computed tomography. This study was carried out to determine the suitable welding parameters and to evaluate tensile strength of AA6061-T6 aluminum alloy. In the present experiment, satisfactory electron beam welding process of the full-sized sample was being developed. Based on this fundamental study, fabrication of the plate-type fuel assembly will be provided for the future Ki-Jang research reactor project

Microstructural development from interdiffusion and reaction between U−Mo and AA6061 alloys annealed at 600° and 550 °C

Energy Technology Data Exchange (ETDEWEB)

Perez, E., E-mail: Emmanuel.Perez@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Keiser, D.D., E-mail: dennis.keiser@inl.gov [Nuclear Fuels and Materials Division, Idaho National Laboratory, P.O. Box 1625, Idaho Falls, ID 83415-6188 (United States); Sohn, Y.H., E-mail: yongho.sohn@ucf.edu [Department of Materials Science and Engineering, University of Central Florida, 4000 Central Florida Blvd., Orlando, FL 32816 (United States)

2016-08-15

The U.S. Material Management and Minimization Reactor Conversion Program is developing low enrichment fuel systems encased in Al-alloy for use in research and test reactors. Monolithic fuel plates have local regions where the U−Mo fuel plate may come into contact with the Al-alloy 6061 (AA6061) cladding. This results in the development of interdiffusion zones with complex microstructures with multiple phases. In this study, the microstructural development of diffusion couples, U−7 wt%Mo, U−10 wt%Mo, and U−12 wt%Mo vs. AA6061, annealed at 600 °C for 24 h and at 550 °C for 1, 5, and 20 h, were analyzed by scanning electron microscopy with x-ray energy dispersive spectroscopy. The microstructural development and kinetics were compared to diffusion couples U−Mo vs. high purity Al and binary Al−Si alloys. The diffusion couples developed complex interaction regions where phase development was influenced by the alloying additions of the AA6061. - Highlights: • Diffusion couples of U−7Mo, U−10Mo, and U−12Mo vs. AA6061 were analyzed by SEM with XEDS. • The couples were annealed at 600 °C for 24 h and at 550 °C for 1, 5 and 20 h. • The interaction regions were more complex than those in diffusion couples of U−Mo vs. high purity Al and Al−Si alloys. • Analysis showed that the alloying additions of the AA6061 were present in the interaction regions. • Phase development was significantly influenced by the alloying additions of the AA6061.

Applying Quantum Cascade Laser Spectroscopy in Plasma Diagnostics

Directory of Open Access Journals (Sweden)

Jürgen Röpcke

2016-07-01

Full Text Available The considerably higher power and wider frequency coverage available from quantum cascade lasers (QCLs in comparison to lead salt diode lasers has led to substantial advances when QCLs are used in pure and applied infrared spectroscopy. Furthermore, they can be used in both pulsed and continuous wave (cw operation, opening up new possibilities in quantitative time resolved applications in plasmas both in the laboratory and in industry as shown in this article. However, in order to determine absolute concentrations accurately using pulsed QCLs, careful attention has to be paid to features like power saturation phenomena. Hence, we begin with a discussion of the non-linear effects which must be considered when using short or long pulse mode operation. More recently, cw QCLs have been introduced which have the advantage of higher power, better spectral resolution and lower fluctuations in light intensity compared to pulsed devices. They have proved particularly useful in sensing applications in plasmas when very low concentrations have to be monitored. Finally, the use of cw external cavity QCLs (EC-QCLs for multi species detection is described, using a diagnostics study of a methane/nitrogen plasma as an example. The wide frequency coverage of this type of QCL laser, which is significantly broader than from a distributed feedback QCL (DFB-QCL, is a substantial advantage for multi species detection. Therefore, cw EC-QCLs are state of the art devices and have enormous potential for future plasma diagnostic studies.

Early Design Stage of the MsAa-4 Moessbauer Spectrometer

International Nuclear Information System (INIS)

Blachowski, A.; Ruebenbauer, K.; Zukrowski, J.; Gornicki, R.

2008-01-01

Entirely new Moessbauer spectrometer MsAa-4 is currently under design and construction. New features as compared to the basic features of the previous generation MsAa-3 spectrometer could be summarized as follows. Completely digital processing of the γ-ray detector signal beyond the Gaussian shape filter/amplifier is to be implemented. The spectrometer is going to be able to accommodate external multiple detector heads. One could collect simultaneously up to 128 γ-ray spectra in 16384 channels of 32-bit each and up to 512 Moessbauer spectra in 4096 channels of 32-bit each provided the proper external multiple detector head is used. The count-rate per single detector is limited to about 105 counts per second total. Improved precision of the reference function from 12-bit to 16-bit is to be provided. The reference function is stored in 8192 channels per complete cycle. Addition of the random noise to the reference corner prism of the Michelson-Morley calibration interferometer is to be introduced to avoid spurious fringes due to the phase lock-up. Integrated universal temperature controller being able to use variety of the temperature sensors is to be interconnected with the proper spectrometer. The spectrometer is now a stand-alone network device as it is equipped with the Ethernet connection to the outside world. Modular design and use of the strict standards allows easy reconfiguration for other applications than the Moessbauer spectroscopy. (authors)

Characteristics of AA amyloidosis patients in San Francisco.

Science.gov (United States)

Lejmi, Hiba; Jen, Kuang-Yu; Olson, Jean L; James, Sam H; Sam, Ramin

2016-04-01

AA amyloidosis due to subcutaneous injection of drugs of abuse has been described in the USA, but all the existing literature is from more than 20 years ago. There is more recent literature from Europe. We have observed a high incidence of AA amyloidosis in the county hospital in San Francisco. Here, we describe 24 patients who had kidney biopsy-proven AA amyloidosis from our hospital from 1998 to 2013. All the patients were thought to have AA amyloidosis from skin popping of illicit drugs after having exhausted the intravenous route. These patients with biopsy-proven AA amyloidosis were analysed further. All patients were found to have hepatitis C infection, hypertension was not common, most had advanced kidney failure, and acidosis was common as was tubulointerstitial involvement on the kidney biopsy. Other organ involvement included hepatomegaly and splenomegaly in a number of patients; direct myocardial involvement was not seen, but pulmonary hypertension, history of deep vein thrombosis and pulmonary embolism were common. The prognosis of these patients was poor. The mortality rate approached 50% 1 year after biopsy, and most of the patient needed dialysis shortly after diagnosis. Cessation of drug use seemed beneficial but rarely achievable. AA amyloidosis from skin popping is common in San Francisco. Most patients with renal involvement end up on dialysis, and mortality rates are exceedingly high. © 2015 Asian Pacific Society of Nephrology.

The Antiproton Accumulator (AA)

CERN Multimedia

1980-01-01

Section 06 - 08*) of the AA where the dispersion (and hence the horizontal beam size) is large. One can distinguish (left to right): A vacuum-tank, two bending magnets (BST06 and BST07 in blue) with a quadrupole (QDN07, in red) in between, another vacuum-tank, a wide quadrupole (QFW08) and a further tank . The tanks are covered with heating tape for bake-out. The tank left of BST06 contained the stack core pickup for stochastic cooling (see 7906193, 7906190, 8005051), the two other tanks served mainly as vacuum chambers in the region where the beam was large. Peter Zettwoch works on BST06. *) see: H. Koziol, Antiproton Accumulator Parameter List, PS/AA/Note 84-2 (1984)

Effect of pressurized steam on AA1050 aluminium

DEFF Research Database (Denmark)

Jariyaboon, Manthana; Møller, Per; Ambat, Rajan

2012-01-01

Purpose - The purpose of this paper is to understand the effect of pressurized steam on surface changes, structures of intermetallic particles and corrosion behavior of AA1050 aluminium. Design/methodology/approach - Industrially pure aluminium (AA1050, 99.5 per cent) surfaces were exposed...... reactivities was observed due to the formation of the compact oxide layer. Originality/value - This paper reveals a detailed investigation of how pressurized steam can affect the corrosion behaviour of AA1050 aluminium and the structure of Fe-containing intermetallic particles....

Reinforcement with alumina particles at the interface region of AA6101-T6 and AA1350 alloys during friction stir welding

Science.gov (United States)

Ashok Kumar, R.; Thansekhar, M. R.

2018-04-01

This paper deals the combinational effect of friction stir welding and friction stir processing on dissimilar AA6101-T6 and AA1350 aluminium alloys. For that, alumina particles are reinforced at interface region of AA6101-T6 and AA1350 aluminium alloys. Friction Stir Welding and Friction Stir Processing are done simultaneously for various sizes of groove. To analyze the welding quality and surface modifications, mechanical, wear and microstructural tests are carried out. Among these, smallest groove of 0.5 mm width and 1 mm depth reveals highest tensile and bending strengths and largest groove of 2 mm width and 3 mm depth gives maximum hardness and wear resistance. Taguchi technique shows that groove width is most influencing parameter. Developed second order models with interaction predict the responses with minimum error.

Terahertz time-domain attenuated total reflection spectroscopy applied to the rapid discrimination of the botanical origin of honeys

Science.gov (United States)

Liu, Wen; Zhang, Yuying; Yang, Si; Han, Donghai

2018-05-01

A new technique to identify the floral resources of honeys is demanded. Terahertz time-domain attenuated total reflection spectroscopy combined with chemometrics methods was applied to discriminate different categorizes (Medlar honey, Vitex honey, and Acacia honey). Principal component analysis (PCA), cluster analysis (CA) and partial least squares-discriminant analysis (PLS-DA) have been used to find information of the botanical origins of honeys. Spectral range also was discussed to increase the precision of PLS-DA model. The accuracy of 88.46% for validation set was obtained, using PLS-DA model in 0.5-1.5 THz. This work indicated terahertz time-domain attenuated total reflection spectroscopy was an available approach to evaluate the quality of honey rapidly.

Simon van der Meer in the AA Control Room

CERN Multimedia

CERN PhotoLab

1984-01-01

Simon van der Meer, spiritus rector of the Antiproton Accumulator, in the AA Control Room. Inventor of stochastic cooling, on which the AA was based, and of the magnetic horn, with which the antiprotons were focused, he also wrote most of the software with which the AA was controlled, and spent uncountable numbers of hours in this chair to tickle the AA to top performance. 8 months after this picture was taken, he received, in October 1984, the Nobel prize, together with Carlo Rubbia, the moving force behind the whole Proton-Antiproton Collider project that led to the discovery, in 1983, of the W and Z intermediate bosons.

Inclusive cross sections in AA collisions at high energies

International Nuclear Information System (INIS)

Braun, M.A.

1988-01-01

Inclusive cross sections in AA collisions at high energies are considered in the Glauber multiple scattering theory taking into account many-nucleon collisions. Correspondence is found between the AA amplitude and the effective action of the two-dimensional quantum field theory with exponential interaction. The tree and one-loop contributions are calculated in this formalism. The rules are derived, which relate the absorption part of the AA-collision amplitudes associated with various inclusive cross sections to the absorption parts of NN amplitudes. These rules generalize the well-known Agranowsky-Gribov-Kanchelli rules for hh and hA collisions. Formulas are written for single and double inclusive cross sections in AA collisions

Bake hardening of nanograin AA7075 aluminum alloy

International Nuclear Information System (INIS)

Dehghani, Kamran

2011-01-01

Highlights: ► The bake hardening behavior of AA7075 was studied and compared with its coarse-grain counterpart. ► Nanograin AA7075 exhibited 88–100% increase in bake hardenability. ► Nanograin AA7075 exhibited 36–38% increase in final yield strength after baking. ► Maximum bake hardenability and final yield stress were about 185 MPa and 719 MPa. - Abstract: In the present work, the bake hardening of nanostructured AA7075 aluminum alloy was compared with that of its coarse-grain counterpart. Surface severe plastic deformation (SSPD) was used to produce nanograin layers on both surfaces of workpieces. The nanostructured layers were characterized using scanning electron microscopy (SEM) and atomic force microscopy (AFM) techniques. The thickness of nanostructured layer, having the grains of 50–110 nm, was about 75 μm on each side of workpiece. The bake hardenability of nanograin and coarse-grain AA7075 was then compared by pre-straining to 2, 4 and 6% followed by baking at 100 °C and 200 °C for 20 min. Comparing to coarse-grain case, there was about 88–100% increase in bake hardenability and about 36–38% increase in yield strength after the bake hardening of present nanograin AA7075. Such an increase in bake hardenability and strength was achieved when the thickness of two nanograin layers was about only one-tenth of the whole thickness.

Androgen Ablation Augments Prostate Cancer Vaccine Immunogenicity Only When Applied After Immunization

Science.gov (United States)

Koh, Yi T.; Gray, Andrew; Higgins, Sean A.; Hubby, Bolyn; Kast, W. Martin

2009-01-01

Background Androgen ablation (AA) causes apoptosis of normal and neoplastic prostate cells. It is a standard treatment for advanced prostate cancer. Androgen ablation-mediated immunological effects include bone marrow hyperplasia, thymic regeneration, T and B cell lymphopoeisis and restoration of age-related peripheral T cell dysfunction. Androgens also regulate the transcription of several cytokines. Dendritic cells (DC) are the most potent antigen presenting cells that can activate antigen-specific naïve T cells. Despite myriad clinical trials involving DC-based prostate cancer immunotherapies, the effects of AA on DC function remain largely uncharacterized. Therefore, we investigated the effects of AA on DC and whether it could improve the efficacy of prostate cancer immunotherapy. Methods Cytokine expression changes due to AA were quantified by multiplex ELISA. Flow cytometry was used to assess AA-mediated effects on DC maturation and expression of costimulatory markers. Mixed leukocyte reactions and cell-mediated lysis assays elucidated the role of androgens in DC function. The effect of AA on the efficacy of vaccination against a prostate tumor-associated antigen was tested using Elispot assays. Results Androgen ablation increased dendritic cell maturation and costimulatory marker expression, but had no effect on DC costimulatory function. However, DC isolated from castrated mice increased the expression of key cytokines by antigen-experienced T cells while decreasing their expression in naïve cells. Finally, androgen ablation improved immune responses to vaccination only when applied after immunization. Conclusion Androgen ablation causes differential effects of DC on primary and secondary T cell responses, thus augmenting vaccine immunogenicity only when applied after immunization. PMID:19143030

Introducing the AAS Working Group on Astroinformatics and Astrostatistics

Science.gov (United States)

Ivezic, Zeljko

2014-01-01

In response to two White Papers submitted to the Astro2010 Decadal Survey (1,2), a new AAS Working Group on Astroinformatics and Astrostatistics (WGAA) has been approved by the AAS Council at the 220th Meeting, June 2012, in Anchorage. The motivation for this WG is the growing importance of the interface between astronomy and various branches of applied mathematics, computer science and the emerging field of data science. With the new data-intensive projects envisioned for the coming decade, the need for advice derived from the focused attention of a group of AAS members who work in these areas is bound to increase. The Working Group is charged with spreading awareness of rapidly advancing computational techniques, sophsticated statistical methods, and highly capble software to further the goals of astronomical and astrophysical research. The three main strategic goals adopted by the WGAA Steering Committee for the next few years are to: (i) develop, organize and maintain methodological resources (such as software tools, papers, books, and lectures); (ii) enhance human resources (such as foster the creation of career paths, establish a Speakers' Bureau, establish and maintain an archived discussion forum, enable periodic news distribution); and (iii) organize topical meetings. The WGAA Steering Committee at this time includes twelve members: Kirk Borne, George Djorgovski, Eric Feigelson, Eric Ford, Alyssa Goodman, Joe Hilbe, Zeljko Ivezic (chair), Ashish Mahabal, Aneta Siemiginowska, Alex Szalay, Rick White, and Padma Yanamandra-Fisher. I will summarize our accomplishments since July 2012. (1) Astroinformatics: A 21st Century Approach to Astronomy (Borne & 90 coauthors), (2) The Astronomical Information Sciences: A Keystone for 21st-Century Astronomy (Loredo & 72 coauthors)

Mechanical and corrosion properties of AA8011 sheets and foils:

OpenAIRE

Asanović, Vanja; Dalijić, Kemal; Radonjić, Dragan

2006-01-01

The mechanical and corrosion properties of a twin-roll cast Al-Fe-Si aluminum alloy with 0.74 % Fe and 0.52 % Si (AA8011) were investigated. The influence of the thermo-mehanical processing route on the mechanical behavior of AA8011 sheets was determined. Comparisons were made with AA3003 and A199.5 sheets. The restoration of the mechanical properties was used in the analysis of the recrystallization behavior of the twin-roll cast AA8011 alloy deformed under cold-working conditions and subseq...

Fred-Jaiyesimi, AA

African Journals Online (AJOL)

Fred-Jaiyesimi, AA. Vol 12 (2008) - Articles Hypoglycaemic And Alpha-Amylase Inhibitory Activities Of Fermented Seeds Of Parkia Biglobosa (Jacq) Benth Abstract. ISSN: 1118-6267. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

Evaluation of Shifted Excitation Raman Difference Spectroscopy and Comparison to Computational Background Correction Methods Applied to Biochemical Raman Spectra.

Science.gov (United States)

Cordero, Eliana; Korinth, Florian; Stiebing, Clara; Krafft, Christoph; Schie, Iwan W; Popp, Jürgen

2017-07-27

Raman spectroscopy provides label-free biochemical information from tissue samples without complicated sample preparation. The clinical capability of Raman spectroscopy has been demonstrated in a wide range of in vitro and in vivo applications. However, a challenge for in vivo applications is the simultaneous excitation of auto-fluorescence in the majority of tissues of interest, such as liver, bladder, brain, and others. Raman bands are then superimposed on a fluorescence background, which can be several orders of magnitude larger than the Raman signal. To eliminate the disturbing fluorescence background, several approaches are available. Among instrumentational methods shifted excitation Raman difference spectroscopy (SERDS) has been widely applied and studied. Similarly, computational techniques, for instance extended multiplicative scatter correction (EMSC), have also been employed to remove undesired background contributions. Here, we present a theoretical and experimental evaluation and comparison of fluorescence background removal approaches for Raman spectra based on SERDS and EMSC.

Laser spectroscopy applied to environmental, ecological, food safety, and biomedical research.

Science.gov (United States)

Svanberg, Sune; Zhao, Guangyu; Zhang, Hao; Huang, Jing; Lian, Ming; Li, Tianqi; Zhu, Shiming; Li, Yiyun; Duan, Zheng; Lin, Huiying; Svanberg, Katarina

2016-03-21

Laser spectroscopy provides many possibilities for multi-disciplinary applications in environmental monitoring, in the ecological field, for food safety investigations, and in biomedicine. The paper gives several examples of the power of multi-disciplinary applications of laser spectroscopy as pursued in our research group. The studies utilize mostly similar and widely applicable spectroscopic approaches. Air pollution and vegetation monitoring by lidar techniques, as well as agricultural pest insect monitoring and classification by elastic scattering and fluorescence spectroscopy are described. Biomedical aspects include food safety applications and medical diagnostics of sinusitis and otitis, with strong connection to the abatement of antibiotics resistance development.

AAS 227: Day 2

Science.gov (United States)

Kohler, Susanna

2016-01-01

tests of GR, and performing predictive GRMHD simulations hydrodynamics simulations that include magnetic fields and full GR treatment. Ozel pointed out that one of the recent theoretical advancements in GRMHD simulations is harnessing the power of GPUs to render images in simulations; check out the tweet below for the awesome video she showed us!Watch C. Chan manipulate black hole simulation with hand motions https://t.co/O5BgaltYAu (more on the code: https://t.co/9GC46ReMGs) #aas227 Sarah Scoles (@ScolesSarah) January 6, 2016Deployment of the full EHT array is planned for early 2017, and theyve already got 10 targets selected black holes that are near enough and large enough that the EHT should be able to image their shadows. I, for one, cant wait to see the first results!Grad School and Postdocs as a Means to a Job (by Meredith Rawls)This morning session was presented by Karen Kelsky of The Professor Is In. She presented a very practical overview of the advice in her book (which this job-searching Astrobiter highly recommends). Her target audience is postdocs and graduate students who are finishing their PhDs and applying for tenure-track jobs. Karens background is in the social sciences, but she has worked with many scientists and her expertise easily transferred. Much of her writing advice also applies for undergraduates who are writing research statements and proposals to apply to graduate school. For example:What not to do, with @ProfessorIsIn #aas227 pic.twitter.com/afGAsSuPwN Meredith Rawls (@merrdiff) January 6, 2016One of Karens main takeaways is that academia is not automatically good preparation for a job search. Writing documents like cover letters, resumes, and research statements will be harder and take more time than you think, and it is important to make them top-notch. Karen was also surprised that the majority of professional astronomers at the AAS meeting carry backpacks, because she typically advises against bringing a backpack to a job interview or

Displaying Now-Understanding: The Finnish Change-of-State Token "aa"

Science.gov (United States)

Koivisto, Aino

2015-01-01

This article discusses the use of the Finnish change-of-state token "aa" that has previously not been identified. The central claim is that even though "aa" indicates a cognitive shift experienced by the speaker, it does not function as a receipt of new information. Instead, the token "aa" indicates that the speaker…

Evaluation of Electron Beam Welding Performance of AA6061-T6 Plate-type Fuel Assembly

International Nuclear Information System (INIS)

Kim, Soo-Sung; Seo, Kyoung-Seok; Lee, Don-Bae; Park, Jong-Man; Lee, Yoon-Sang; Lee, Chong-Tak

2014-01-01

As one of the most commonly used heat-treatable aluminum alloys, AA6061-T6 aluminum alloy is available in a wide range of structural materials. Typically, it is used in structural members, auto-body sheet and many other applications. Generally, this alloy is easily welded by conventional GTAW (Gas Tungsten Arc Welding), LBW (Laser Beam Welding) and EBW(Electron Beam Welding). However, certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes possess the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the plate-type nuclear fuel fabrication and assembly, a fundamental electron beam welding experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the suitable welding process, and satisfy the requirements of the weld quality, EBW apparatus using an electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. The EB weld quality of AA6061-T6 aluminum alloy for the plate-type fuel assembly has been also studied by the weld penetrations of side plate to end fitting and fixing bar and weld inspections using computed tomography

Dynamic Response and Microstructure Evolution of AA2219-T4 and AA2219-T6 Aluminum Alloys

Science.gov (United States)

Olasumboye, A.; Owolabi, G.; Odeshi, A.; Zeytinci, A.; Yilmaz, N.

2018-02-01

In this study, the dynamic deformation behavior of AA2219 aluminum alloy was investigated in two different temper conditions: T4 and T6, with a view to determining the effect of heat treatment on the microstructure and flow behavior of the material under high strain rates. Split Hopkinson pressure bar experiment was used in determining the dynamic response of the alloy while a digital image correlation system was employed in visualizing and tracking the surface deformation of the specimens. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. The results obtained showed heterogeneous deformation of the alloy in the two temper conditions. It was observed that the dynamic mechanical behavior of each sample preparation was dependent on its strength properties due to aging type, which in turn controls the metamorphosis of the strengthening precipitates and the initial microstructure. At the maximum strain rate of 3500 s-1, transformed bands leading to crack nucleation was observed in the AA2219-T4 aluminum alloy while AA2219-T6 had fractured at the same strain rate. The modes of crack formation and growth in the two alloys were found to be similar: nucleation, growth and coalescence of voids. However, shear band bifurcation phenomenon was observed only in the AA2219-T6 alloy.

Effectiveness of Anabolic Steroid Preventative Intervention among Gym Users: Applying Theory of Planned Behavior

Directory of Open Access Journals (Sweden)

Abbas Moghimbeigi

2011-07-01

Full Text Available Background: Use of anabolic androgenic steroids (AAS has been associated with adversephysical and psychiatric effects and it is known as rising problem among youth people. Thisstudy was conducted to evaluate anabolic steroids preventative intervention efficiency amonggym users in Iran and theory of planned behaviour was applied as theoretical framework.Methods: Overall, 120 male gym users participated in this study as intervention and controlgroup. This was a longitudinal randomized pretest - posttest series control group design panelstudy to implement a behaviour modification based intervention to prevent AAS use. Cross -tabulation and t-test by using SPSS statistical package, version 13 was used for the statisticalanalysis.Results: It was found significant improvements in average response for knowledge about sideeffects of AAS (P<0.001, attitude toward, and intention not to use AAS. Additionally afterintervention, the rate of AAS and supplements use was decreased among intervention group.Conclusion: Comprehensive implementation against AAS abuse among gym users and adolescenceswould be effective to improve adolescents’ healthy behaviors and intend them notto use AAS.

Spontaneous, Experimentally Induced, and Transmissible AA Amyloidosis in Japanese Quail ( Coturnix japonica).

Science.gov (United States)

Nakayama, Yumi; Kamiie, Junichi; Watanabe, Gen; Suzuki, Kazuhiko; Murakami, Tomoaki

2017-11-01

The authors describe a spontaneous case of amyloid A (AA) amyloidosis in an adult female Japanese quail ( Coturnix japonica). The bird developed AA amyloidosis secondary to chronic peritonitis caused by a Gram-negative bacillus infection. Mild amyloid deposition was also identified in the intestinal tract of apparently healthy adult individuals, suggesting that quail may develop intestinal amyloidosis with age. Based on these observations, it was hypothesized that quail can develop AA amyloidosis following inflammatory stimulation with lipopolysaccharide (LPS). Therefore, adult quail were repeatedly injected with LPS and the development of AA amyloidosis was confirmed. The amyloid deposition in this model increased when quail amyloid was intravenously injected as an amyloid-enhancing factor. The experiments were repeated with young quail, but amyloid deposits were not observed following LPS injections. However, AA amyloidosis did develop when quail amyloid was injected in addition to LPS. These results indicated that adult quail develop AA amyloidosis after inflammatory stimulation with LPS. Furthermore, quail AA amyloidosis was shown to have transmissibility regardless of age. Interestingly, the authors found that administration of chicken amyloid fibrils also induced AA amyloidosis in young quail. This is the first report of cross-species transmission of avian AA amyloidosis.

Effects of Friction Stir Welding on Corrosion Behaviors of AA2024-T4 Aluminum Alloy

Directory of Open Access Journals (Sweden)

Ales Steve Korakan

2017-01-01

Full Text Available In this work, the corrosion behavior of welded joints of AA2024-T4 Al alloy produced by friction stir welding process has been investigated. Tests were performed in an aerated 3.5% NaCl aqueous solution with pH = 7 at 20±2°C. Corrosion rate and corrosion morphology of weld regions were evaluated and compared to those of the parent metal. The microstructure of weld nugget, thermomechanical affected zone, heated affected zone, and parent metal were analyzed using scanning electron microscopy and energy dispersive spectroscopy. It was observed that corrosion initiated at FSW related spots and the sizes of local corrosion increased with time.

Tensile behavior of friction stir welded AA 6061-T4 aluminum alloy joints

International Nuclear Information System (INIS)

Heidarzadeh, A.; Khodaverdizadeh, H.; Mahmoudi, A.; Nazari, E.

2012-01-01

Highlights: ► Range of parameters for defect-free friction stir welded AA 6061-T4 was reached. ► A model was developed for predicting UTS and EL of friction stir welded AA 6061-T4. ► The maximum values of UTS and EL of joints were estimated by developed model. ► The optimum values of FSW process parameters were determined. -- Abstract: In this investigation response surface methodology based on a central composite rotatable design with three parameters, five levels and 20 runs, was used to develop a mathematical model predicting the tensile properties of friction stir welded AA 6061-T4 aluminum alloy joints at 95% confidence level. The three welding parameters considered were tool rotational speed, welding speed and axial force. Analysis of variance was applied to validate the predicted model. Microstructural characterization and fractography of joints were examined using optical and scanning electron microscopes. Also, the effects of the welding parameters on tensile properties of friction stir welded joints were analyzed in detail. The results showed that the optimum parameters to get a maximum of tensile strength were 920 rev/min, 78 mm/min and 7.2 kN, where the maximum of tensile elongation was obtained at 1300 rev/min, 60 mm/min and 8 kN.

AA Attendance and Abstinence for Dually Diagnosed Patients: A Meta-Analytic Review.

Science.gov (United States)

Scott Tonigan, J; Pearson, Matthew R; Magill, Molly; Hagler, Kylee J

2018-05-29

There is consensus that best clinical practice for dual diagnosis (DD) is integrated mental health and substance use treatment augmented with Alcoholics Anonymous (AA) attendance. This is the first quantitative review of the direction and magnitude of the association between AA attendance and alcohol abstinence for DD patients. A systematic literature search (1993-2017) identified 22 studies yielding 24 effect sizes that met our inclusion criteria (8,075 patients). Inverse-variance weighting of correlation coefficients (r) was used to aggregate sample-level findings and study aims were addressed using random and mixed effect models. Sensitivity and publication bias analyses were conducted to assess the likelihood of bias in the overall estimate of AA-related benefit. AA exposure and abstinence for DD patients were significantly and positively associated (r w =.249; 95% CI.203-.293; Tau=.097). There was also significant heterogeneity in the distribution of effect sizes, (Q(23)=90.714, pAA-related benefit did not differ between 6 (k=7) and 12 (k=12) month follow-up, (Q=.068, pAA benefit was not adversely or substantively impacted by pooling RCT and observational samples (Q=.763, pAA (Q=.023, pAA) is common and, in many cases, DD patients who attend AA will report higher rates of alcohol abstinence relative to DD patients who do not attend AA. This article is protected by copyright. All rights reserved.

Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo.

Science.gov (United States)

Jing, Yue; Wang, Gang; Xiao, Qi; Zhou, Yachun; Wei, Yingjie; Gong, Zhunan

2018-01-01

Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA) has demonstrated anticancer properties and we suspect this might be attributable to an effect on angio-genesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-L-proline methyl ester (AA-PMe), has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs). First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF) present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2)-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP) transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline phosphatase assay. VEGFR2 expression in whole embryos following AA-PMe treatment was also determined. We found AA-PMe decreased cell viability and inhibited migration and tube formation in a dose-dependent manner in HUVECs. Similarly, AA-PMe disrupted the formation of intersegmental vessels, the dorsal aorta, and the posterior cardinal vein in zebrafish embryos. Both in vitro and in vivo AA-PMe surpassed AA in its ability to block angiogenesis by suppressing VEGF-induced phosphorylation of VEGFR2 and disrupting downstream extracellular regulated protein kinase and AKT signaling. For the first time

Noise-spectroscopy of multiqubit systems: Determining all their parameters by applying an external classical noise

Energy Technology Data Exchange (ETDEWEB)

Savel' ev, S., E-mail: S.Saveliev@lboro.ac.uk [Department of Physics, Loughborough University, Leicestershire LE11 3TU (United Kingdom); Advanced Science Institute, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Zagoskin, A.M. [Department of Physics, Loughborough University, Leicestershire LE11 3TU (United Kingdom); Advanced Science Institute, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Omelyanchouk, A.N. [Advanced Science Institute, RIKEN, Wako-shi, Saitama 351-0198 (Japan); B. Verkin Institute for Low Temperature Physics and Engineering, 61103 Kharkov (Ukraine); Nori, Franco [Advanced Science Institute, RIKEN, Wako-shi, Saitama 351-0198 (Japan); Physics Department, University of Michigan, Ann Arbor, MI 48109-1040 (United States)

2010-10-05

Imagine that you have several sets of two coupled qubits, but you do not know the parameters of their Hamitonians. How to determine these without resorting to the usual spectroscopy approach to the problem? Based on numerical modeling, we show that all the parameters of a system of two coupled qubits can be determined by applying to it an external classical noise and analyzing the Fourier spectrum of the elements of the system's density matrix. In particular, the interlevel spacings as well as the strength and sign of the qubit-qubit coupling can be determined this way.

Controlled release of bioactive PDGF-AA from a hydrogel/nanoparticle composite.

Science.gov (United States)

Elliott Donaghue, Irja; Shoichet, Molly S

2015-10-01

Polymer excipients, such as low molar mass poly(ethylene glycol) (PEG), have shown contradictory effects on protein stability when co-encapsulated in polymeric nanoparticles. To gain further insight into these effects, platelet-derived growth factor (PDGF-AA) was encapsulated in polymeric nanoparticles with vs. without PEG. PDGF-AA is a particularly compelling protein, as it has been demonstrated to promote cell survival and induce the oligodendrocyte differentiation of neural stem/progenitor cells (NSPCs) both in vitro and in vivo. Here we show, for the first time, the controlled release of bioactive PDGF-AA from an injectable nanoparticle/hydrogel drug delivery system (DDS). PDGF-AA was encapsulated, with high efficiency, in poly(lactide-co-glycolide) nanoparticles, and its release from the drug delivery system was followed over 21 d. Interestingly, the co-encapsulation of low molecular weight poly(ethylene glycol) increased the PDGF-AA loading but, unexpectedly, accelerated the aggregation of PDGF-AA, resulting in reduced activity and detection by enzyme-linked immunosorbent assay (ELISA). In the absence of PEG, released PDGF-AA remained bioactive as demonstrated with NSPC oligodendrocyte differentiation, similar to positive controls, and significantly different from untreated controls. This work presents a novel delivery method for differentiation factors, such as PDGF-AA, and provides insights into the contradictory effects reported in the literature of excipients, such as PEG, on the loading and release of proteins from polymeric nanoparticles. Previously, the polymer poly(ethylene glycol) (PEG) has been used in many biomaterials applications, from surface coatings to the encapsulation of proteins. In this work, we demonstrate that, unexpectedly, low molecular weight PEG has a deleterious effect on the release of the encapsulated protein platelet-derived growth factor AA (PDGF-AA). We also demonstrate release of bioactive PDGF-AA (in the absence of PEG

Modification of Cry4Aa toward Improved Toxin Processing in the Gut of the Pea Aphid, Acyrthosiphon pisum.

Directory of Open Access Journals (Sweden)

Michael A Rausch

Full Text Available Aphids are sap-sucking insects (order: Hemiptera that cause extensive damage to a wide range of agricultural crops. Our goal was to optimize a naturally occurring insecticidal crystalline (Cry toxins produced by the soil-dwelling bacterium Bacillus thuringiensis for use against the pea aphid, Acyrthosiphon pisum. On the basis that activation of the Cry4Aa toxin is a rate-limiting factor contributing to the relatively low aphicidal activity of this toxin, we introduced cathepsin L and cathepsin B cleavage sites into Cry4Aa for rapid activation in the aphid gut environment. Incubation of modified Cry4Aa and aphid proteases in vitro demonstrated enhanced processing of the toxin into the active form for some of the modified constructs relative to non-modified Cry4Aa. Aphids fed artificial diet with toxin at a final concentration of 125 μg/ml showed enhanced mortality after two days for one of the four modified constructs. Although only modest toxin improvement was achieved by use of this strategy, such specific toxin modifications designed to overcome factors that limit aphid toxicity could be applied toward managing aphid populations via transgenic plant resistance.

Magnetic horn of the Antiproton Accumulator (AA)

CERN Multimedia

Photographic Service

1988-01-01

In the 1960s, the invention of this "current sheet lens" has helped to greatly improve the flux of neutrino beams. It was used again at the AA, collecting antiprotons from the production target at angles too large to fit into the acceptance of the AA. It was machined from aluminium to a thickness of 1.4 mm and pulsed at 400 kA for 15 microseconds (half-sine).

Inhibitory effect of propolis on the development of AA amyloidosis.

Science.gov (United States)

Harata, Daichi; Tsuchiya, Yuya; Miyoshi, Tomoyuki; Yanai, Tokuma; Suzuki, Kazuhiko; Murakami, Tomoaki

2018-04-01

In the several types of amyloidoses, participation of oxidative stresses in the pathogenesis and the effect of antioxidants on amyloidosis have been reported. Meanwhile, the relationship between oxidative stresses and pathogenesis of amyloid A (AA) amyloidosis is still unclear. In this study, we used an antioxidant, Brazilian propolis, to investigate the inhibitory effects on AA amyloidosis. The results showed that AA deposition was inhibited by administration of propolis. Increased expression of antioxidant markers was detected in molecular biological examinations of mice treated with propolis. Although serum amyloid A (SAA) levels were strongly correlated with the immunoreactive area of AA deposits in the control group, the correlation was weaker in the propolis-treated groups. In addition, there were no changes in SAA levels between the control group and the propolis-treated groups. The results indicate that propolis, an antioxidant, may induce inhibitory effects against AA amyloidosis.

FORMULA ESTABLISHMENT OF COLORLESS Pb(II COMPLEX WITH N-BENZOYL-N-PHENYL HYDROXYLAMINE (BPA USING ATOMIC ABSORPTION SPECTROSCOPY

Directory of Open Access Journals (Sweden)

Dhananjay B Sarode

2012-02-01

Full Text Available A new method for determination of stoichiometry of colorless complexes by using atomic absorption spectrophotometric technique in continuous variation method and slope ratio method was described here. This method can be used in same manner as that of mole ratio method and slope ratio method. In this method atomic absorption spectroscopy was used instead of UV-Vis spectrophotometry. Atomic absorption spectrophotometric technique is superior to UV-Vis spectrophotometry as it can be applied to colorless soluble complexes. Pb(II and n-benzoyl-n-phenyl hydroxylamine react to form colorless complex at pH 6.5, which can be easily determined by this method. It was found that Pb(II forms 1:2 complex with n-benzoyl-n-phenyl hydroxylamine and is quantitatively extracted back to aqueous solution for AAS analysis.

Transgenic cotton expressing Cry10Aa toxin confers high resistance to the cotton boll weevil.

Science.gov (United States)

Ribeiro, Thuanne Pires; Arraes, Fabricio Barbosa Monteiro; Lourenço-Tessutti, Isabela Tristan; Silva, Marilia Santos; Lisei-de-Sá, Maria Eugênia; Lucena, Wagner Alexandre; Macedo, Leonardo Lima Pepino; Lima, Janaina Nascimento; Santos Amorim, Regina Maria; Artico, Sinara; Alves-Ferreira, Márcio; Mattar Silva, Maria Cristina; Grossi-de-Sa, Maria Fatima

2017-08-01

Genetically modified (GM) cotton plants that effectively control cotton boll weevil (CBW), which is the most destructive cotton insect pest in South America, are reported here for the first time. This work presents the successful development of a new GM cotton with high resistance to CBW conferred by Cry10Aa toxin, a protein encoded by entomopathogenic Bacillus thuringiensis (Bt) gene. The plant transformation vector harbouring cry10Aa gene driven by the cotton ubiquitination-related promoter uceA1.7 was introduced into a Brazilian cotton cultivar by biolistic transformation. Quantitative PCR (qPCR) assays revealed high transcription levels of cry10Aa in both T 0 GM cotton leaf and flower bud tissues. Southern blot and qPCR-based 2 -ΔΔCt analyses revealed that T 0 GM plants had either one or two transgene copies. Quantitative and qualitative analyses of Cry10Aa protein expression showed variable protein expression levels in both flower buds and leaves tissues of T 0 GM cotton plants, ranging from approximately 3.0 to 14.0 μg g -1 fresh tissue. CBW susceptibility bioassays, performed by feeding adults and larvae with T 0 GM cotton leaves and flower buds, respectively, demonstrated a significant entomotoxic effect and a high level of CBW mortality (up to 100%). Molecular analysis revealed that transgene stability and entomotoxic effect to CBW were maintained in T 1 generation as the Cry10Aa toxin expression levels remained high in both tissues, ranging from 4.05 to 19.57 μg g -1 fresh tissue, and the CBW mortality rate remained around 100%. In conclusion, these Cry10Aa GM cotton plants represent a great advance in the control of the devastating CBW insect pest and can substantially impact cotton agribusiness. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

NCBI nr-aa BLAST: CBRC-XTRO-01-0674 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0674 ref|YP_001022362.1| putative heme O oxygenase (cytochrome aa3-controlling...) transmembrane protein [Methylibium petroleiphilum PM1] gb|ABM96127.1| putative heme O oxygenase (cytochrome aa3-controlling

Conformation of flexibly linked triterpene dimers by using RDC-enhanced NMR spectroscopy

Science.gov (United States)

Lakshmi, Jerripothula K.; Pattnaik, Banita; Kavitha, Rachineni; Mallavadhani, Uppuluri V.; Jagadeesh, Bharatam

2018-06-01

Dimers of flexibly linked pentacyclic triterpene ursolic acid (UA) and its related frameworks such as asiatic acid (AA) and oleanolic acid (OA) have recently attracted significant attention due to their enhanced anti-cancer and anti-HCV activity compared to their respective monomers. Determination of conformation/inter-monomer orientation of these molecules is very important to understand their structure-activity relationship and to develop new scaffolds, which, however, is difficult through conventional NOE based solution-state NMR spectroscopy, due to lack of long-range NOEs. In the present work, we report a precise determination of conformation of two 1,2,3-triazole-linked triterpene dimer molecules, UA-AA and UA-OA, by employing one-bond Csbnd H residual dipolar couplings (RDCs) as additional long-range orientational restraints, measured in anisotropic PDMS/CDCl3 solvent medium.

Corrosion issues of powder coated AA6060 aluminium profiles

DEFF Research Database (Denmark)

Din, Rameez Ud; Valgarðsson, Smári; Jellesen, Morten Stendahl

2015-01-01

In this study detailed microstructural investigation of the reason for unexpected corrosion of powder coated aluminium alloy AA6060 windows profiles has been performed. The results from this study reveals that the failure of the window profiles was originated from the surface defects present...... on the extruded AA6060 aluminium profile after metallurgical process prior to powder coating. Surface defects are produced due to intermetallic particles in the alloy, which disturb the flow during the extrusion process. The corrosion mechanism leading to the failure of the powder coated AA6060 aluminium profiles...

Core–corona PSt/P(BA–AA) composite particles by two-stage emulsion polymerization

Energy Technology Data Exchange (ETDEWEB)

Xie, Delong; Ren, Xiaolin; Zhang, Xinya, E-mail: cexyzh@scut.edu.cn; Liao, Shijun [South China University of Technology, School of Chemistry and Chemical Engineering (China)

2016-03-15

Raspberry-shaped composite particles with polystyrene (PSt) as core and poly(n-butyl acrylate-co-acrylic acid) (P(BA–AA)) as corona were synthesized via emulsion polymerization. The random copolymer, P(BA–AA), was pre-prepared and used as a polymeric surfactant, its emulsifying properties adjusted by changing the mass ratio of BA and AA. The morphology of the resulting core–corona composite particles, P(St/P(BA–AA)), could be regulated and controlled by varying the concentrations of P(BA–AA) or the mass ratio of BA:AA in P(BA–AA). The experimental results indicate that 3.0–6.0 wt% of P(BA–AA) is required to obtain stable composite emulsions, and P(BA–AA) with a mass ratio of BA:AA = 1:2 is able to generate distinct core–corona structures. A mechanism of composite particle formation is proposed based on the high affinity between the PSt core and the hydrophobic segments of P(BA–A). The regular morphology of the colloidal film is expected to facilitate potential application of core–corona particles in the field of light scattering. Furthermore, the diversity of core–corona particles can be expanded by replacing P(BA–AA) corona particles with other amphiphilic particles.

Microstructure, mechanical properties and texture of an AA6061/AA5754 composite fabricated by cross accumulative roll bonding

Energy Technology Data Exchange (ETDEWEB)

Verstraete, K., E-mail: kevin.verstraete@u-psud.fr [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Helbert, A.L. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Brisset, F. [Université Paris-Sud, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France); Benoit, A.; Paillard, P. [Institut des Matériaux Jean Rouxel (IMN), UMR 6502, Polytech’Nantes, Nantes Cedex (France); Baudin, T. [Université Paris-Sud, SP2M, ICMMO, UMR CNRS 8182, 91405 Orsay Cedex (France)

2015-07-29

AA6061 alloy is a widely used material in the automotive and aerospace industries, but is prone to hot cracking, which limits its weldability. To prevent this phenomenon, the AA6061/AA5754 composite was formed using a severe plastic deformation technique, Cross Accumulative Roll Bonding (CARB), at an elevated temperature (350 °C) to ensure good bonding between layers. This technique was efficient to maintain a small grain size, even under the process temperature conditions, and consequently, preserve good mechanical properties. The composite had better mechanical properties than the initial aluminium alloys. Microstructure and texture remained stable after two cycles and yield stress tended towards an equal value in the rolling and the transverse directions. After two cycles, the main component was the {001}〈110〉 rotated Cube, which was maintained for up to 10 cycles. Diffusion was more effective as the strain increased. Finally, a tungsten inert gas (TIG) welding process was performed on the composite and confirmed resistance to hot cracking.

Antiangiogenic effects of AA-PMe on HUVECs in vitro and zebrafish in vivo

Directory of Open Access Journals (Sweden)

Jing Y

2018-04-01

Full Text Available Yue Jing,1,2,* Gang Wang,1,* Qi Xiao,1 Yachun Zhou,1 Yingjie Wei,3 Zhunan Gong1 1Center for New Drug Research and Development, College of Life Science, Nanjing Normal University, Nanjing, China; 2Central Laboratory of Stomatology, Nanjing Stomatological Hospital, Medical School of Nanjing University, Nanjing, China; 3Key Laboratory of Oral Drug Delivery System of Chinese Materia Medica of State Administration of Traditional Chinese Medicine, Jiangsu Branch of China Academy of Chinese Medical Science, Nanjing, China *These authors contributed equally to this work Abstract: Angiogenesis plays a vital role in many physiological and pathological processes and several diseases are connected with its dysregulation. Asiatic acid (AA has demonstrated anticancer properties and we suspect this might be attributable to an effect on angiogenesis. A modified derivative of AA, N-(2α,3β,23-acetoxyurs-12-en-28-oyl-L-proline methyl ester (AA-PMe, has improved efficacy over its parent compound, but its effect on blood vessel development remains unclear. Methods: In this study, we investigated the antiangiogenic activity of AA and AA-PMe in zebrafish embryos and human umbilical vein endothelial cells (HUVECs. First of all, we treated HUVECs with increasing concentrations of AA-PMe or AA, with or without vascular endothelial growth factor (VEGF present, and assessed cell viability, tube formation, and cell migration and invasion. Quantitative real-time polymerase chain reaction and Western blot analysis were later used to determine the role of vascular endothelial growth factor receptor 2 (VEGFR2-mediated signaling in AA-PMe inhibition of angiogenesis. We extended these studies to follow angiogenesis using Tg(fli:EGFP transgenic zebrafish embryos. For these experiments, embryos were treated with varying concentrations of AA-PMe or AA from 24 to 72 hours postfertilization prior to morphological observation, angiogenesis assessment, and endogenous alkaline

Role and mechanism of AT1-AA in the pathogenesis of HELLP syndrome.

Science.gov (United States)

Bu, Shurui; Wang, Yuxian; Sun, Shuqing; Zheng, Yanqian; Jin, Zhu; Zhi, Jianming

2018-01-10

HELLP syndrome remains a leading cause of maternal and neonatal mortality and morbidity worldwide, which symptoms include hemolysis, elevated liver enzymes and low platelet count. The objective of this study was to determine whether HELLP is associated with AT1-AA. The positive rate and titer of AT1-AA in plasma from pregnant women were determined, and the correlation of AT1-AA titer with the grade of HELLP was analyzed. A HELLP rat model established by intravenous injection of AT1-AA. Our experimental results show the AT1-AA titer and positive rate were significantly higher in HELLP group, and AT1-AA titer were positively correlated with the level of TNF-α and ET-1 in plasma and the grade of HELLP syndrome. The results of animal experiments showed that the typical features of HELLP in the pregnant rats after AT1-AA injection. The levels of TNF-α and ET-1 in plasma and liver tissue were significantly increased in AT1-AA-treated rats compared with control rats. The HELLP syndrome induced by AT1-AA was attenuated markedly after administration of losartan. These data support the hypothesis that one the potential pathway that AT1-AA induce damage to capillary endothelial cells and liver during pregnancy is through activation of TNF-α and ET-1.

Assessment of the concentration of Cr, Mn and Fe in sediment using ...

African Journals Online (AJOL)

In the present study, laser-induced breakdown spectroscopy (LIBS) has been applied for the determination of levels of Cr, Mn and Fe in sediment samples and the results have been compared with that of flame-atomic absorption spectroscopy (F-AAS). Fourteen sediment samples were collected from Tinishu Akaki River ...

The effects of various reinforcements on dry sliding wear behaviour of AA 6061 nanocomposites

International Nuclear Information System (INIS)

Jeyasimman, D.; Narayanasamy, R.; Ponalagusamy, R.; Anandakrishnan, V.; Kamaraj, M.

2014-01-01

Highlights: • Wear and friction coefficient of nanocomposites were investigated. • The worn surface morphologies of nanocomposites were analysed. • The wear rate was increased with increasing load and sliding velocity. • The friction coefficient was decreased with increasing load and sliding velocity. - Abstract: The present work aims to investigate the dry sliding wear behaviour of AA 6061 nanocomposites reinforced with various nanolevel reinforcements, such as titanium carbide (TiC), gamma phase alumina (γ-Al 2 O 3 ) and hybrid (TiC + Al 2 O 3 ) nanoparticles with two weight percentages (wt.%) prepared by 30 h of mechanical alloying (MA). The tests were performed using a pin-on-disk wear tester by sliding these pin specimens at sliding speeds of 0.6, 0.9 and 1.2 m/s against an oil-hardened non-shrinking (OHNS) steel disk at room temperature. Wear tests were conducted for normal loads of 5, 7 and 10 N at different sliding speeds at room temperature. The variations of the friction coefficient and the wear rate with the sliding distances (500 m, 1000 m and 1600 m) for different normal loads and sliding velocities were plotted and investigated. To observe the wear characteristics and to investigate the wear mechanism, the morphologies of the worn surfaces were analysed using a scanning electron microscope (SEM). The formation of an oxide layer on the worn surface was examined by energy dispersive spectroscopy (EDS). The wear rate was found to increase with the load and sliding velocity for all prepared nanocomposites. Hybrid (TiC + Al 2 O 3 ) reinforced AA 6061 nanocomposites had lower wear rates and friction coefficients compared with TiC and Al 2 O 3 reinforced AA 6061 nanocomposites

Fecal transmission of AA amyloidosis in the cheetah contributes to high incidence of disease

Science.gov (United States)

Zhang, Beiru; Une, Yumi; Fu, Xiaoying; Yan, Jingmin; Ge, FengXia; Yao, Junjie; Sawashita, Jinko; Mori, Masayuki; Tomozawa, Hiroshi; Kametani, Fuyuki; Higuchi, Keiichi

2008-01-01

AA amyloidosis is one of the principal causes of morbidity and mortality in captive cheetahs (Acinonyx jubatus), which are in danger of extinction, but little is known about the underlying mechanisms. Given the transmissible characteristics of AA amyloidosis, transmission between captive cheetahs may be a possible mechanism involved in the high incidence of AA amyloidosis. In this study of animals with AA amyloidosis, we found that cheetah feces contained AA amyloid fibrils that were different from those of the liver with regard to molecular weight and shape and had greater transmissibility. The infectious activity of fecal AA amyloid fibrils was reduced or abolished by the protein denaturants 6 M guanidine·HCl and formic acid or by AA immunodepletion. Thus, we propose that feces are a vehicle of transmission that may accelerate AA amyloidosis in captive cheetah populations. These results provide a pathogenesis for AA amyloidosis and suggest possible measures for rescuing cheetahs from extinction. PMID:18474855

Estimation of lead, cadmium and nickel content by means of Atomic Absorption Spectroscopy in dry fruit bodies of some macromycetes growing in Poland. II.

Directory of Open Access Journals (Sweden)

Jan Grzybek

2014-08-01

Full Text Available The content of lead, cadmium, and nickel in dry fruit bodies of 34 species of macromyoetes collected in Poland from 72 natural babitats by means of Atomic Absorption Spectroscopy (AAS was estimated.

An Overview of the Evolution of Infrared Spectroscopy Applied to Bacterial Typing.

Science.gov (United States)

Quintelas, Cristina; Ferreira, Eugénio C; Lopes, João A; Sousa, Clara

2018-01-01

The sustained emergence of new declared bacterial species makes typing a continuous challenge for microbiologists. Molecular biology techniques have a very significant role in the context of bacterial typing, but they are often very laborious, time consuming, and eventually fail when dealing with very closely related species. Spectroscopic-based techniques appear in some situations as a viable alternative to molecular methods with advantages in terms of analysis time and cost. Infrared and mass spectrometry are among the most exploited techniques in this context: particularly, infrared spectroscopy emerged as a very promising method with multiple reported successful applications. This article presents a systematic review on infrared spectroscopy applications for bacterial typing, highlighting fundamental aspects of infrared spectroscopy, a detailed literature review (covering different taxonomic levels and bacterial species), advantages, and limitations of the technique over molecular biology methods and a comparison with other competing spectroscopic techniques such as MALDI-TOF MS, Raman, and intrinsic fluorescence. Infrared spectroscopy possesses a high potential for bacterial typing at distinct taxonomic levels and worthy of further developments and systematization. The development of databases appears fundamental toward the establishment of infrared spectroscopy as a viable method for bacterial typing. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Testing a laser-induced breakdown spectroscopy technique on the Arctic sediments

Science.gov (United States)

Han, D.; Nam, S. I.

2017-12-01

Physical and geochemical investigations coupled with the Laser-induced Breakdown Spectroscopy (LIBS) were performed on three surface sediment cores (ARA03B/24BOX, ARA02B/01(A)MUC, ARA02B/02MUC and ARA02B/03(A)MUC) recovered from the western Arctic Ocean (Chukchi Sea) during IBRV ARON expeditions in 2012. The LIBS technique was applied to carry out elemental chemical analysis of the Arctic sediments and compared with that measured by ITRAX X-ray fuorescence (XRF) core scanning. LIBS and XRF have shown similar elemental composition within each sediment core. In this study, mineral composition (XRD), grain size distribution and organic carbon content as well as elemental composition (LIBS) were all considered to understand paleoenvironmental changes (ocean circulation, sea-ice drift, iceberg discharge, and etc.) recorded in the Arctic Holocene sediment. Quantitative LIBS analysis shows a gradually varying distribution of the elements along the sampled core and clear separation between the cores. The cores are geochemically characterized by elevated Mn profile. The gradient of mineral composition and grain sizes among the cores shows regional distribution and variation in sedimentary condition due to geological distance between East Siberian and North America. The present study reveals that a LIBS technique can be employed for in-situ sediment analyses for the Arctic Ocean. Furthermore, LIBS does not require costly equipment, trained operators, and complicated sample pre-treatment processes compared to Atomic absorption spectroscopy (AAS) and inductively coupled plasma emission spectroscopy (ICP), and also known to show relatively high levels of sensitivity, precision, and distinction than XRF analysis, scanning electron microscopy-energy dispersive spectrometry (SEM-EDS), and electron probe X-ray microanalysis (EPMA).

Large magnetoresistance in (AA')2FeReO6 double perovskites

International Nuclear Information System (INIS)

Teresa, J.M. de; Serrate, D.; Blasco, J.; Ibarra, M.R.; Morellon, L.

2005-01-01

We review the main structural, magnetic and magnetotransport properties of the intriguing (AA') 2 FeReO 6 magnetic double perovskites. As the average cation size decreases, the crystallographic structure at room temperature evolves from cubic [(AA') 2 =Ba 2 , Ba 1.5 Sr 0.5 , BaSr, Ba 0.5 Sr 1.5 ] to tetragonal [(AA') 2 =Sr 2 ] and monoclinic [(AA') 2 =Ca 0.5 Sr 1.5 , CaSr, Ca 1.5 Sr 0.5 , Ca 2 ]. The Curie temperature increases anomalously from ∼303K for Ba 2 to ∼522K for Ca 2 in sharp contrast with the observed behaviour in the isostructural compounds (AA') 2 FeMoO 6 . Other anomalous features in the (AA') 2 FeReO 6 series are: the large magnetic anisotropy, the large magnetoelastic coupling and the semiconducting behaviour of the monoclinic compounds. The monoclinic compounds undergo a structural/magnetic transition at T S below 125K. Three different magnetoresistance mechanisms have been identified: the intergrain negative magnetoresistance effect, which is present across the whole series of compounds, and in the case of the monoclinic compounds below T S a negative magnetoresistance effect associated to the melting of the low-temperature phase and a positive magnetoresistance effect only present in (AA') 2 =Ca 2 below T∼50K

The Drentsche Aa valley system

International Nuclear Information System (INIS)

Gans, W. de.

1981-01-01

This thesis is composed of five papers concerned with Late Quaternary geology and geomorphology of the Aa valley system. The correlation and chronostratigraphic position of the layers have been established by radiocarbon dating. (Auth.)

UV spectroscopy applied to stratospheric chemistry, methods and results

Energy Technology Data Exchange (ETDEWEB)

Karlsen, K.

1996-03-01

The publication from the Norwegian Institute for Air Research (NILU) deals with an investigation done on stratospheric chemistry by UV spectroscopy. The scientific goals are briefly discussed, and it gives the results from the measuring and analysing techniques used in the investigation. 6 refs., 11 figs.

AaERF1 positively regulates the resistance to Botrytis cinerea in Artemisia annua.

Directory of Open Access Journals (Sweden)

Xu Lu

Full Text Available Plants are sessile organisms, and they can not move away under abiotic or biotic stresses. Thus plants have evolved a set of genes that response to adverse environment to modulate gene expression. In this study, we characterized and functionally studied an ERF transcription factor from Artemisia annua, AaERF1, which plays an important role in biotic stress responses. The AaERF1 promoter had been cloned and GUS staining results of AaERF1 promoter-GUS transgenic A. annua showed that AaERF1 is expressed ubiquitiously in all organs. Several putative cis-acting elements such as W-box, TGA-box and Py-rich element, which are involved in defense responsiveness, are present in the promoter. The expression of AaERF1 can be induced vigorously by methyl jasmonate as well as by ethephon and wounding, implying that AaERF1 may activate some of the defense genes via the jasmonic acid and ethylene signaling pathways of A. annua. The results of electrophoretic mobility shift assay (EMSA and yeast one-hybrid experiments showed that AaERF1 was able to bind to the GCC box cis-acting element in vitro and in yeast. Ectopic expression of AaERF1 could enhance the expression levels of the defense marker genes PLANT DEFENSIN1.2 (PDF1.2 and BASIC CHITINASE (ChiB, and increase the resistance to Botrytis cinerea in the 35S::AaERF1 transgenic Arabidopsis. The down-regulated expression level of AaERF1 evidently reduced the resistance to B. cinerea in A. annua. The overall results showed that AaERF1 positively regulated the resistance to B. cinerea in A. annua.

Investigating Corrosion, Wear Resistance and Friction of AA5454-O Series after its Severe Deformation by Rolling

Directory of Open Access Journals (Sweden)

Sinan SEZEK

2017-02-01

Full Text Available AA5454-O is an easily wrought, or in other words, a ductile aluminium alloy, however, its mechanical properties are inferior as compared to those of other alloys. The change taking place in corrosion resistance of AA5454-O alloy as a result of its severe plastic deformation (SPD by rolling has been investigated in this study. It has been observed that significant changes occurred in abrasion wear and corrosion resistances of AA5454-O alloy, which was severely deformed up to 80 % by rolling process. Corrosion resistance of the alloy that was severely deformed by rolling has increased. The effect of deformation rate on corrosion has been investigated by applying potentiodynamic test whereas on the other hand such change has been evidenced also through corrosion test. It has been observed that friction coefficient of severely deformed AA5454-O alloy varied by around 10 %, and that, associated with such change, its wear resistance also increased considerably. It has been determined that, as a result of severe deformation by rolling, hardness values rose in areas where the alloy was in contact with rolling surface. In this study, wear resistance of severely deformed alloy has been investigated as well. It has been observed that deformation value contributed positively to the increase in wear resistance.DOI: http://dx.doi.org/10.5755/j01.ms.23.1.14650

AA amyloidosis complicating the hereditary periodic fever syndromes.

Science.gov (United States)

Lane, Thirusha; Loeffler, Jutta M; Rowczenio, Dorota M; Gilbertson, Janet A; Bybee, Alison; Russell, Tonia L; Gillmore, Julian D; Wechalekar, Ashutosh D; Hawkins, Philip N; Lachmann, Helen J

2013-04-01

AA amyloidosis is a life-threatening complication of the hereditary periodic fever syndromes (HPFS), which are otherwise often compatible with normal life expectancy. This study was undertaken to determine the characteristics, presentation, natural history, and response to treatment in 46 patients who had been referred for evaluation at the UK National Amyloidosis Centre. Disease activity was monitored by serial measurement of serum amyloid A. Renal function was assessed by measurement of serum creatinine and albumin levels, the estimated glomerular filtration rate, and proteinuria from 24-hour urine collections. The amyloid load was measured by serum amyloid P scintigraphy. Twenty-four patients had familial Mediterranean fever, 12 patients had tumor necrosis factor receptor-associated periodic syndrome, 6 patients had cryopyrin-associated periodic syndromes, and 4 patients had mevalonate kinase deficiency. The median age at onset of HPFS was 5 years; median age at presentation with AA amyloidosis was 38 years. Diagnosis of an HPFS had not been considered prior to presentation with AA amyloidosis in 23 patients (50%). Eleven patients (24%) had end-stage renal failure (ESRF) at presentation; of these, 3 had received transplants prior to referral. A further 13 patients developed ESRF over the followup period, with 10 undergoing renal transplantation. The median time to progression to ESRF from onset of AA amyloidosis was 3.3 years (interquartile range [IQR] 2-8), with a median time to transplant of 4 years (IQR 3-6). Eleven patients (24%) died. The median survival in the entire cohort was 19 years from diagnosis of AA amyloidosis. Of the 37 patients who were treated successfully, or in whom at least partial suppression of the underlying HPFS was achieved, 17 (46%) showed amyloid regression, 14 (38%) showed a stable amyloid load, and 2 (5%) showed increased amyloid deposition over the followup period. AA amyloidosis remains a challenging and serious late complication

Intramyocardial oxygen transport by quantitative diffuse reflectance spectroscopy in calves

Science.gov (United States)

Lindbergh, Tobias; Larsson, Marcus; Szabó, Zoltán; Casimir-Ahn, Henrik; Strömberg, Tomas

2010-03-01

Intramyocardial oxygen transport was assessed during open-chest surgery in calves by diffuse reflectance spectroscopy using a small intramuscular fiber-optic probe. The sum of hemo- and myoglobin tissue fraction and oxygen saturation, the tissue fraction and oxidation of cytochrome aa3, and the tissue fraction of methemoglobin were estimated using a calibrated empirical light transport model. Increasing the oxygen content in the inhaled gas, 21%-50%-100%, in five calves (group A) gave an increasing oxygen saturation of 19+/-4%, 24+/-5%, and 28+/-8% (panimals increased with LVAD pump speed (p<0.001, ANOVA) and with oxygen content in inhaled gas (p<0.001, ANOVA). The cytochrome aa3 oxidation level was above 96% in both group A and group B calves, including the two cases involving cardiac arrest. In conclusion, the estimated tissue fractions and oxygenation/oxidation levels of the myocardial chromophores during respiratory and hemodynamic provocations were in agreement with previously presented results, demonstrating the potential of the method.

Failure analysis of fusion clad alloy system AA3003/AA6xxx sheet under bending

Energy Technology Data Exchange (ETDEWEB)

Shi, Y., E-mail: shiyh@mcmaster.ca [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Jin, H. [Novelis Global Technology Center, P.O. Box 8400, Kingston, Ontario, Canada K7L 5L9 (Canada); Wu, P.D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada); Lloyd, D.J. [Aluminum Materials Consultants, 106 Nicholsons Point Road, Bath, Ontario, Canada K0H 1G0 (Canada); Embury, D. [Department of Mechanical Engineering, McMaster University, 1280 Main Street West, Hamilton, Ontario, Canada L8S 4L7 (Canada)

2014-07-29

An ingot of AA6xxx Al–Si–Mg–Cu alloy clad with AA3003 Al–Mn alloy was co-cast by Fusion technology. Bending tests and numerical modeling were performed to investigate the potential for sub-surface cracking for this laminate system. To simulate particle-induced crack initiation and growth, both random and stringer particles have been selected to mimic the particle distribution in the tested samples. The morphology of cracking in the model was similar to that observed in clad sheet tested in the Cantilever bend test. The crack initiated in the core close to the clad-core interface where the strain in the core is highest, between particles or near particles and propagates along local shear bands in the core, while the clad layer experiences extreme thinning before failure.

In vivo Raman spectroscopy detects increased epidermal antioxidative potential with topically applied carotenoids

International Nuclear Information System (INIS)

Lademann, J; Richter, H; Patzelt, A; Darvin, M; Sterry, W; Fluhr, J W; Caspers, P J; Van der Pol, A; Zastrow, L

2009-01-01

In the present study, the distribution of the carotenoids as a marker for the complete antioxidative potential in human skin was investigated before and after the topical application of carotenoids by in vivo Raman spectroscopy with an excitation wavelength of 785 nm. The carotenoid profile was assessed after a short term topical application in 4 healthy volunteers. In the untreated skin, the highest concentration of natural carotenoids was detected in different layers of the stratum corneum (SC) close to the skin surface. After topical application of carotenoids, an increase in the antioxidative potential in the skin could be observed. Topically applied carotenoids penetrate deep into the epidermis down to approximately 24 μm. This study supports the hypothesis that antioxidative substances are secreted via eccrine sweat glands and/or sebaceous glands to the skin surface. Subsequently they penetrate into the different layers of the SC

Effect of Retrogression Heat Treatment Time on Microstructure and Mechanical Properties of AA7010

Science.gov (United States)

Nandana, M. S.; Udaya Bhat, K.; Manjunatha, C. M.

2018-03-01

The effect of retrogression time during retrogression and re-aging (RRA) treatment of AA7010 is evaluated by performing tensile tests and characterizing the microchemistry of the grain boundary precipitates (GBPs) using transmission electron microscope coupled with the energy-dispersive spectroscopy. Retrogression time is evaluated so that the ultimate tensile strength of the RRA-treated sample is equal to that of the T6-treated sample and the grain boundary microstructure similar to that of the over-aged (T7451) condition. The investigation reveals that the sample retrogressed at 200 °C for 20 min has UTS of 586 MPa which is equivalent to that of the T6 sample and 11.5% higher than that of the T7451 condition. The fracture toughness of the RRA-treated sample was 41 MPa√m. Microstructure of the RRA-treated sample is similar to T7451, along the grain boundaries and in the grain interior similar to that of the T6-treated sample. Energy-dispersive spectroscopy confirmed the increment of Cu content on the GBP's with increase in the retrogression time, which is expected to improve the stress corrosion cracking resistance of the alloy.

An Analysis of the Rise and Fall of the AA-MAS Policy

Science.gov (United States)

Lazarus, Sheryl S.; Thurlow, Martha L.; Ysseldyke, James E.; Edwards, Lynn M.

2015-01-01

In 2005, to address concerns about students who might fall in the "gap" between the regular assessment and the alternate assessment based on alternate achievement standards (AA-AAS), the U.S. Department of Education announced that states could develop alternate assessments based on modified achievement standards (AA-MAS). This article…

The Effects of Applied Stress and Sensitization on the Passive Film Stability of Al-Mg Alloys

Science.gov (United States)

2013-06-01

evaluates effects of stress on the corrosion behavior for the aluminum magnesium alloy AA5083 in a comprehensive and systematic manner. This study used... comprehensive and systematic manner. This study used cyclic polarization and electrochemical impedance spectroscopy to study passive film stability...cyclic polarization DoD Department of Defense DON Department of the Navy EBD breakdown potential ECORR corrosion potential ECRIT critical potential

Comparative study on Ti/Zr/V and chromate conversion treated aluminum alloys: Anti-corrosion performance and epoxy coating adhesion properties

Energy Technology Data Exchange (ETDEWEB)

Zhu, Wen; Li, Wenfang, E-mail: mewfli@163.com; Mu, Songlin; Fu, Nianqing; Liao, Zhongmiao

2017-05-31

Highlights: • The surface roughness and surface free energy of the AA6063 are significantly increased after TZVCC treatment. • The anti-corrosion performance of the AA6063 is effectively enhanced after TZVCC treatment. • Both the corrosion resistance and wet adhesion properties of the epoxy coating on the AA6063 are noticeably improved after TZVCC treatment. - Abstract: In this study, a Ti/Zr/V conversion coating (TZVCC) was deposited on the surface of aluminum alloy 6063 (AA6063) as an alternative of the chromate conversion coating (CCC). Both the TZVCC treated AA6063 (TZVCC/AA6063) and CCC treated AA6063 (CCC/AA6063) were characterized by scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS), atomic force microscope (AFM) and contact angle measuring device. The anti-corrosion performance of the TZVCC/AA6063 and CCC/AA6063 was evaluated by electrochemical measurements and neutral salt spray tests. It showed that both the surface roughness and surface free energy of the AA6063 were significantly increased after TZVCC treatment. The anti-corrosion performance of TZVCC/AA6063 was superior to that of CCC/AA6063. In addition, the effects of the TZVCC and CCC on the adhesion properties and anti-corrosion performance of epoxy coating applied on samples were examined by pull-off tests and electrochemical impedance spectroscopy (EIS). The dry, wet and recovery adhesive strengths of the epoxy coating on TZVCC treated samples (epoxy coated TZVCC/AA6063) were very close to those of epoxy coating on CCC treated ones (epoxy coated CCC/AA6063). The epoxy coated TZVCC/AA6063 showed better corrosion resistance than the epoxy coated CCC/AA6063 and epoxy coated AA6063.

Chemometric methods and near-infrared spectroscopy applied to bioenergy production

International Nuclear Information System (INIS)

Liebmann, B.

2010-01-01

The present work examines bioenergy production from different viewpoints. The three main objectives are: (1) to reveal the relation of technology, sustainability and economy in bioenergy processes; (2) to investigate spectroscopic methods as a tool for analytical monitoring of bioenergy processes; and (3) to develop new chemometric methods for advanced analysis of spectroscopic data. At the first stage, this thesis investigates the technological, ecological, and economic features of renewable-resource-based and de-centralized bioenergy production systems. In different scenarios, small-scale bioethanol production is combined with other technologies that provide renewable energy from residuals of the bioethanol process. The general aim is to substitute fossil energy conventionally used within the bioethanol process. The investigated technologies are biogas production and straw incineration. Agricultural aspects are introduced by sustainable crop rotation concepts that reconcile food, feed, and biofuel production. The sustainability of small-scale bioethanol production in the different scenarios is quantified by an ecological footprint method, the sustainable process index, SPI, and compared to conventional fuels. The main findings are: (i) small-scaled bioethanol production can be operated with 100 % renewable energy supply, (ii) the SPI of bioethanol can be reduced up to 92 % compared to conventional fuels, (iii) a complex trade-off between ecology-of-scale and economy-of-scale is necessary. At the second stage, this thesis approaches bioenergy production processes from an analytical perspective, and presents near-infrared spectroscopy (NIR) as promising method for fast process monitoring of bioethanol production and biomass characterization. In addition, new analytical methods are presented for a fast determination of the heating value of solid biomass fuel, based on IR and NIR spectroscopy. The main findings are that NIR spectroscopy and appropriate chemometric

INAA and flame AAS of various vegetable reference materials

International Nuclear Information System (INIS)

Djingova, R.; Arpadjan, S.; Kuleff, I.

1991-01-01

INAA and flame AAS have been used for the analysis of a large number of vegetable reference materials. Out of all determined elements (28 by INAA and 11 by AAS) nine are common for both methods (Ca, Cd, Co, Cu, Fe, Mg, Mn, Na, Zn) and for these the possibilities of the two methods have been compared. (orig.)

Predicting Hot Deformation of AA5182 Sheet

Science.gov (United States)

Lee, John T.; Carpenter, Alexander J.; Jodlowski, Jakub P.; Taleff, Eric M.

Aluminum 5000-series alloy sheet materials exhibit substantial ductilities at hot and warm temperatures, even when grain size is not particularly fine. The relatively high strain-rate sensitivity exhibited by these non-superplastic materials, when deforming under solute-drag creep, is a primary contributor to large tensile ductilities. This active deformation mechanism influences both plastic flow and microstructure evolution across conditions of interest for hot- and warm-forming. Data are presented from uniaxial tensile and biaxial bulge tests of AA5182 sheet material at elevated temperatures. These data are used to construct a material constitutive model for plastic flow, which is applied in finite-element-method (FEM) simulations of plastic deformation under multiaxial stress states. Simulation results are directly compared against experimental data to explore the usefulness of this constitutive model. The effects of temperature and stress state on plastic response and microstructure evolution are discussed.

Comparison of results analysis of chemical composition of alloys inside the U-Zr-Nb by XRF and AAS techniques

International Nuclear Information System (INIS)

Masrukan; Tri Yulianto; Anwar Muchsin

2011-01-01

U-Zr-Nb alloy chemical composition analysis using X Ray Fluorescence (XRF) and Atomic Absorption Spectroscopy (AAS) techniques have been conducted, where U-Zr- Nb alloy was chosen as candidates for new high-density fuel for future research reactors . Composition analysis is necessary because the composition of elements in the fuel will determine the characteristics of fuel during the fabrication process and in the reactor. The use of two kinds of analysis techniques were designed to obtain accurate analysis results. The experiment was conducted to determine the major element composition and impurities in the alloy U-Zr-Nb. First U-Zr-Nb varying alloy composition Nb were respectively 1%, 4%, 7% (U10% Zr1% Nb, U10% Zr4% Nb and U10% 7% Nb) as results of the melting process of measuring the diameter of 120 mm crushed on the surface bottom. Once on the bottom surface is smooth, then analyzed using XRF techniques. To analyze the elements using AAS techniques, alloy U-Zr-Nb cut into 10 mm x 5 mm then dissolved using HF and nitric acid. Solution that occurred were analyzed using AAS technique. From the analysis using the XRF technique is obtained the alloy U-10% Zr-1% Nb, U-10% Zr-4% Nb and Zr-10% U-7% Nb) had a content of each element as follows: U (87.8858%), Zr (2.6097%) and Nb (0.2206%), U (87.8556%), Zr (2.6302%), and Nb (0.6573%); U (84.6334%), Zr (2.5773%), and Nb (1.0940) weight. Results of analysis using AAS techniques on samples obtained third consecutive Zr content of 9.25%, 8.90% and 9.80% while the content of Nb was not detected. Meanwhile, the results of elemental analysis of impurities in all three samples showed that almost all the elements are still qualify as fuel except Zn element. Element Zn at the three samples of each alloys U-10% Zr-1% Nb, U-10% Zr-4% Nb and U-10% Zr-7%Nb is 1.3266%, 3.2756% and 1.0927% weight. It could be concluded that the results of analysis of elemental content and impurities in the alloy U-Nb-Zr using both XRF and AAS visible

High-energy radiation processing, a smart approach to obtain PVP-graft-AA nanogels

International Nuclear Information System (INIS)

Grimaldi, N.; Sabatino, M.A.; Przybytniak, G.; Kaluska, I.; Bondì, M.L.; Bulone, D.; Alessi, S.; Spadaro, G.; Dispenza, C.

2014-01-01

Poly(N-vinylpyrrolidone)-grafted-acrylic acid biocompatible nanogels (NGs) were prepared using an exiting industrial-type electron accelerator and setups, starting from semi-dilute aqueous solutions of a commercial PVP and the acrylic acid monomer. As a result, NGs with tunable size and structure can be obtained quantitatively. Sterility was also imparted at the integrated dose absorbed. The chemical structure of the NGs produced was confirmed through Fourier Transformer Infrared Spectroscopy (FT-IR). The molecular and physico-chemical properties of NGs, such as the hydrodynamic dimensions and surface charge densities, for various polymer and monomer concentrations in the irradiated solutions, are discussed here. - Highlights: • Aqueous solutions of PVP and AA were irradiated by industrial electron accelerator. • NGs with different physico-chemical and molecular properties can be obtained. • Carboxyl-functionalized NGs produced are promising building blocks for bio-devices

Energy loss spectroscopy applied to surface studies

International Nuclear Information System (INIS)

Lecante, J.

1975-01-01

The analysis of energy losses suffered by slow electrons (5 eV to 300 eV) back-scattered by single crystal surfaces appears to be a powerful method for surfaces studies. The inelastic scattering of these slow electrons limits their escape depth to the surface region which is defined here. After a review of the basic excitation processes due to the interaction between electrons and surfaces (phonons, plasmons and electronic transitions) a brief discussion is given about the instruments needed for this electron spectroscopy. Finally some experimental results are listed and it is shown that the comparison of the results given by ELS with other surface sensitive methods such as UPS is very fruitful and new information can be obtained [fr

PDGF-AA-induced filamentous mitochondria benefit dermal papilla cells in cellular migration.

Science.gov (United States)

Mifude, C; Kaseda, K

2015-06-01

Human dermal papilla cells (HDPCs) play essential roles in hair follicular morphogenesis and postnatal hair growth cycles. Previous reports demonstrated that platelet-derived growth factor-AA (PDGF-AA) enhanced the formation of dermal condensates in hair follicular development. Additionally, PDGF-AA induces/maintains the anagen phase of the hair cycle. It is likely that mitochondrial morphology and functions are tightly coupled with maintenance of these energy-demanding activities. However, little is known about the mitochondrial regulation in HDPCs. Thus, we investigated the PDGF-involved mitochondrial regulation in HDPCs. The mitochondrial morphologies of HDPCs were examined in the presence or absence of PDGF-AA under a fluorescent microscope. ATP production and cellular motility were investigated. The relationship between mitochondrial morphology and the cellular functions was discussed. We observed that primary HDPCs contained mitochondria with filamentous and/or rounded morphologies. Both types of mitochondria showed similar membrane potentials. Interestingly, in the presence of PDGF-AA, but not PDGF-BB, the balance between the two morphologies shifted towards the filamentous form. Concomitantly, both mitochondrial enzymatic activity and total cellular ATP level were augmented by PDGF-AA. These two parameters were closely correlated, suggesting the mitochondrial involvement in the PDGF-augmented ATP production. Moreover, PDGF-AA accelerated the migration of HDPCs in a gap-filling assay, but did not change the rate of cellular proliferation. Notably, filamentous mitochondria dominated migrating HDPCs. PDGF-AA benefits HDPCs in the process of migration, by increasing the number of filamentous mitochondria. © 2014 Society of Cosmetic Scientists and the Société Française de Cosmétologie.

Photoacoustic spectroscopy applied to the optical characterization of calcium phosphates for biomedical use

Energy Technology Data Exchange (ETDEWEB)

Mendez G, M. [ESFM-IPN, 07738 Mexico D.F. (Mexico); Cruz O, A. [CINVESTAV, Dept. of Physics, 07360 Mexico D.F. (Mexico)

2007-07-01

Full text: Photoacoustic Spectroscopy (PAS), based on the Rosencwaig and Gersho model, has been used for thermal and optical characterization of diverse materials. The use of PAS has become an important tool because is a nondestructive and no contact analytical technique. Furthermore its use to measure optical absorption spectra has advantages over the usual transmission measurements due to important features as the fact that scattered light does not disturb the measurements significantly and also the sample don't need to be prepared to have good quality surfaces. Then the optical properties of biological samples can be easily investigated with this technique. In the present study PAS is applied to obtain the optical absorption spectra of hydroxyapatite (HAp) [Ca{sub 10} (PO{sub 4} ){sub 6} (OH ){sub 2}] and bioactive calcium phosphates. The spectra of these samples ranged from 300 to 800 nm. All samples were prepared in a power form with particle size < 741m. Complementary studies X-ray diffraction and EDC were performed. (Author)

Enhancement of mechanical properties and corrosion resistance of friction stir welded joint of AA2014 using water cooling

Energy Technology Data Exchange (ETDEWEB)

Sinhmar, S., E-mail: sinhmarsunil88@gmail.com; Dwivedi, D.K.

2017-01-27

An investigation on the microstructure, mechanical properties, and corrosion behavior of friction stir welded joint of AA2014 in natural cooled (NC) and water cooled (WC) conditions have been reported. Optical microscopy, field emission scanning electron microscopy (FESEM) with Energy dispersive X-ray spectroscopy (EDS), Vicker's microhardness, tensile testing, X-ray diffraction (XRD), and electrochemical potentiodynamic polarization corrosion test (Tafel curve) were carried out to characterize the friction stir weld joints in both the cooling conditions. Water cooling resulted in higher strength and microhardness of friction stir weld joint compared to the natural cooling. The width of heat affected zone was reduced by the use of water cooling during friction stir welding (FSW) and minimum hardness zone was shifted towards weld center. The corrosion test was performed in 3.5% NaCl solution. Corrosion resistance of water cooled joint was found higher than natural cooled FSW joint. The precipitation behavior of weld nugget and heat affected zone impacts the corrosion resistance of FSW joint of AA 2014. Hardness, tensile, and corrosion properties of FSW joints produced under NC and WC conditions have been discussed in the light of microstructure.

Enhancement of mechanical properties and corrosion resistance of friction stir welded joint of AA2014 using water cooling

International Nuclear Information System (INIS)

Sinhmar, S.; Dwivedi, D.K.

2017-01-01

An investigation on the microstructure, mechanical properties, and corrosion behavior of friction stir welded joint of AA2014 in natural cooled (NC) and water cooled (WC) conditions have been reported. Optical microscopy, field emission scanning electron microscopy (FESEM) with Energy dispersive X-ray spectroscopy (EDS), Vicker's microhardness, tensile testing, X-ray diffraction (XRD), and electrochemical potentiodynamic polarization corrosion test (Tafel curve) were carried out to characterize the friction stir weld joints in both the cooling conditions. Water cooling resulted in higher strength and microhardness of friction stir weld joint compared to the natural cooling. The width of heat affected zone was reduced by the use of water cooling during friction stir welding (FSW) and minimum hardness zone was shifted towards weld center. The corrosion test was performed in 3.5% NaCl solution. Corrosion resistance of water cooled joint was found higher than natural cooled FSW joint. The precipitation behavior of weld nugget and heat affected zone impacts the corrosion resistance of FSW joint of AA 2014. Hardness, tensile, and corrosion properties of FSW joints produced under NC and WC conditions have been discussed in the light of microstructure.

[A review for recent advances in AA amyloid research and therapeutic approach to AA amyloidosis complicating rheumatoid arthritis].

Science.gov (United States)

Tamura, Hiroaki; Hasegawa, Kiminori

2009-02-01

AA amyloidosis is a life threatening clinical complication of chronic inflammatory diseases such as rheumatoid arthritis. It has been demonstrated biochemically that amyloidosis resulted from abnormal folding of proteins, which are deposited as insoluble fibrils in extracellular tissue, leading to the disruption of their normal function. In this regard, amyloidosis has been recognized as a conformation disorder. Interestingly, genetic polymorphisms of amyloid precursor protein (SAA) have been reported to associate with increased risk for AA amyloidosis. Also recent biochemical research revealed that SAA is synthesized under the influence of the proinflammatory cytokines, such as IL-6, TNF-alpha, IL-1. Additionally, it was suggested that amyloid deposits in extracellular tissue could reflect to the serum level of SAA in the reversible fashion, leading to the hypothesis that the control of the SAA synthesis could be beneficial to the treatment of amyloidosis. In this context, anti-cytokine therapies may be most effective. Especially the inhibition of IL-6 is critical to suppression of SAA production, so treatment with a humanized monoclonal antibody against human IL-6 receptor may not only ameliorate RA disease activity but also pave the way for the treatment of AA amyloidosis.

Bardoxolone methyl (BARD) ameliorates aristolochic acid (AA)-induced acute kidney injury through Nrf2 pathway.

Science.gov (United States)

Wu, Juan; Liu, Xinhui; Fan, Jinjin; Chen, Wenfang; Wang, Juan; Zeng, Youjia; Feng, Xiaorang; Yu, Xueqing; Yang, Xiao

2014-04-06

Bardoxolone methyl (BARD) is an antioxidant modulator that acts through induction of the nuclear factor erythroid 2-related factor 2 (Nrf2) signaling pathway. This study aimed to investigate the role of BARD in protecting kidneys from aristolochic acid (AA)-induced acute kidney injury (AKI). Male C57BL/6 mice received intraperitoneal (i.p.) injections of aristolochic acid I (AAI) (5mg/kg/day) for 5 days to produce acute AA nephropathy (AAN) model. BARD (10mg/kg/day, i.p.) was applied for 7 consecutive days, starting 2 days prior to AAI administration. The mice in the AA group showed AKI as evidenced by worsening kidney function evaluated by blood urea nitrogen (BUN) and serum creatinine (SCr) levels, and severe tubulointerstitial injury marked by massive tubule necrosis in kidney tissues. BARD significantly reduced BUN and SCr levels which were elevated by AAI. Additionally, AAI-induced histopathological renal damage was ameliorated by BARD. Furthermore, the expression of Nrf2 was reduced, and its repressor Kelch-like ECH-associated protein 1 (Keap1) was increased significantly, whereas heme oxygenase-1 (HO-1) was upregulated and NAD(P)H quinone oxidoreductase-1 (NQO1) was barely increased in the cytoplasm of tubules in kidneys after treatment with AAI. BARD significantly upregulated renal Nrf2, NQO1 and HO-1 expression and downregulated Keap1 expression compared with those in the AA group. Moreover, it was found that Nrf2 was expressed both in the cytoplasm and nuclear of glomeruli and tubules, whereas NQO1 and HO-1 were localized in the cytoplasm of tubules only. In conclusion, AA-induced acute renal injury was associated with impaired Nrf2 activation and expression of its downstream target genes in renal tissues. BARD prevented renal damage induced by AAI, and this renoprotective effect may be exerted by activating the Nrf2 signaling pathway and increasing expression of the downstream target genes. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Nonlinear resonant ultrasound spectroscopy (NRUS) applied to damage assessment in bone

Science.gov (United States)

Muller, Marie; Sutin, Alexander; Guyer, Robert; Talmant, Maryline; Laugier, Pascal; Johnson, Paul A.

2005-12-01

Nonlinear resonant ultrasound spectroscopy (NRUS) is a resonance-based technique exploiting the significant nonlinear behavior of damaged materials. In NRUS, the resonant frequency(ies) of an object is studied as a function of the excitation level. As the excitation level increases, the elastic nonlinearity is manifest by a shift in the resonance frequency. This study shows the feasibility of this technique for application to damage assessment in bone. Two samples of bovine cortical bone were subjected to progressive damage induced by application of mechanical cycling. Before cycling commenced, and at each step in the cycling process, NRUS was applied for damage assessment. For independent assessment of damage, high-energy x-ray computed tomography imaging was performed but was only useful in identifying the prominent cracks. As the integral quantity of damage increased, NRUS revealed a corresponding increase in the nonlinear response. The measured change in nonlinear response is much more sensitive than the change in linear modulus. The results suggest that NRUS could be a potential tool for micro-damage assessment in bone. Further work must be carried out for a better understanding of the physical nature of damaged bone and for the ultimate goal of the challenging in vivo implementation of the technique.

Non-equilibrium umbrella sampling applied to force spectroscopy of soft matter.

Science.gov (United States)

Gao, Y X; Wang, G M; Williams, D R M; Williams, Stephen R; Evans, Denis J; Sevick, E M

2012-02-07

Physical systems often respond on a timescale which is longer than that of the measurement. This is particularly true in soft matter where direct experimental measurement, for example in force spectroscopy, drives the soft system out of equilibrium and provides a non-equilibrium measure. Here we demonstrate experimentally for the first time that equilibrium physical quantities (such as the mean square displacement) can be obtained from non-equilibrium measurements via umbrella sampling. Our model experimental system is a bead fluctuating in a time-varying optical trap. We also show this for simulated force spectroscopy on a complex soft molecule--a piston-rotaxane.

Antihydrogen Experiment Gravity Interferometry Spectroscopy

CERN Multimedia

Trezzi, D; Dassa, L; Rienacker, B; Khalidova, O; Ferrari, G; Krasnicky, D; Perini, D; Cerchiari, G; Belov, A; Boscolo, I; Sacerdoti, M G; Ferragut, R O; Nedelec, P; Hinterberger, A; Al-qaradawi, I; Malbrunot, C L S; Brusa, R S; Prelz, F; Manuzio, G; Riccardi, C; Fontana, A; Genova, P; Haider, S; Haug, F; Turbabin, A; Castelli, F; Testera, G; Lagomarsino, V E; Doser, M; Penasa, L; Gninenko, S; Cataneo, F; Zenoni, A; Cabaret, L; Comparat, D P; Zmeskal, J; Scampoli, P; Nesteruk, K P; Dudarev, A; Kellerbauer, A G; Mariazzi, S; Carraro, C; Zavatarelli, S M

The AEGIS experiment (Antihydrogen Experiment: Gravity, Interferometry, Spectroscopy) has the aim of carrying out the first measurement of the gravitational interaction of antimatter to a precision of 1%, by applying techniques from atomic physics, laser spectroscopy and interferometry to a beam of antihydrogen atoms. A further goal of the experiment is to carry out spectroscopy of the antihydrogen atoms in flight.

Yield and flow properties of aluminum alloy AA 8001

International Nuclear Information System (INIS)

Lyons, J.S.; Johnson, H.W.; Han, E.G.

1995-01-01

Aluminum alloy AA 8001 is being used at the Westinghouse Savannah River Company (WSRC) for nuclear reactor fuel and target components. The objective of this research was to determine parameters for predictive models of the compressive flow properties of AA 8001. Seventy-five true strain-rate, hot compression tests were performed. New, quantitative information about the yield and flow behavior of aluminum alloy AA 8001 was determined. Parameters were determined to use in a hyperbolic sine constitutive law so that the yield stress, the peak stress, and the peak strain can be predicted from the temperature-compensated strain-rate, Z. It was found that the onset of strain softening was more strongly dependent on Z than the onset of yielding was

Absorption spectra of AA-stacked graphite

International Nuclear Information System (INIS)

Chiu, C W; Lee, S H; Chen, S C; Lin, M F; Shyu, F L

2010-01-01

AA-stacked graphite shows strong anisotropy in geometric structures and velocity matrix elements. However, the absorption spectra are isotropic for the polarization vector on the graphene plane. The spectra exhibit one prominent plateau at middle energy and one shoulder structure at lower energy. These structures directly reflect the unique geometric and band structures and provide sufficient information for experimental fitting of the intralayer and interlayer atomic interactions. On the other hand, monolayer graphene shows a sharp absorption peak but no shoulder structure; AA-stacked bilayer graphene has two absorption peaks at middle energy and abruptly vanishes at lower energy. Furthermore, the isotropic features are expected to exist in other graphene-related systems. The calculated results and the predicted atomic interactions could be verified by optical measurements.

Shear Resistance Properties of Modified Nano-SiO2/AA/AM Copolymer Oil Displacement Agent

Directory of Open Access Journals (Sweden)

Nanjun Lai

2016-12-01

Full Text Available To address the problem regarding poor shear resistance of commonly employed polymers for oil displacement, modified nano-SiO2/AA/AM copolymer (HPMNS oil displacement agents were synthesized using acrylic acid (AA, acrylamide (AM, and modified nano-SiO2 of different modification degrees as raw materials. HPMNS was characterized by means of infrared spectroscopy (IR, nuclear magnetic resonance (1H-NMR, 13C-NMR, dynamic/static light scattering, and scanning electron microscope. A comparative study of the shear resistance properties for partially hydrolyzed polyacrylamide (HPAM and HPMNS was conducted. Compared to HPAM, the introduced hyperbranched structure endowed HPMNS with good shear resistance, which was quantified from the viscosity retention ratio of the polymer solutions. From the perspective of rheological property, HPMNS also showed great shear stability after shearing by a Mixing Speed Governor and porous media shear model. Furthermore, with a higher degree of modification, HPMNS-2 had better shear stability in terms of viscosity and rheological property than HPMNS-1. The phenomena were due to its lower hydrodynamic radius, weight-average molecular weight, and better flexibility of its molecular chains. In addition, upon the indoor displacement test, the resistance factor and residual resistance factor values of HPMNS-2 were higher than those of HPAM. This behavior is beneficial for increasing oil recovery.

Systemic AA amyloidosis in the red fox (Vulpes vulpes).

Science.gov (United States)

Rising, Anna; Cederlund, Ella; Palmberg, Carina; Uhlhorn, Henrik; Gaunitz, Stefan; Nordling, Kerstin; Ågren, Erik; Ihse, Elisabet; Westermark, Gunilla T; Tjernberg, Lars; Jörnvall, Hans; Johansson, Jan; Westermark, Per

2017-11-01

Amyloid A (AA) amyloidosis occurs spontaneously in many mammals and birds, but the prevalence varies considerably among different species, and even among subgroups of the same species. The Blue fox and the Gray fox seem to be resistant to the development of AA amyloidosis, while Island foxes have a high prevalence of the disease. Herein, we report on the identification of AA amyloidosis in the Red fox (Vulpes vulpes). Edman degradation and tandem MS analysis of proteolyzed amyloid protein revealed that the amyloid partly was composed of full-length SAA. Its amino acid sequence was determined and found to consist of 111 amino acid residues. Based on inter-species sequence comparisons we found four residue exchanges (Ser31, Lys63, Leu71, Lys72) between the Red and Blue fox SAAs. Lys63 seems unique to the Red fox SAA. We found no obvious explanation to how these exchanges might correlate with the reported differences in SAA amyloidogenicity. Furthermore, in contrast to fibrils from many other mammalian species, the isolated amyloid fibrils from Red fox did not seed AA amyloidosis in a mouse model. © 2017 The Protein Society.

Chang'aa Drinking in Kibera Slum: The Harmful Effects of ...

African Journals Online (AJOL)

Chang'aa Drinking in Kibera Slum: The Harmful Effects of Contemporary Changes in the Production and Consumption of Traditional Spirits. ... African Journal of Drug and Alcohol Studies ... This article examines the harmful effects of drinking chang'aa, an illegal spirit produced locally, in Kibera slum in Nairobi, Kenya.

Multielement atmospheric deposition study in Croatia using moss biomonitoring, NAA, AAS and GIS technologies

International Nuclear Information System (INIS)

Spiric, Z.; Frontas'eva, M.V.; Gundorina, S.F.; Ostrovnaya, T.M.; Stafilov, T.; Enimiteva, V.; Steinnes, E.; Bukovec, D.

2009-01-01

For the first time the moss biomonitoring technique and two complementary analytical techniques - neutron activation analysis (NAA) and atomic absorption spectrometry (AAS) - were applied to study multielement atmospheric deposition in the Republic of Croatia. Moss samples were collected during the summer 2006 from 98 sites evenly distributed over the country. Sampling was performed in accordance with the LRTAP Convention - ICP Vegetation protocol and sampling strategy of the European Programme on Biomonitoring of Heavy Metal Atmospheric Deposition. Conventional and epithermal neutron activation analyses made it possible to determine concentrations of 41 elements including key heavy metals such as Pb, Cd, Hg, and Cu determined by AAS. Principal component analysis (factor analysis with VARIMAX rotation) was applied to distinguish elements mainly of anthropogenic origin from those predominantly originating from natural sources. Geographical distribution maps of the elements over the sampled territory were constructed using GIS technology. The median values for Croatia are consistent with the corresponding values for all Europe for most elements. It was shown that the Adriatic coastline of Croatia may be considered as an environmentally pristine area. This study was conducted for providing reliable assessment of air quality throughout Croatia and producing information needed for better identification of pollution sources and improving the potential for assessing environmental and health risks in Croatia associated with toxic metals

Changes in depression mediate the effects of AA attendance on alcohol use outcomes.

Science.gov (United States)

Wilcox, Claire E; Tonigan, J Scott

2018-01-01

Depression may contribute to increased drinking in individuals with alcohol use disorder. Although Alcoholics Anonymous (AA) attendance predicts drinking reductions, there is conflicting information regarding the intermediary role played by reductions in depression. We explored whether AA attendance reduces depressive symptoms, the degree to which improvement in depression results in reductions in drinking, and in which subgroups these effects occur. 253 early AA affiliates (63% male) were recruited and assessed at baseline 3, 6, 9, 12, 18, and 24 months. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. AA attendance and alcohol use outcomes were obtained with the Form 90. Mediation analyses were performed at early (3, 6, and 9 months) and late (12, 18, and 24 months) follow-up to investigate the degree to which reductions in depression mediated the effect of AA attendance on drinking, controlling for concurrent drinking. In addition, a series of moderated mediation analyses were performed using baseline depression severity as a moderator. At early follow-up, reductions in depression (6 months) mediated the effects of AA attendance (3 months) on later drinking (drinks per drinking day) (9 months) (b = -0.02, boot CI [-0.055, -0.0004]), controlling for drinking at 6 months. Baseline depression severity did not moderate the degree to which BDI mediated the effects of AA attendance on alcohol use (ps > .05). These findings provide further evidence that depression reduction is a mechanism by which AA attendance leads to reductions in alcohol use. Improving depression may help reduce alcohol use in individuals with AUD, and AA attendance may be an effective way to achieve that goal.

AA, bending magnet, BLG

CERN Multimedia

CERN PhotoLab

1980-01-01

The very particular lattice of the AA required 2 types of dipole (bending magnets; BLG, long and narrow; BST, short and wide). The BLG had a steel length of 4.70 m, a good field width of 0.24 m, and a weight of about 70 t. Jean-Claude Brunet inspects the lower half of a BLG. For the BST magnets see 7811105 and 8006036.

Identifying a typology of men who use anabolic androgenic steroids (AAS).

Science.gov (United States)

Zahnow, Renee; McVeigh, Jim; Bates, Geoff; Hope, Vivian; Kean, Joseph; Campbell, John; Smith, Josie

2018-05-01

Despite recognition that the Anabolic Androgenic Steroid (AAS) using population is diverse, empirical studies to develop theories to conceptualise this variance in use have been limited. In this study, using cluster analysis and multinomial logistic regression, we identify typologies of people who use AAS and examine variations in motivations for AAS use across types in a sample of 611 men who use AAS. The cluster analysis identified four groups in the data with different risk profiles. These groups largely reflect the ideal types of people who use AAS proposed by Christiansen et al. (2016): Cluster 1 (You Only Live Once (YOLO) type, n = 68, 11.1%) were younger and motivated by fat loss; Cluster 2 (Well-being type, n = 236, 38.6%) were concerned with getting fit; Cluster 3 (Athlete type, n = 155, 25.4%) were motivated by muscle and strength gains; Cluster 4 (Expert type, n = 152, 24.9%) were focused on specific goals (i.e. not 'getting fit'). The results of this study demonstrate the need to make information about AAS accessible to the general population and to inform health service providers about variations in motivations and associated risk behaviours. Attention should also be given to ensuring existing harm minimisation services are equipped to disseminate information about safe intra-muscular injecting and ensuring needle disposal sites are accessible to the different types. Copyright © 2018 Elsevier B.V. All rights reserved.

A near-infrared luminescent Mn2+-doped NaYF4:Yb,Tm/Fe3+ upconversion nanoparticles redox reaction system for the detection of GSH/Cys/AA.

Science.gov (United States)

Zhang, Liping; Ling, Bo; Wang, Lun; Chen, Hongqi

2017-09-01

An upconversion luminescence method was developed for the determination of glutathione (GSH), L-cysteine (Cys) or L-ascorbic acid (AA) based on redox reaction. We synthesized poly(acrylic acid) (PAA)-modified Mn 2+ -doped NaYF 4 :Yb,Tm upconversion nanoparticles (UCNPs), and the luminescence of these UCNPs was effectively quenched due to their carboxyl groups coordinating with Fe 3+ to form a UCNPs/Fe 3+ system. GSH, Cys or AA reduced Fe 3+ to Fe 2+ , which induced the luminescence recovery of the UCNPs. Under the optimized conditions, wide linear concentration ranges from 0.25-300μM for GSH, 0.5-875μM for Cys and 0.5-350μM for AA were found, and the detection limits (3S/K) were 0.2μM, 0.5μM and 0.2μM, respectively. Thus, the UCNPs/Fe 3+ system was successfully applied for sensing GSH, Cys or AA. Copyright © 2017 Elsevier B.V. All rights reserved.

Kinoform optics applied to X-ray photon correlation spectroscopy.

Science.gov (United States)

Sandy, A R; Narayanan, S; Sprung, M; Su, J-D; Evans-Lutterodt, K; Isakovic, A F; Stein, A

2010-05-01

Moderate-demagnification higher-order silicon kinoform focusing lenses have been fabricated to facilitate small-angle X-ray photon correlation spectroscopy (XPCS) experiments. The geometric properties of such lenses, their focusing performance and their applicability for XPCS measurements are described. It is concluded that one-dimensional vertical X-ray focusing via silicon kinoform lenses significantly increases the usable coherent flux from third-generation storage-ring light sources for small-angle XPCS experiments.

Estudio mediante EIS de la respuesta electroquímica de la aleación AA5083 frente a señales DC anódicas

Directory of Open Access Journals (Sweden)

Aballe, A.

1998-05-01

Full Text Available Electrochemical Impedance Spectroscopy (EIS has been applied to characterise the behaviour of AA5083 alloy samples under anodic polarisation in a 3.5 % NaCl solution. EIS spectra were obtained at different DC potentials falling within the passivity range characteristic of the anodic polarisation branch of this alloy in the cited corrosive environment. Three different types of electrochemical response, with specific features in the corresponding Nyquist diagrams, were observed within the potential range covered in this study. The different type of spectra have been fitted with equivalent circuits. The evolution of the values of the different elements in the circuits as a function of the applied DC polarisation potential has been established. The analysis of these data has allowed us to determine the ranges of polarisation potentials where the passivation layer remains stable, metastable pits are nucleated or where stable pits grow. Finally, the use of a "Bode Surface Plot" has been proposed to get a better visualization of the evolution of the system with the applied DC potential.

Se ha llevado a cabo un estudio, mediante Espectroscopia de Impedancia Electroquímica (EIS, del comportamiento de la aleación AA5083 polarizada anódicamente en disolución de NaCl al 3,5 %. Los espectros de impedancia se registraron a distintos potenciales DC, seleccionados de acuerdo con el intervalo de pasividad que aparece en su curva de polarización anódica. En el rango de potenciales estudiado, se han obtenido tres tipos de respuesta electroquímica, cada una con un diagrama de Nyquist característico. Los diagramas obtenidos se han simulado construyendo los correspondientes circuitos equivalentes. La evolución, con la polarización aplicada, de los valores de los elementos que componen cada circuito ha permitido definir el intervalo de potencial en el que la capa pasiva es estable, se forman picaduras metaestables, o se nuclean y crecen picaduras. Por

Microstructural characterization of fly ash particulate reinforced AA6063 aluminium alloy for aerospace applications

Science.gov (United States)

Razzaq, A. M.; Majid, D. L. Abang Abdul; Ishak, M. R.; Uday, M. B.

2017-12-01

Aluminium-fly ash (FA) particulate reinforced composites (AA6063-FA) have been used in automotive and aerospace industries because of their low density and good mechanical properties. Three different weight fraction of FA: 2%, 4% and 6% are added to AA6063 alloy using compocasting method. The effect of FA particulates on microstructure, density and compression strength of AA6063- FA composites are investigated. Field Emission Scanning Electron Microscope (FESEM) micrographs reveal that the FA particulates are uniformly distributed in AA6063 alloy. The results also show that density, compression strength and microstructure of the AA6063-FA composites are significantly influenced by the FA amount. The increase in the weight fraction of FA will improve the microstructure and enhance the compression strength. The density of AA6063-FA composites decreases as the incorporation of FA increases.

Raman spectroscopy applied to identify metabolites in urine of physically active subjects.

Science.gov (United States)

Moreira, Letícia Parada; Silveira, Landulfo; da Silva, Alexandre Galvão; Fernandes, Adriana Barrinha; Pacheco, Marcos Tadeu Tavares; Rocco, Débora Dias Ferraretto Moura

2017-11-01

Raman spectroscopy is a rapid and non-destructive technique suitable for biological fluids analysis. In this work, dispersive Raman spectroscopy has been employed as a rapid and nondestructive technique to detect the metabolites in urine of physically active subjects before and after vigorous 30min pedaling or running compared to sedentary subjects. For so, urine samples from 9 subjects were obtained before and immediately after physical activities and submitted to Raman spectroscopy (830nm excitation, 250mW laser power, 20s integration time) and compared to urine from 5 sedentary subjects. The Raman spectra of urine from sedentary showed peaks related to urea, creatinine, ketone bodies, phosphate and other nitrogenous compounds. These metabolic biomarkers presented peaks with different intensities in the urine of physically active individuals after exercises compared to before, measured by the intensity of selected peaks the Raman spectra, which means different concentrations after training. These peaks presented different intensity values for each subject before physical activity, also behaving differently compared to the post-training: some subjects presented increase while others decrease the intensity. Raman spectroscopy may allow the development of a rapid and non-destructive test for metabolic evaluation of the physical training in active and trained subjects using urine samples, allowing nutrition adjustment with the sport's performance. Copyright © 2017 Elsevier B.V. All rights reserved.

Laser induced photoacoustic spectroscopy applied to a study on coagulation processes of Tc(IV) colloid

International Nuclear Information System (INIS)

Sekine, T.; Kino, S.; Kino, Y.; Kudo, H.

2001-01-01

Quantitative determination of size and concentration of colloid particles in aqueous solutions was performed by laser induced photoacoustic spectroscopy (LPAS), and this technique was applied to a study on coagulation processes of Tc(IV) colloids. The intensity of photoacoustic signals from colloid particles (polystyrene, gold sols) was successfully calculated as a product of the number of particles and the absorption cross section per particle based on the Mie's light scattering theory. With this technique, the coagulation of Tc(IV) colloids prepared by the reduction of TcO 4 with Sn(II) was observed. The observed growth rate of colloid particles was successfully analyzed by a newly developed collision model, in which both the distribution of the kinetic energy of particles and the potential barrier between the two particles played significant roles. (author)

AAS 227: Day 1

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

Efficacy of etanercept in patients with AA amyloidosis secondary to rheumatoid arthritis.

Science.gov (United States)

Nakamura, T; Higashi, S; Tomoda, K; Tsukano, M; Baba, S

2007-01-01

The efficacy of biological therapies in rheumatoid arthritis (RA) is well known, but their hypothetical benefit in amyloid A (AA) amyloidosis secondary to RA still remains to be considered. We evaluated the efficacy and safety of etanercept in serum amyloid A (SAA) 1.3 allele Japanese patients with AA amyloidosis secondary to RA. Seven RA patients with histologically confirmed AA amyloidosis and renal involvement who were treated with etanercept were enrolled. They all had the SAA1.3 allele, which has been shown to be a risk factor not only for the association of AA amyloidosis but also for a poor prognosis in Japanese RA patients. Efficacy was assessed as a sustained decrease in RA inflammation and an amelioration of renal function. RA inflammation and AA amyloidosis were improved and stabilized after 43.4 +/- 16.5 weeks. At week 20 the number of tender (p = 0.017) and swollen (p = 0.017) joints, and levels of serum C-reactive protein (p = 0.018) and albumin (p = 0.045) had improved. The values for SAA, serum creatinine, calculated creatinine clearance, and proteinuria also ameliorated. No severe adverse events were observed. One patient eventually had to go on hemodialysis but her tolerance of etanercept remained stable. Etanercept can be used safely and effectively in AA amyloidosis secondary to RA with renal involvement, and is of clinical benefit in the short-term, even in patients on hemodialysis. It appears that SAA1.3 allele may be used as a clinical parameter for the introduction of etanercept in Japanese RA with AA amyloidosis.

Laser spectroscopy of neutron deficient gold and platinum isotopes

International Nuclear Information System (INIS)

Savard, G.

1988-03-01

A new method for on-line laser spectroscopy of radioactive atoms based on the resonant ionization spectroscopy of laser-desorbed radioactive samples has been devised. An experimental setup has been installed on-line at the ISOCELE mass separator in Orsay (France) and experiments have been performed on the region of transitional nuclei around Z=79. Isotopic shift measurements on four new isotopes 194 Au, 196 Au, 198 Au, 199 Au have been performed on gold and results on the neutron deficient isotopes down to 186 Au have been obtained confirming the nuclear ground-state shape transition from oblate to prolate between 187 Au and 186 Au. The first isotopic shift measurements on radioactive platinum isotopes have been obtained on 186 Pt, 188 Pt, 189 Pt. Indications of a shape transition have been observed between 186 Pt and 188 Pt. The extracted experimental changes in mean square charge radii δ 2 > A,A' along isotopic chains are compared to self-consistent Hartree-Fock plus BCS calculations

Parameters controlling the performance of AA319-type alloys Part II. Impact properties and fractography

International Nuclear Information System (INIS)

Li, Z.; Samuel, A.M.; Samuel, F.H.; Ravindran, C.; Doty, H.W.; Valtierra, S.

2004-01-01

The Charpy impact energy of Al-Si-Cu AA319-type alloys was measured in terms of the total absorbed energy. The Charpy specimens were machined from end-chilled castings to incorporate the effect of cooling rate on the impact properties. Unnotched specimens were used to increase the accuracy of the measurements, and to emphasize the effect of microstructure. The influence of the microconstituents on the impact strength was investigated by adding various alloying elements (i.e. Sr, Fe, and P) to the AA319 base alloy, and applying two different heat treatments (T5, and T6). The results show that strontium-modification enhances the impact properties, so that the Sr-modified AA319 alloy exhibits the highest impact properties compared to the base, and other alloys at any given dendrite arm spacing (DAS). The impact energy increases with increase in cooling rate, while iron, and phosphorus additions have a detrimental influence due, respectively, to the formation of β-Al 5 FeSi, and phosphorus oxide particles during solidification. T6 treatment assists in the even distribution, and dissolution of the microconstituents (including the block-like CuAl 2 particles) into the aluminum matrix. With more Cu available for strengthening during aging, the impact toughness is greatly enhanced. In the unmodified AA319 base alloy, crack initiation, and propagation occur mainly through Si-particle fracture, and the mechanism of void coalescence. In the Sr-modified, 1.2% Fe-containing 319 alloys, however, crack initiation takes place through fragmentation of β-Al 5 FeSi, Si, and CuAl 2 or Cu 2 FeAl 7 particles. Crack propagation occurs through cleavage of the β-Fe platelets, and fracture of the Cu-intermetallics, and brittle Si particles. Such samples exhibit very low impact energies

Protection by Thermal and Chemical Activation with Cerium Salts of the Alloy AA2017 in Aqueous Solutions of NaCl

Science.gov (United States)

Bethencourt, Manuel; Botana, Francisco Javier; Cano, María José; González-Rovira, Leandro; Marcos, Mariano; Sánchez-Amaya, José María

2012-01-01

A wide variety of anticorrosive treatments for aluminum alloys that can be employed as "green" alternatives to those based on Cr(VI) are currently under development. This article reports a study of the morphological and anticorrosive characteristics of surface layers formed on the Al-Cu alloy AA2017 by immersion treatment in baths of cerium salt, accelerated by increased temperature and the employment of hydrogen peroxide. Scanning electron microscopy (SEM)/X-ray energy dispersive spectroscopy (XEDS) studies of the samples treated have demonstrated the existence of a heterogeneous layer formed by a film of aluminum oxide/hydroxide on the matrix, and a series of dispersed islands of cerium over the cathodic intermetallics. The protective efficacy has been evaluated using electrochemical techniques, linear polarizations (LP) and electrochemical impedance spectroscopy (EIS), and salt spray tests. The results obtained indicate that the layer provided good resistance to corrosion in media with chlorides, and the method gives a considerable reduction of the time required for the immersion treatments.

Energy loss spectroscopy applied to surface studies

International Nuclear Information System (INIS)

Lecante, J.

1975-01-01

The analysis of energy losses suffered by slow electrons (5eV to 300eV) back-scattered by single crystal surfaces appears to be a powerful method for surfaces studies. The inelastic scattering of these slow electrons limits their escape depth to the surface region. After a review of the basic excitation processes due to the interaction between electrons and surfaces (phonons, plasmons and electronic transitions) a brief discussion is given about the instruments needed for this electrons spectroscopy. Finally some experimental results are listed and it is shown that the comparison of the results given by ELS with other surface sensitive methods such as UPS is very fruitful and new information can be obtained. The improvement of theoretical studies on surface excitations due to slow electrons will provide in the next future the possibility of analysing in a more quantitative way the results given by ELS [fr

Optogalvanic spectroscopy

International Nuclear Information System (INIS)

Pianarosa, P.; Demers, Y.; Gagne, J.M.

1983-01-01

Laser induced optogalvanic spectroscopy in a hollow cathode-produced plasma has been used to resolve the isotopic structure of some absorption lines in uranium. We have shown that the optogalvanic signal associated with any isotope can be related to the concentration of that isotope in a multi-isotopic sample. From the results we have obtained, optogalvanic spectroscopy of sputtered samples appears to be an interesting approach to the isotopic analysis of both natural and enriched uranium and could easily be applied to the analysis of other fissile elements, such as the plutonium isotopes

Comparative investigation of the adhesion of Ce conversion layers and silane layers to a AA 2024-T3 substrate through mechanical and electrochemical tests

Directory of Open Access Journals (Sweden)

Luis Enrique Morales Palomino

2007-12-01

Full Text Available Cerium conversion layers and silane films are among the potential substitutes for the carcinogenic chromate conversion layers used to protect high-strength Al alloys. In the present work the adhesion of a cerium conversion layer and of a silane film to an aluminium alloy (AA 2024-T3 substrate was investigated using mechanical and electrochemical tests. Scanning electron microscopy (SEM- X ray energy dispersive spectroscopy (EDS, Fourier transform infrared spectroscopy (FT-IR and X ray photoelectron spectroscopy (XPS were used to characterize the layers prior and after the mechanical test consisting of ultrasonic rinse in deionized water during 30 minutes. Mechanically tested and untested layers were also submitted to electrochemical impedance spectroscopy (EIS and anodic polarization measurements in 0.1 M NaCl solution. The results of the characterization tests have pointed to a stronger adhesion of the Ce layer to the substrate in comparison with the silane film, which was confirmed by the electrochemical tests. The adhesion between the silane film and the Ce conversion layer was also tested, to evaluate the possibility of using the system as a protective bi-layer in accordance with the new trends being developed to substitute chromate conversion layers.

AAS 228: Day 1 morning

Science.gov (United States)

Kohler, Susanna

2016-06-01

Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

High energy photoelectron spectroscopy in basic and applied science: Bulk and interface electronic structure

Energy Technology Data Exchange (ETDEWEB)

Knut, Ronny; Lindblad, Rebecka [Department of Physics and Astronomy, Uppsala University, SE-751 21 Uppsala (Sweden); Gorgoi, Mihaela [Helmholtz Zentrum Berlin für Materialien und Energie GmbH, Albert-Einstein-Str. 15, 12489 Berlin (Germany); Rensmo, Håkan [Department of Physics and Astronomy, Uppsala University, SE-751 21 Uppsala (Sweden); Karis, Olof, E-mail: olof.karis@physics.uu.se [Department of Physics and Astronomy, Uppsala University, SE-751 21 Uppsala (Sweden)

2013-10-15

Highlights: •We demonstrate how hard X-ray photoelectron spectroscopy can be used to investigate interface properties of multilayers. •By combining HAXPES and statistical methods we are able to provide quantitative analysis of the interface diffusion process. •We show how photoionization cross sections can be used to map partial density of states contributions to valence states. •We use HAXPES to provide insight into the valence electronic structure of e.g. multiferroics and dye-sensitized solar cells. -- Abstract: With the access of new high-performance electron spectrometers capable of analyzing electron energies up to the order of 10 keV, the interest for photoelectron spectroscopy has grown and many new applications of the technique in areas where electron spectroscopies were considered to have limited use have been demonstrated over the last few decades. The technique, often denoted hard X-ray photoelectron spectroscopy (HX-PES or HAXPES), to distinguish the experiment from X-ray photoelectron spectroscopy performed at lower energies, has resulted in an increasing interest in photoelectron spectroscopy in many areas. The much increased mean free path at higher kinetic energies, in combination with the elemental selectivity of the core level spectroscopies in general has led to this fact. It is thus now possible to investigate the electronic structure of materials with a substantially enhanced bulk sensitivity. In this review we provide examples from our own research using HAXPES which to date has been performed mainly at the HIKE facility at the KMC-1 beamline at HZB, Berlin. The review exemplifies the new opportunities using HAXPES to address both bulk and interface electronic properties in systems relevant for applications in magnetic storage, energy related research, but also in purely curiosity driven problems.

High energy photoelectron spectroscopy in basic and applied science: Bulk and interface electronic structure

International Nuclear Information System (INIS)

Knut, Ronny; Lindblad, Rebecka; Gorgoi, Mihaela; Rensmo, Håkan; Karis, Olof

2013-01-01

Highlights: •We demonstrate how hard X-ray photoelectron spectroscopy can be used to investigate interface properties of multilayers. •By combining HAXPES and statistical methods we are able to provide quantitative analysis of the interface diffusion process. •We show how photoionization cross sections can be used to map partial density of states contributions to valence states. •We use HAXPES to provide insight into the valence electronic structure of e.g. multiferroics and dye-sensitized solar cells. -- Abstract: With the access of new high-performance electron spectrometers capable of analyzing electron energies up to the order of 10 keV, the interest for photoelectron spectroscopy has grown and many new applications of the technique in areas where electron spectroscopies were considered to have limited use have been demonstrated over the last few decades. The technique, often denoted hard X-ray photoelectron spectroscopy (HX-PES or HAXPES), to distinguish the experiment from X-ray photoelectron spectroscopy performed at lower energies, has resulted in an increasing interest in photoelectron spectroscopy in many areas. The much increased mean free path at higher kinetic energies, in combination with the elemental selectivity of the core level spectroscopies in general has led to this fact. It is thus now possible to investigate the electronic structure of materials with a substantially enhanced bulk sensitivity. In this review we provide examples from our own research using HAXPES which to date has been performed mainly at the HIKE facility at the KMC-1 beamline at HZB, Berlin. The review exemplifies the new opportunities using HAXPES to address both bulk and interface electronic properties in systems relevant for applications in magnetic storage, energy related research, but also in purely curiosity driven problems

Overview of the Antiproton Accumulator (AA)

CERN Multimedia

1982-01-01

See photo 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

A Status Report on the AAS Astronomy Ambassadors Program

Science.gov (United States)

Fienberg, Richard Tresch; Fraknoi, Andrew; Gurton, Suzanne; Hurst, Anna; Schatz, Dennis L.

2014-06-01

The American Astronomical Society, in partnership with the Astronomical Society of the Pacific (ASP), has launched a series of professional-development workshops and a community of practice designed to improve early-career astronomers’ ability to communicate effectively with students and the public. Called AAS Astronomy Ambassadors, the program provides training and mentoring for young astronomers, from advanced undergraduates to beginning faculty; it also provides them access to resources and a network of contacts within the astronomy education and public outreach (EPO) community. Ambassadors are provided with a library of outreach activities and resource materials suitable for a range of venues and audiences. For much of this library we are using resources developed by organizations such as the ASP, the Pacific Science Center, and the Center for Astronomy Education for other outreach programs, though some resources have been created by one of us (AF) specifically for this program. After a period of evaluation and revision, the program’s “Menu of Outreach Opportunities for Science Education” (MOOSE) is now posted on the AAS website at http://aas.org/outreach/moose-menu-outreach-opportunities-science-education.The first two Astronomy Ambassadors workshops were held at AAS meetings in January 2013 and January 2014; each served 30 young astronomers chosen from about twice that many applicants. Web-based follow-up activities are being provided through a website at the ASP designed to keep cohorts of educators trained in their programs in touch with one another. The AAS is exploring ways to fund additional workshops at future winter meetings; suggestions are most welcome. Meanwhile, the Astronomy Ambassadors trained to date have logged more than 150 outreach events, reaching many thousands of children and adults across the U.S. and Canada.

Astrocytes mediated the nootropic and neurotrophic effects of Sarsasapogenin-AA13 via upregulating brain-derived neurotrophic factor.

Science.gov (United States)

Dong, Dong; Mao, Yu; Huang, Cui; Jiao, Qian; Pan, Hui; Ma, Lei; Wang, Rui

2017-01-01

Rhizoma Anemarrhena , a widely used traditional Chinese medicine, has previously been shown to have neuroprotective effect. Sarsasapogenin-AA13 (AA13) is a novel synthetic derivative of Sarsasapogenin, which is extracted from Rhizoma Anemarrhena . The aim of this study is to investigate the nootropic and neurotrophic effects of AA13 and underlying mechanisms. In vitro , cell viability of rat primary astrocytes treated with AA13 and neurons cultured with conditioned medium of AA13-treated rat primary astrocytes was tested by MTT assays. In vivo , a pharmacological model of cognitive impairment induced by scopolamine was employed and spatial memory of the mice was assessed by Morris water maze. This study found that AA13 increased cell viability of primary astrocytes and AA13-treated astrocyte-conditioned medium enhanced the survival rate of primary neurons. Interestingly, AA13 markedly enhanced the level of BDNF in astrocytes. Furthermore, AA13 (6 mg/kg) improved the cognitive deficits in animal models (p<0.05) and BDNF and PSD95 levels were increased in brain. Therefore, we hypothesize that AA13 exerts nootropic and neurotrophic activities through astrocytes mediated upregulation of BDNF secretion. The results suggest that AA13 could be a potential compound for cognitive impairment after further research.

THz spectroscopy of liquids – applications and future challenges

DEFF Research Database (Denmark)

Jepsen, Peter Uhd; Cooke, David; Møller, Uffe

2009-01-01

transmission spectroscopy of pressed pellets for the investigation of powder materials and wafer-like samples for spectroscopy of bulk and nanostructured semiconductor materials. Reflection-type spectroscopy is applied using plane interfaces for the study of liquids [1,2,3]. However, quantitative spectroscopy...

Evaluation of the standard normal variate method for Laser-Induced Breakdown Spectroscopy data treatment applied to the discrimination of painting layers

Science.gov (United States)

Syvilay, D.; Wilkie-Chancellier, N.; Trichereau, B.; Texier, A.; Martinez, L.; Serfaty, S.; Detalle, V.

2015-12-01

Nowadays, Laser-Induced Breakdown Spectroscopy (LIBS) is frequently used for in situ analyses to identify pigments from mural paintings. Nonetheless, in situ analyses require a robust instrumentation in order to face to hard experimental conditions. This may imply variation of fluencies and thus inducing variation of LIBS signal, which degrades spectra and then results. Usually, to overcome these experimental errors, LIBS signal is processed. Signal processing methods most commonly used are the baseline subtraction and the normalization by using a spectral line. However, the latter suggests that this chosen element is a constant component of the material, which may not be the case in paint layers organized in stratigraphic layers. For this reason, it is sometimes difficult to apply this normalization. In this study, another normalization will be carried out to throw off these signal variations. Standard normal variate (SNV) is a normalization designed for these conditions. It is sometimes implemented in Diffuse Reflectance Infrared Fourier Transform Spectroscopy and in Raman Spectroscopy but rarely in LIBS. The SNV transformation is not newly applied on LIBS data, but for the first time the effect of SNV on LIBS spectra was evaluated in details (energy of laser, shot by shot, quantification). The aim of this paper is the quick visualization of the different layers of a stratigraphic painting sample by simple data representations (3D or 2D) after SNV normalization. In this investigation, we showed the potential power of SNV transformation to overcome undesired LIBS signal variations but also its limit of application. This method appears as a promising way to normalize LIBS data, which may be interesting for in-situ depth analyses.

Adverse effects of doping with anabolic androgenic steroids (AAS) in competitive athletics, recreational sports and bodybuilding.

Science.gov (United States)

Vorona, Elena; Nieschlag, Eberhard

2018-02-19

Despite the fact that sports organizations and legislators have introduced various mechanisms to discourage athletes from using performance and appearance enhancing substances a high percentage of athletes admits to their unabated application. In competitive athletics, bodybuilding and in recreational sports anabolic androgenic steroids (AAS) continue to be the substances most abused. This review summarizes the side effects of AAS abuse on organs and system functions in both sexes. High doses of AAS cause a significant increase of erythrocytes und haemoglobin concentration, which may lead to thromboembolism, intracardiac thrombosis and stroke. Long-term AAS abusers have a higher incidence of arrhythmias, atherosclerosis, concentric left-ventricular myocardial hypertrophy with impaired diastolic function and also sudden cardiac death. Changes of liver function and structure, up to hepatocellular carcinoma, have been described, mainly in cases of chronic misuse of 17α-alkylated AAS. Sleeplessness, increased irritability, depressive mood status are often observed in AAS abuse. In former AAS abusers depression, anxiety and melancholy may persist for many years. Due to negative feedback in the regulation of the hypothalamic-pituitary-gonadal axis AAS can cause reversible suppression of spermatogenesis up to azoospermia. In women the changes most often caused by AAS abuse are hirsutism, irreversible deepening of voice, dysmenorrhoea, secondary amenorrhoea with anovulation and infertility. AAS abuse notwithstanding, under clinical conditions testosterone remains the most important hormone for substitution therapy of male hypogonadism.

The social nature of environmental knowledge among the nomadic WoÉ - aaÉ"e of Niger

Directory of Open Access Journals (Sweden)

Nikolaus Schareika

2014-12-01

Full Text Available Pastoral nomads such as West Africa's WoÉ - aaÉ"e are renowned for the impressive environmental knowledge they apply to successfully raise animal herds in arid and variable environments. We looked at such herders' knowledge not as based on individual learning and expertise but as ultimately social in the sense that it is formed, made available, and linked to pastoral decision making in the public and interactive space of permanent talking, discussing, and negotiating among peers. Drawing on theoretical ideas from science and technology studies, a number of concrete social situations of information management and pastoral decision making were explored in detail to reveal the distinctly social character of WoÉ - aaÉ"e knowledge. Special emphasis has been given to the institutional framework of knowledge exchange; the blending of moral values and empirical facts in particular statements of knowledge; the dialogic and collaborative nature of information procurement and assessment; and the contingency of decisions reached after lengthy rounds of discussion among herders.

76 FR 6794 - 30-Day Submission Period for Requests for ONC-Approved Accreditor (ONC-AA) Status

Science.gov (United States)

2011-02-08

... Accreditor (ONC-AA) Status AGENCY: Office of the National Coordinator for Health Information Technology... submission of requests for ONC-Approved Accreditor (ONC-AA) status. Authority: 42 U.S.C. 300jj-11. DATES: The... for ONC-AA status may be submitted. The 30-day period for submission of requests for ONC-AA status...

AAS 228: Day 3 afternoon

Science.gov (United States)

Kohler, Susanna

2016-06-01

Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

Effects of chronic ethanol ingestion on arachidonic acid (AA) metabolism in rat macrophages

International Nuclear Information System (INIS)

Chanmugam, P.; Boudreau, M.; Hymel, G.; Jeffers, G.; Hwang, D.H.

1986-01-01

In a previous report, preincubation of rat platelets with ethanol resulted in dose dependent inhibition of AA metabolites whereas chronic ingestion of ethanol enhanced the synthesis of AA metabolites. Thus, the authors studied whether chronic ethanol ingestion also affects AA metabolism in MACS. Two groups of rats (10 each) were fed DeCarli/Lieber liquid diet containing 36 caloric % ethanol for 3 weeks. The control group was pair fed the same diet made isocaloric with dextrin-maltose. Resident MACS were collected by peritoneal lavage. The monolayers of MACS were incubated for 20 min with calcium ionophore (5μg/ml), and the incubation stopped with 4 vol. of ethanol. PGE 2 , LTB 4 and 5-HETE were assayed by radioimmunoassay. The results indicated that chronic ethanol ingestion did not affect the capacity of MACS to synthesize AA metabolites. There was also no difference in the levels of AA metabolites in heart and lung homogenates between the two groups

Coarsening of AA6013-T6 Precipitates During Sheet Warm Forming Applications

Science.gov (United States)

Di Ciano, M.; DiCecco, S.; Esmaeili, S.; Wells, M. A.; Worswick, M. J.

2018-03-01

The use of warm forming for AA6xxx-T6 sheet is of interest to improve its formability; however, the effect warm forming may have on the coarsening of precipitates and the mechanical strength of these sheets has not been well studied. In this research, the coarsening behavior of AA6013-T6 precipitates has been explored, in the temperature range of 200-300 °C, and time of 30 s up to 50 h. Additionally, the effect of warm deformation on coarsening behavior was explored using: (1) simulated warm forming tests in a Gleeble thermo-mechanical simulator and (2) bi-axial warm deformation tests. Using a strong obstacle model to describe the yield strength (YS) evolution of the AA6013-T6 material, and a Lifshitz, Slyozov, and Wagner (LSW) particle coarsening law to describe the change in precipitate size with time, the coarsening kinetics were modeled for this alloy. The coarsening kinetics in the range of 220-300 °C followed a trend similar to that previously found for AA6111 for the 180-220 °C range. There was strong evidence that coarsening kinetics were not altered due to warm deformation above 220 °C. For warm forming between 200 and 220 °C, the YS of the AA6013-T6 material increased slightly, which could be attributed to strain hardening during warm deformation. Finally, a non-isothermal coarsening model was used to assess the potential reduction in the YS of AA6013-T6 for practical processing conditions related to auto-body manufacturing. The model calculations showed that 90% of the original AA6013-T6 YS could be maintained, for warm forming temperatures up to 280 °C, if the heating schedule used to get the part to the warm forming temperature was limited to 1 min.

Long-term biases in geomagnetic K and aa indices

Science.gov (United States)

Love, J.J.

2011-01-01

Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0-2009.0, solar cycles 11-23. The K data show persistent biases, especially for high (low) K-activity levels at British (Australian) observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4. ?? 2011 Author(s).

Long-term biases in geomagnetic K and aa indices

Directory of Open Access Journals (Sweden)

J. J. Love

2011-08-01

Full Text Available Analysis is made of the geomagnetic-activity aa index and its source K-index data from groups of ground-based observatories in Britain, and Australia, 1868.0–2009.0, solar cycles 11–23. The K data show persistent biases, especially for high (low K-activity levels at British (Australian observatories. From examination of multiple subsets of the K data we infer that the biases are not predominantly the result of changes in observatory location, localized induced magnetotelluric currents, changes in magnetometer technology, or the modernization of K-value estimation methods. Instead, the biases appear to be artifacts of the latitude-dependent scaling used to assign K values to particular local levels of geomagnetic activity. The biases are not effectively removed by weighting factors used to estimate aa. We show that long-term averages of the aa index, such as annual averages, are dominated by medium-level geomagnetic activity levels having K values of 3 and 4.

Relationship between patient-reported outcomes and clinical outcomes in metastatic castration-resistant prostate cancer: post hoc analysis of COU-AA-301 and COU-AA-302.

Science.gov (United States)

Cella, D; Traina, S; Li, T; Johnson, K; Ho, K F; Molina, A; Shore, N D

2018-02-01

Patient-reported outcomes (PROs) are used to assess benefit-risk in drug development. The relationship between PROs and clinical outcomes is not well understood. We aim to elucidate the relationships between changes in PRO measures and clinical outcomes in metastatic castration-resistant prostate cancer (mCRPC). We investigated relationships between changes in self-reported fatigue, pain, functional well-being (FWB), physical well-being (PWB) and prostate cancer-specific symptoms with overall survival (OS) and radiographic progression-free survival (rPFS) after 6 and 12 months of treatment in COU-AA-301 (N = 1195) or COU-AA-302 (N = 1088). Eligible COU-AA-301 patients had progressed after docetaxel and had Eastern Cooperative Oncology Group performance status (ECOG PS) ≤ 2. Eligible COU-AA-302 patients had no prior chemotherapy and ECOG PS 0 or 1. Patients were treated with abiraterone acetate (1000 mg/day) plus prednisone (10 mg/day) or prednisone alone daily. Association between self-reported fatigue, pain and functional status, and OS and/or rPFS, using pooled data regardless of treatment, was assessed. Cox proportional hazard regression modeled time to death or radiographic progression. In COU-AA-301 patients, PRO improvements were associated with longer OS and longer time to radiographic progression versus worsening or stable PROs (P AA-302 patients, worsening PROs were associated with higher likelihood of radiographic progression (P ≤ 0.025) compared with improved or stable PROs. In multivariate models, worsening PWB remained associated with worse rPFS. The 12-month analysis confirmed the 6-month results. PROs are significantly associated with clinically relevant time-to-event efficacy outcomes in clinical trials and may complement and help predict traditional clinical practice methods for monitoring patients for disease progression. © The Author 2017. Published by Oxford University Press on behalf of the European Society for

Effect of gaussian beam on microstructural and mechanical properties of dissimilarlaser welding ofAA5083 and AA6061 alloys

Science.gov (United States)

Srinivas, B.; Cheepu, Muralimohan; Sivaprasad, K.; Muthupandi, V.

2018-03-01

The present study focuses on a sheet thickness of 4 mm using different laser power and welding rate by the laser beam welding (LBW) at a beam size180 μm. The observations on the weldments are showing that thermal conductivity of the materials plays a major role on microstructural changes. The as-welded mechanical properties were studied by correlation with its microstructures. Due to the steeper temperature gradient during the laser beam welding AA6061 was showing the greater variation compares with AA5083 side in the micro hardness studies.Also, the tensile strength of 241 MPa has been reported as highest with the welds made of laser powerat 3.5 kW and welding rate at 3.5 mmin-1.

Raadioteatril elu sees. Elu sees? / Mart Aas, Tõnis Leemets ; interv. Kutt Kommel

Index Scriptorium Estoniae

Aas, Mart

2007-01-01

Eesti Raadio raadioteatri 78. sünnipäeval esietendus Vikerraadios dokumentaalkuuldemäng "Elu sees" Aleksander Alleni (hilisema nimega Aleksander Aas) mälestuste põhjal. Theatrumi lavastuse on raadiole seadnud Mart Aas, Marius Peterson, Toomas Lõhmuste ja Tõnis Leemets

Noise-immune cavity-enhanced analytical atomic spectrometry - NICE-AAS - A technique for detection of elements down to zeptogram amounts

Science.gov (United States)

Axner, Ove; Ehlers, Patrick; Hausmaninger, Thomas; Silander, Isak; Ma, Weiguang

2014-10-01

Noise-immune cavity-enhanced optical heterodyne molecular spectroscopy (NICE-OHMS) is a powerful technique for detection of molecular compounds in gas phase that is based on a combination of two important concepts: frequency modulation spectroscopy (FMS) for reduction of noise, and cavity enhancement, for prolongation of the interaction length between the light and the sample. Due to its unique properties, it has demonstrated unparalleled detection sensitivity when it comes to detection of molecular constituents in the gas phase. However, despite these, it has so far not been used for detection of atoms, i.e. for elemental analysis. The present work presents an assessment of the expected performance of Doppler-broadened (Db) NICE-OHMS for analytical atomic spectrometry, then referred to as noise-immune cavity-enhanced analytical atomic spectrometry (NICE-AAS). After a description of the basic principles of Db-NICE-OHMS, the modulation and detection conditions for optimum performance are identified. Based on a previous demonstrated detection sensitivity of Db-NICE-OHMS of 5 × 10- 12 cm- 1 Hz- 1/2 (corresponding to a single-pass absorbance of 7 × 10- 11 over 10 s), the expected limits of detection (LODs) of Hg and Na by NICE-AAS are estimated. Hg is assumed to be detected in gas phase directly while Na is considered to be atomized in a graphite furnace (GF) prior to detection. It is shown that in the absence of spectral interferences, contaminated sample compartments, and optical saturation, it should be feasible to detect Hg down to 10 zg/cm3 (10 fg/m3 or 10- 5 ng/m3), which corresponds to 25 atoms/cm3, and Na down to 0.5 zg (zg = zeptogram = 10- 21 g), representing 50 zg/mL (parts-per-sextillion, pps, 1:1021) in liquid solution (assuming a sample of 10 μL) or solely 15 atoms injected into the GF, respectively. These LODs are several orders of magnitude lower (better) than any previous laser-based absorption technique previously demonstrated under atmospheric

Effects of quench rate and natural ageing on the age hardening behaviour of aluminium alloy AA6060

Energy Technology Data Exchange (ETDEWEB)

Strobel, Katharina, E-mail: katharina.strobel@aol.com [CAST Co-operative Research Centre, Department of Materials Engineering, Monash University, Clayton, Victoria 3800 (Australia); Lay, Matthew D.H., E-mail: mlay@fbrice.com [CSIRO Manufacturing Flagship, Clayton, Victoria 3169 (Australia); Easton, Mark A., E-mail: mark.easton@rmit.edu.au [CAST Co-operative Research Centre, Department of Materials Engineering, Monash University, Clayton, Victoria 3800 (Australia); Sweet, Lisa, E-mail: lisa.sweet@monash.edu [CAST Co-operative Research Centre, Department of Materials Engineering, Monash University, Clayton, Victoria 3800 (Australia); Zhu, Suming, E-mail: suming.zhu@rmit.edu.au [CAST Co-operative Research Centre, Department of Materials Engineering, Monash University, Clayton, Victoria 3800 (Australia); Parson, Nick C., E-mail: nick.parson@riotinto.com [Rio Tinto Alcan, Arvida Research and Development Centre, 1955, Mellon Blvd, Jonquière, Québec G7S 4K8 (Canada); Hill, Anita J., E-mail: anita.hill@csiro.au [CSIRO Manufacturing Flagship, Clayton, Victoria 3169 (Australia)

2016-01-15

Quench sensitivity in Al–Mg–Si alloys has been largely attributed to the solute loss at the heterogeneous nucleation sites, primarily dispersoids, during slow cooling after extrusion. As such, the number density of dispersoids, the solute type and concentration are considered to be the key variables for the quench sensitivity. In this study, quench sensitivity and the influence of natural ageing in a lean Al–Mg–Si alloy, AA6060, which contains few dispersoids, have been investigated by hardness measurement, thermal analysis, transmission electron microscopy (TEM) and positron annihilation lifetime spectroscopy (PALS). It is shown that the quench sensitivity in this alloy is associated with the degree of supersaturation of vacancies after cooling. Due to vacancy annihilation and clustering during natural ageing, the quench sensitivity is more pronounced after a short natural ageing time (30 min) compared to a longer natural ageing time (24 h). Therefore, prolonged natural ageing not only leads to an increase in hardness, but can also have a positive effect on the quench sensitivity of lean Al–Mg–Si alloys. - Highlights: • Significant quench sensitivity observed in AA6060 alloy after 30 min natural ageing • Prolonged natural ageing increased hardness and reduced QS. • Low dispersoid density leads to insignificant QS from non-hardening precipitates. • Vacancy supersaturation identified as a contributor to QS.

Effects of quench rate and natural ageing on the age hardening behaviour of aluminium alloy AA6060

International Nuclear Information System (INIS)

Strobel, Katharina; Lay, Matthew D.H.; Easton, Mark A.; Sweet, Lisa; Zhu, Suming; Parson, Nick C.; Hill, Anita J.

2016-01-01

Quench sensitivity in Al–Mg–Si alloys has been largely attributed to the solute loss at the heterogeneous nucleation sites, primarily dispersoids, during slow cooling after extrusion. As such, the number density of dispersoids, the solute type and concentration are considered to be the key variables for the quench sensitivity. In this study, quench sensitivity and the influence of natural ageing in a lean Al–Mg–Si alloy, AA6060, which contains few dispersoids, have been investigated by hardness measurement, thermal analysis, transmission electron microscopy (TEM) and positron annihilation lifetime spectroscopy (PALS). It is shown that the quench sensitivity in this alloy is associated with the degree of supersaturation of vacancies after cooling. Due to vacancy annihilation and clustering during natural ageing, the quench sensitivity is more pronounced after a short natural ageing time (30 min) compared to a longer natural ageing time (24 h). Therefore, prolonged natural ageing not only leads to an increase in hardness, but can also have a positive effect on the quench sensitivity of lean Al–Mg–Si alloys. - Highlights: • Significant quench sensitivity observed in AA6060 alloy after 30 min natural ageing • Prolonged natural ageing increased hardness and reduced QS. • Low dispersoid density leads to insignificant QS from non-hardening precipitates. • Vacancy supersaturation identified as a contributor to QS.

AAS Publishing News: Astronomical Software Citation Workshop

Science.gov (United States)

Kohler, Susanna

2015-07-01

Do you write code for your research? Use astronomical software? Do you wish there were a better way of citing, sharing, archiving, or discovering software for astronomy research? You're not alone! In April 2015, AAS's publishing team joined other leaders in the astronomical software community in a meeting funded by the Sloan Foundation, with the purpose of discussing these issues and potential solutions. In attendance were representatives from academic astronomy, publishing, libraries, for-profit software sharing platforms, telescope facilities, and grantmaking institutions. The goal of the group was to establish “protocols, policies, and platforms for astronomical software citation, sharing, and archiving,” in the hopes of encouraging a set of normalized standards across the field. The AAS is now collaborating with leaders at GitHub to write grant proposals for a project to develop strategies for software discoverability and citation, in astronomy and beyond. If this topic interests you, you can find more details in this document released by the group after the meeting: http://astronomy-software-index.github.io/2015-workshop/ The group hopes to move this project forward with input and support from the broader community. Please share the above document, discuss it on social media using the hashtag #astroware (so that your conversations can be found!), or send private comments to julie.steffen@aas.org.

LAS HABILIDADES SOCIALES EN UNIVERSITARIOS, ADOLESCENTES Y ALCOHÓLICOS EN RECUPERACIÓN DE UN GRUPO DE ALCOHÓLICOS ANÓNIMOS (AA/ SOCIAL ABILITIES IN ADOLESCENTS, UNIVERSITY STUDENTS AND ALCOHOLICS IN RECOVERY IN A GROUP OF ALCOHOLICS ANONYMOUS (AA

Directory of Open Access Journals (Sweden)

Carlos Nava Quiroz***

2010-03-01

Full Text Available RESUMENEntre los factores de riesgo de inicio al consumo de alcohol se encuentra el déficit en habilidades sociales, que aunqueno es determinante, sí es un factor que de alguna manera influye en la conducta de beber en exceso. En la presenteinvestigación se realizó un análisis de habilidades sociales en tres muestras distintas: universitarios, adolescentes y alcohólicosen recuperación (AA. Se utilizaron los siguientes instrumentos: Escala Multidimensional de Expresión Social – ParteMotora (EMES-M: Caballo, 1987, 2006 y la Escala Multidimensional de Expresión Social – Parte Cognitiva (EMES-C:Caballo, 1987, 2006. Estas escalas se aplicaron a una muestra de 157 participantes (74 hombres y 83 mujeres. Se distribuyeronde la siguiente forma: 58 adolescentes (estudiantes de secundaria, 55 integrantes de AA y 44 estudiantes universitarios. Seencontraron diferencias significativas entre algunas subescalas y los diferentes grupos de referencia. La mayoría de estasdiferencias se encontraron en cuanto a habilidades sociales de corte cognitivo. El grupo de alcohólicos AA marcó ladiferencia, mostrando éstos una mayor puntuación en las subescalas que indican «temor» o «preocupación» en ciertassituaciones sociales. Se discuten estos resultados y las implicaciones de éstos para el tratamiento y prevención del alcoholismo.ABSTRACTAmong the risk factors for alcohol use initiation is the deficit in social skills, which while not conclusive, if it is a factorthat somehow influences the behavior of excessive drinking. In the present study it conducted an analysis of social skills inthree different samples: college, young people and alcoholics in recovery (AA. The following instruments were used:Multidimensional Scale of Social Expression-Motor Part (EMES-M: Horse, 1987 and Multidimensional Scale of SocialExpression-Cognitive Part (EMES-C: Caballo, 1987. These scales were applied to a sample of 157 participants (74 menand 83 women and they

Overall view of AA (Bld 193)

CERN Multimedia

1980-01-01

See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

Flame AAS determination of As, Cd and Tl in soils and sediments after their simultaneous carbodithioate extraction

International Nuclear Information System (INIS)

Ivanova; Stoimenova, M.; Gentcheva, G.

1994-01-01

The extraction system ammonium tetramethylenecarbodithioate/isobutylmethylketone is applied to the simultaneous preconcentration of the toxic trace elements As, Cd and Tl from soil digests at an acidity of 2-3 mol/l sulphuric acid and to their separation from the major soil components. The extraction procedure is easily coupled to AAS. The accuracy of the method is checked by the analysis of a certified reference material. RSD is between 4 and 10%. (orig.)

Laser spectroscopy: Assessment of research needs for laser technologies applied to advanced spectroscopic methods

International Nuclear Information System (INIS)

Hurst, G.S.

1990-05-01

This report is organized as follows. Section 2 summarizes the current program of DOE's Office of Health and Environmental Research (OHER) and provides some remarks on low laser science and technology could beneficially impact most of the research programs. Section 3 provides a brief global perspective on laser technology and attempts to define important trends in the field. Similarly, Section 4 provides a global perspective on laser spectroscopy and addresses important trends. Thus, Section 5 focuses on the trends in laser technology and spectroscopy which could impact the OHER mission in significant ways and contains the basis for recommendations made in the executive summary. For those with limited familiarity with laser technology and laser spectroscopy, reference is made to Appendix 1 for a list of abbreviations and acronyms. Appendix 2 can serve a useful review or tutorial for those who are not deeply involved with laser spectroscopy. Even those familiar with laser spectroscopy and laser technology may find it useful to know precisely what the authors of this document mean by certain specialized terms and expressions. Finally, a note on the style of referencing may be appropriate. Whenever possible a book or review articles is referenced as the preferred citation. However, we frequently found it useful to reference a number of individual papers of recent origin or those which were not conveniently found in the review articles

A NOVEL METHOD OF THE HYDRIDE SEPARATION FOR THE DETERMINATION OF ARSENIC AND ANTIMONY BY AAS

Directory of Open Access Journals (Sweden)

Ganden Supriyanto

2010-06-01

Full Text Available A novel method is proposed for the hydride separation when determinining of arsenic and antimony by AAS. A chromatomembrane cell was used as preconcentration-, extraction- and separation-manifold instead of the U-tube phase separator, which is normally fitted in continuous flow vapour systems generating conventionaly the hydrides. The absorbances of the hydrides produced were measured by an atomic absorption spectrophotometer at 193.7 nm and 217.6 nm. Under optimized analytical conditions, the calibration plot for arsenic was linear from 50 to 500 ng.mL-1 (r2 = 0.9982. The precision for three subsequent measurements of 500 ng.mL-1 arsenic gave rise to a relative standard deviation of 0.4%. The detection limit was 15 ng.mL-1, which is much lower compared with that of the conventional hydride system (2000 ng.mL-1. A similar result was observed in case of antimony: the detection limit was 8 ng.mL-1 when the proposed method was applied. Consequently, the sensitivity of the novel method surpasses systems with conventional hydride generation, i.e. the precision and the acuracy increase whereas the standard deviation and the detection limit decrease. The proposed method was applied in pharmacheutial analysis and the certified As-content of a commercial product was very sufficiently confirmed.   Keywords: Chromatomembrane Cell, Hydride separation, Arsenic detection, Antimony detection, AAS

The use of CR1aa for ovine in vitro embryo production

Directory of Open Access Journals (Sweden)

Yulnawati

2006-06-01

Full Text Available The aim of this study was to investigate the capacity of CR1aa as a simple medium for maturation, fertilization and culture of ovine embryo in vitro. Oocytes were collected by slicing method in Phosphate Buffer Saline (PBS supplemented with 5% Fetal Bovine Serum (FBS and 100 IU/ml penicillin streptomycin. Oocytes were matured in Tissue Culture Medium (TCM-199 as control or CR1aa as treatment medium. Both maturation medium were supplemented with 10% Fetal Bovine Serum (FBS, 10 IU/ml Follicle Stimulating Hormone (FSH, 10 IU/ml Luteinizing Hormone (LH, 1 μg/ml Estradiol and 100 IU/ml penicillin-streptomycin. Oocytes were incubated in 5% CO2 incubator, 38˚C for 24 h. Matured oocytes were fertilized in BO or CR1aa medium, supplemented with 2.5 mM caffeine benzoate and 20 mg /ml heparin. After 18 h in vitro fertilization, oocytes were cultured in TCM-199 or CR1aa medium, both supplemented with 5% FBS, 5 mg/ml insulin and 100 IU/ml penicillin streptomycin. Results showed that the highest maturation rate was found in TCM-199 medium (73.27% and significantly different (P0.05 between cleavage rate of ovine embryos in TCM-199 and CR1aa medium (39.45% vs 50.94%. In conclusion, optimum result on ovine in vitro embryo production can be achieved from a combination of TCM-199 as maturation medium and CR1aa as fertilization and culture medium.

Two-dimensional optical correlation spectroscopy applied to liquid/glass dynamics

OpenAIRE

Lazonder, Kees; Pshenichnikov, Maxim S.; Wiersma, Douwe A.; Corkum, Paul; Jonas, David M.; Miller, R.J. Dwayne.; Weiner, Andrew M.

2007-01-01

Correlation spectroscopy was used to study the effects of temperature and phase changes on liquid and glass solvent dynamics. By assessing the eccentricity of the elliptic shape of a 2D optical correlation spectrum the value of the underlying frequency-frequency correlation function can be retrieved through a very simple relationship. This method yielded both intuitive clues and a quantitative measure of the dynamics of the system.

NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

PHOTOACOUSTIC SPECTROSCOPY USING A SYNCHROTRON LIGHT SOURCE

International Nuclear Information System (INIS)

JACKSON, R.S.; MICHAELIAN, K.H.; HOMES, C.C.

2001-01-01

We have investigated the use of a synchrotron as a source for infrared photoacoustic spectroscopy. A synchrotron has an intrinsically high radiance, which is beneficial when photoacoustic spectroscopy is applied to small samples, especially at long wavelengths

Lu AA21004, a novel multimodal antidepressantwith activity exerted through serotonergic targets

DEFF Research Database (Denmark)

Mork, A.; Pehrson, A.; Montezinho, L. C. P.

2012-01-01

Background: Lu AA21004 is a multimodal antidepressant that functions as a 5-HT3 and 5-HT7 receptor antagonist, 5-HT1B receptor partial agonist, 5-HT1A receptor agonist and inhibitor of the 5-HT transporter in vitro. Here we investigated preclinical effects of Lu AA21004 1) on target occupancies, 2...... (5-HT), noradrenaline (NA), dopamine (DA), acetylcholine (ACh), histamine (Hist)] were measured by microdialysis. Antidepressant potential was assessed in the forced swim test using Flinders Sensitive Line (FSL) rats. Moreover, effects of Lu AA21004 on acquisition, consolidation and recall...

AA, vacuum tank for stochastic precooling

CERN Multimedia

CERN PhotoLab

1979-01-01

The vaccum tank in which the fast stochastic precooling kicker was installed. It is clad with heating jackets for bake-out to 200 deg C, indispensable for reaching the operational vacuum of 7E-11 Torr. Alain Poncet, responsible for AA vacuum, is looking on. See also 7910268, 8002234.

Inhibitory effect of konjac glucomanan on pitting corrosion of AA5052 aluminium alloy in NaCl solution.

Science.gov (United States)

Zhang, Kegui; Yang, Wenzhong; Xu, Bin; Chen, Yun; Yin, Xiaoshuang; Liu, Ying; Zuo, Huanzhen

2018-05-01

A natural carbohydrate polymer, konjac glucomanan, has been extracted from commercial product and studied as a green corrosion inhibitor for AA5052 aluminium alloy in 3.5 wt% NaCl solution by high-performance gel permeation chromatography (GPC), thermo gravimetric analysis (TGA), Fourier-transform infrared (FT-IR) spectra, electrochemical measurement and surface characterization techniques. The results of GPC measurements suggest the weight-average molecular weight and the number-average molecular weight of KGM with 98.2% purity are 1.61 × 10 5  g/mol and 1.54 × 10 5  g/mol, respectively. Potentiodynamic polarization curves show konjac glucomanan behaves as a mixed-type inhibitor with dominant anodic effect and that its maximum efficiency at 200 ppm is 94%. Electrochemical impedance spectroscopy (EIS) studies reveal the resistance of oxide film is approximately two orders of magnitude greater than the resistance of adsorbed inhibitor layer and that they both increase with KGM concentration. Moreover, in-situ electrochemical noise (EN) detection demonstrates that the growth and propagation stages of the pitting corrosion germinating on metal surface are blocked by polysaccharide additive, which is confirmed by the surface analysis of aluminium alloy using scanning electron microscope (SEM), energy dispersive spectroscopy (EDS) and Raman spectroscopy. At last, it is found that the addition of KGM makes it harder for water droplet containing NaCl to wet the metallic substrate. Copyright © 2018 Elsevier Inc. All rights reserved.

Development and validation of an SPE HG-AAS method for determination of inorganic arsenic in samples of marine origin

Energy Technology Data Exchange (ETDEWEB)

Rasmussen, Rie R.; Larsen, Erik H.; Sloth, Jens J. [Technical University of Denmark, National Food Institute, Division of Food Chemistry, Soeborg (Denmark); Hedegaard, Rikke V. [Technical University of Denmark, National Food Institute, Division of Food Chemistry, Soeborg (Denmark); University of Copenhagen, Faculty of Life Sciences, Department of Food Science, Frederiksberg (Denmark)

2012-07-15

The present paper describes a novel method for the quantitative determination of inorganic arsenic (iAs) in food and feed of marine origin. The samples were subjected to microwave-assisted extraction using diluted hydrochloric acid and hydrogen peroxide, which solubilised the analytes and oxidised arsenite (As{sup III}) to arsenate (As{sup V}). Subsequently, a pH buffering of the sample extract at pH 6 enabled selective elution of As{sup V} from a strong anion exchange solid-phase extraction (SPE) cartridge. Hydride generation atomic absorption spectrometry (HG-AAS) was applied to quantify the concentration of iAs (sum of As{sup III} and As{sup V}) as the total arsenic (As) in the SPE eluate. The results of the in-house validation showed that mean recoveries of 101-104% were achieved for samples spiked with iAs at 0.5, 1.0 and 1.5 mg.kg{sup -1}, respectively. The limit of detection was 0.08 mg kg{sup -1}, and the repeatability (RSD{sub r}) and intra-laboratory reproducibility (RSD{sub IR}) were less than 8% and 13%, respectively, for samples containing 0.2 to 1.5 mg kg{sup -1} iAs. The trueness of the SPE HG-AAS method was verified by confirming results obtained by parallel analysis using high-performance liquid chromatography coupled to inductively coupled plasma mass spectrometry. It was demonstrated that the two sets of results were not significantly different (P < 0.05). The SPE HG-AAS method was applied to 20 marine food and feed samples, and concentrations of up to 0.14 mg kg{sup -1} of iAs were detected. (orig.)

Fundamental Study of Electron Beam Welding of AA6061-T6 Aluminum Alloy for Nuclear Fuel Plate Assembly (II)

International Nuclear Information System (INIS)

Kim, Soosung; Lee, Haein; Lee, Donbae; Park, Jongman; Lee, Yoonsang

2013-01-01

Certain characteristics, such as solidification cracking, porosity, HAZ (Heat-affected Zone) degradation must be considered during welding. Because of high energy density and low heat input, especially LBW and EBW processes posses the advantage of minimizing the fusing zone and HAZ and producing deeper penetration than arc welding processes. In present study, to apply for the nuclear fuel plate fabrication and assembly, a fundamental EBW experiment using AA6061-T6 aluminum alloy specimens was conducted. Furthermore, to establish the welding process, and satisfy the requirements of the weld quality, EBW apparatus using a electron welding gun and vacuum chamber was developed, and preliminary investigations for optimizing the welding parameters of the specimens using AA6061-T6 aluminum plates were also performed. In this experiment, a feasibility test was carried out by tensile tester, bead-on-plate welding and metallographic examination to comply with the aluminum welding procedure. The EB weld quality of AA6061-T6 aluminum alloy for the fuel plate assembly has been also studied by the mechanical testing and microstructure examinations. This study was carried out to determine the suitable welding process and to investigate tensile strength of AA6061-T6 aluminum alloy. In the present experiment, satisfactory EBW of the square butt weld specimens was developed. In comparison with the rolling directions of test specimens, the tensile strengths were no difference between the longitudinal and transverse welds. Based on this fundamental study, fabrication and assembly of the nuclear fuel plates will be provided for the future Kijang research reactor project

Vip3Aa induces apoptosis in cultured Spodoptera frugiperda (Sf9) cells.

Science.gov (United States)

Jiang, Kun; Mei, Si-Qi; Wang, Ting-Ting; Pan, Jin-Hua; Chen, Yue-Hua; Cai, Jun

2016-09-15

The vegetative insecticidal proteins (Vip) secreted by many Bacillus thuringiensis strains during their vegetative growth stage are regarded as second generation insecticidal proteins, as they share no sequence or structural homology with known crystal insecticidal proteins (Cry) and have a broad insecticidal spectrum. Compared with insecticidal crystal proteins (ICPs), the insecticidal mechanisms of Vips have been little studied. Here we investigated the mechanism responsible for Vip3Aa toxicity in cultured insect cells. Using, flow cytometry analyzes, TUNEL staining and DNA fragmentation assays, we show that Vip3Aa can induce apoptosis in Spodoptera frugiperda (Sf9) cells and cause cells to arrest at the G2/M phase. We also show that Vip3Aa can disrupt mitochondrial membrane potential (ΔΨm), leading to the activation of Sf-caspase-1, suggesting that a mitochondrial mediated and caspase dependent pathway may be involved in Vip3Aa-induced apoptosis in Sf9 cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

Rectification induced in N2AA-doped armchair graphene nanoribbon device

International Nuclear Information System (INIS)

Chen, Tong; Wang, Ling-Ling; Luo, Kai-Wu; Xu, Liang; Li, Xiao-Fei

2014-01-01

By using non-equilibrium Green function formalism in combination with density functional theory, we investigated the electronic transport properties of armchair graphene nanoribbon devices in which one lead is undoped and the other is N 2 AA -doped with two quasi-adjacent substitutional nitrogen atoms incorporating pairs of neighboring carbon atoms in the same sublattice A. Two kinds of N 2 AA -doped style are considered, for N dopants substitute the center or the edge carbon atoms. Our results show that the rectification behavior with a large rectifying ratio can be found in these devices and the rectifying characteristics can be modulated by changing the width of graphene nanoribbons or the position of the N 2 AA dopant. The mechanisms are revealed to explain the rectifying behaviors.

Cell volume regulation in hemoglobin CC and AA erythrocytes

International Nuclear Information System (INIS)

Berkowitz, L.R.; Orringer, E.P.

1987-01-01

Swelling hemoglobin CC erythrocytes stimulates a ouabain-insensitive K flux that restores original cell volume. Studies were performed with the K analog, 86 Rb. This volume regulatory pathway was characterized for its anion dependence, sensitivity to loop diuretics, and requirement for Na. The swelling-induced K flux was eliminated if intracellular chloride was replaced by nitrate and both swelling-activated K influx and efflux were partially inhibited by 1 mM furosemide or bumetanide. K influx in swollen hemoglobin CC cells was not diminished when Na in the incubation medium was replaced with choline, indicating Na independence of the swelling-induced flux. Identical experiments with hemoglobin AA cells also demonstrated a swelling-induced increase in K flux, but the magnitude and duration of this increase were considerably less than that seen with hemoglobin CC cells. The increased K flux in hemoglobin AA cells was likewise sensitive to anion replacement and to loop diuretics and did not require the presence of Na. These data indicate that a volume-activated K pathway with similar transport characteristics exists in both hemoglobin CC and AA red cells

Somatic effects of AAS abuse: A 30-years follow-up study of male former power sports athletes.

Science.gov (United States)

Lindqvist Bagge, A S; Rosén, T; Fahlke, C; Ehrnborg, C; Eriksson, B O; Moberg, T; Thiblin, I

2017-09-01

The aim of the present study was to investigate the association between somatic health and former abuse of AAS in former elite male athletes 30 years after the end of their active sports career. Retrospective follow-up study. N=996 former elite male athletes were sent a questionnaire concerning sociodemographic variables, previous and past sport activity and lifetime prevalence of seeking professional help for health problems. N=683 (68.6%) answered the questionnaire. The lifetime prevalence of AAS-abuse was 21% (n=143), while 79% (n=540) did not admit having ever used AAS. Former AAS-abuse was associated with tendon ruptures (p=0.01), depression (p=0.001), anxiety (p=0.01) and lower prevalence of prostate hypertrophy (p=0.01) and decreased libido (p=0.01). Former advanced AAS-abusers had higher anxiety (p=0.004) compared to the former less advanced AAS-abusers. Moreover, former advanced AAS-abusers, compared to AAS-naïves, reported more psychiatric problems (p=0.002), depression (p=0.003) and anxiety (p=0.00). A former AAS-abuse seems to be associated with some somatic and mental health problem, although a former less advanced AAS-abuse is related to lower incidence of prostate hypertrophy. The results raise the question whether some of these associations might be dose- and frequency dependent. These findings should however be seen as hypothesis generating and further studies are needed. Copyright © 2017 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.

Applying the Expectancy-Value Model to understand health values.

Science.gov (United States)

Zhang, Xu-Hao; Xie, Feng; Wee, Hwee-Lin; Thumboo, Julian; Li, Shu-Chuen

2008-03-01

Expectancy-Value Model (EVM) is the most structured model in psychology to predict attitudes by measuring attitudinal attributes (AAs) and relevant external variables. Because health value could be categorized as attitude, we aimed to apply EVM to explore its usefulness in explaining variances in health values and investigate underlying factors. Focus group discussion was carried out to identify the most common and significant AAs toward 5 different health states (coded as 11111, 11121, 21221, 32323, and 33333 in EuroQol Five-Dimension (EQ-5D) descriptive system). AAs were measured in a sum of multiplications of subjective probability (expectancy) and perceived value of attributes with 7-point Likert scales. Health values were measured using visual analog scales (VAS, range 0-1). External variables (age, sex, ethnicity, education, housing, marital status, and concurrent chronic diseases) were also incorporated into survey questionnaire distributed by convenience sampling among eligible respondents. Univariate analyses were used to identify external variables causing significant differences in VAS. Multiple linear regression model (MLR) and hierarchical regression model were used to investigate the explanatory power of AAs and possible significant external variable(s) separately or in combination, for each individual health state and a mixed scenario of five states, respectively. Four AAs were identified, namely, "worsening your quality of life in terms of health" (WQoL), "adding a burden to your family" (BTF), "making you less independent" (MLI) and "unable to work or study" (UWS). Data were analyzed based on 232 respondents (mean [SD] age: 27.7 [15.07] years, 49.1% female). Health values varied significantly across 5 health states, ranging from 0.12 (33333) to 0.97 (11111). With no significant external variables identified, EVM explained up to 62% of the variances in health values across 5 health states. The explanatory power of 4 AAs were found to be between 13

Influence of molybdate species on the tartaric acid/sulphuric acid anodic films grown on AA2024 T3 aerospace alloy

Energy Technology Data Exchange (ETDEWEB)

Garcia-Rubio, M. [Departamento de Quimica-Fisica Aplicada, Universidad Autonoma de Madrid, 28049 Madrid (Spain); Department of Surface Technologies, Engineering of Materials and Processes, Airbus Spain, Av. John Lennon s/n 28906 Getafe (Spain); Ocon, P. [Departamento de Quimica-Fisica Aplicada, Universidad Autonoma de Madrid, 28049 Madrid (Spain)], E-mail: pilar.ocon@uam.es; Climent-Font, A. [Departamento de Fisica Aplicada, Universidad Autonoma de Madrid (UAM), 28049 Madrid (Spain); Centro de Micro-Analisis de Materiales (CMAM), Universidad Autonoma de Madrid (UAM), 28049 Madrid (Spain); Smith, R.W. [Unidad de Microanalisis de Materiales, Parque Cientifico de Madrid (PCM), Campus de Cantoblanco, 28049 Madrid (Spain); Curioni, M.; Thompson, G.E.; Skeldon, P. [Corrosion and Protection Centre, School of Materials, University of Manchester, M60 1QD England (United Kingdom); Lavia, A.; Garcia, I. [Department of Surface Technologies, Engineering of Materials and Processes, Airbus Spain, Av. John Lennon s/n 28906 Getafe (Spain)

2009-09-15

AA2024 T3 alloy specimens have been anodised in tartaric acid/sulphuric media and tartaric acid/sulphuric media containing sodium molybdate; molybdate species were added to the anodising bath to enhance further the protection provided by the porous anodic film developed over the macroscopic alloy surface. Morphological characterisation of the anodic films formed in both electrolytes was undertaken using scanning electron and transmission electron microscopies; the chemical compositions of the films were determined by Rutherford backscattering spectroscopy that was complemented by elemental depth profiling using rf-glow discharge optical emission spectrometry. The electrochemical behaviour was evaluated using potentiodynamic polarisations and electrochemical impedance spectroscopy; the corrosion performance was examined after salt spray testing. The porous anodic film morphology was little influenced by the addition of molybdate salt, although thinner films were generated in its presence. Chemical composition of the anodic film was roughly similar; however, addition of sodium molybdate in the anodizing bath resulted in residues of molybdate species in the porous skeleton and improved corrosion resistance measured by electrochemical techniques that was confirmed by salt spray testing.

Influence of molybdate species on the tartaric acid/sulphuric acid anodic films grown on AA2024 T3 aerospace alloy

International Nuclear Information System (INIS)

Garcia-Rubio, M.; Ocon, P.; Climent-Font, A.; Smith, R.W.; Curioni, M.; Thompson, G.E.; Skeldon, P.; Lavia, A.; Garcia, I.

2009-01-01

AA2024 T3 alloy specimens have been anodised in tartaric acid/sulphuric media and tartaric acid/sulphuric media containing sodium molybdate; molybdate species were added to the anodising bath to enhance further the protection provided by the porous anodic film developed over the macroscopic alloy surface. Morphological characterisation of the anodic films formed in both electrolytes was undertaken using scanning electron and transmission electron microscopies; the chemical compositions of the films were determined by Rutherford backscattering spectroscopy that was complemented by elemental depth profiling using rf-glow discharge optical emission spectrometry. The electrochemical behaviour was evaluated using potentiodynamic polarisations and electrochemical impedance spectroscopy; the corrosion performance was examined after salt spray testing. The porous anodic film morphology was little influenced by the addition of molybdate salt, although thinner films were generated in its presence. Chemical composition of the anodic film was roughly similar; however, addition of sodium molybdate in the anodizing bath resulted in residues of molybdate species in the porous skeleton and improved corrosion resistance measured by electrochemical techniques that was confirmed by salt spray testing.

Photoacoustic and photothermal spectroscopies

International Nuclear Information System (INIS)

Sawada, Tsuguo; Kitamori, Takehiko; Nakamura, Masato

1995-01-01

Photoacoustic and photothermal spectroscopy methods can be effectively applied to the analysis of microparticles in condensed matter. A more violent photothermal conversion phenomenon of a particle, laser breakdown and accompanying plasma and acoustic emission, was applied to individual detection and analysis of ultrafine particles in ultrapure water. Laser-like nonlinear emission from the plasma was observed. (author)

Molecular studies by electron spectroscopy

International Nuclear Information System (INIS)

Hansteen, J.M.

1977-01-01

Experience gained in experimental nuclear physics has played a large role in the development of electron spectroscopy as a powerful tool for studying chemical systems. The use of ESCA (Electron Spectroscopy for Chemical Analysis) for the mapping of molecular properties connected with inner as well as outer electron shells is reviewed, mainly from a phenomological point of view. Molecular Auger electron spectroscopy is described as a means of gaining information on details in molecular structure, simultaneously being extensively applied for surface studies. Future highly promising research areas for molecular electron spectroscopy are suggested to be (e,2e) processes as well as continued exploitation of synchrotron radiation from high energy nuclear devices. (Auth.)

A combinatorial matrix of rare earth chloride mixtures as corrosion inhibitors of AA2024-T3: Optimisation using potentiodynamic polarisation and EIS

International Nuclear Information System (INIS)

Muster, T.H.; Sullivan, H.; Lau, D.; Alexander, D.L.J.; Sherman, N.; Garcia, S.J.; Harvey, T.G.; Markley, T.A.; Hughes, A.E.; Corrigan, P.A.; Glenn, A.M.; White, P.A.; Hardin, S.G.; Mardel, J.; Mol, J.M.C.

2012-01-01

A combinatorial matrix of four rare earth chlorides has been evaluated for the corrosion inhibition of aluminium alloy AA2024-T3 in aqueous solution. Two electrochemical techniques, potentiodynamic polarisation (PP) and electrochemical impedance spectroscopy (EIS), were used to evaluate AA2024-T3 corrosion in 0.1 M NaCl with the addition of 10 −3 M of rare earth chloride mixtures at time periods up to 18 h. PP experiments showed rare earth inhibition of up to 98% within the first hour and thereafter corrosion rates were steadily decreased. The open-circuit potential (OCP) of AA2024-T3 decreased as a function of time for all solutions indicating predominantly cathodic inhibition. However, differing trends in the OCP were observed during PP and EIS experiments and are discussed in terms of likely time-dependent mechanisms. A comparative study of optimisation models indicated the best mixture at 10 −3 M total inhibitor concentration was predicted to be 72% cerium (Ce) and 28% (praseodymium (Pr)/lanthanum (La)) ions. As the amount of Ce is decreased from this level the corrosion inhibition is predicted to decrease also, regardless of what other rare earths (La, Pr and Nd) are added alone or in combination. Individually, La, Pr and Nd show varying levels of corrosion inhibition activity, all of which are inferior to that of Ce. If Ce is absent entirely, then a mixture of approximately 50% Pr and 50% Nd is predicted to be preferred. This is one of the first applications of combinatorial design for the optimisation of corrosion inhibitor mixtures.

Foundations of laser spectroscopy

CERN Document Server

Stenholm, Stig

2005-01-01

A simple presentation of the theoretical foundations of steady-state laser spectroscopy, this text helps students to apply theory to calculations with a systematic series of examples and exercises. 1984 edition.

Microstructure and hardness performance of AA6061 aluminium composite using friction stir processing

Science.gov (United States)

Marini, C. D.; Fatchurrohman, N.

2018-04-01

Rice husk ash (RHA) is an industrial waste that has become a potential reinforced material for aluminium matrix composite (AMCs) due to low cost and abundantly available resources. Friction stir processing (FSP) has been introduced as a method to modify surface properties of the metal and alloy including theirs composite as well. The present work reports the production and characterization of AA6061 and AA6061/5 vol% RHA using FSP using parameters rotation speed 1000 rpm and traversed speed 25 mm/min. The microstructure was studied using optical microscopy (OM). A homogenous dispersion of RHA particles was obtained in the composite. No agglomeration or segregation was observed. The produced composite exhibited a fine grain structure. An improvement in hardness profile was observed as AA6061/5 vol% RHA improves in hardness compared to FSPed of AA6061 without reinforcement.

Experimental immunologically mediated aplastic anemia (AA) in H-2k identical, Mls (M) locus different mice

Energy Technology Data Exchange (ETDEWEB)

Knospe, W.H.; Steinberg, D.; Speck, B.

1983-07-01

Immunologically mediated aplastic anemia (AA) was experimentally induced in mice by injecting 10(7) lymph node cells (LNC) from donor mice of one inbred strain to another H-2k identical but Mls mismatched strain previously given 600 rad total body gamma irradiation (TBI). AA developed after 2 weeks to 6 months in selected strain combinations used and usually 60 to 90% of the mice died. Clinical signs of graft-versus-host disease did not occur and splenic atrophy rather than splenomegaly was the rule. Histologically these mice had a lesion of the hematopoietic microenvironment characterized by sinusoidal injury and stromal necrosis. Others have demonstrated injury to hematopoietic stem cells. C3H/He LNC induced AA whereas C3H/HeJ LNC failed to induce AA. The C3H/HeJ strain carries a macrophage defect and these results suggest that a macrophage-like cell may be a mediator of immunological injury in this experimental model. Although all strain combinations evaluated were H-2k identical and Mls mismatched, certain Mls combinations resulted in AA and identical Mls mismatched but different strains did not. Both strong (Mlsd) and weak (Mlsc) stimulating LNC induce AA but simple Mls differences do not explain the AA as similar Mls combinations but different strain combinations fail to induce AA.

Feasibility of the UV/AA process as a pretreatment approach for bioremediation of dye-laden wastewater.

Science.gov (United States)

Yang, Minghui; Wu, Bingdang; Li, Qiuhao; Xiong, Xiaofeng; Zhang, Haoran; Tian, Yu; Xie, Jiawen; Huang, Ping; Tan, Suo; Wang, Guodong; Zhang, Li; Zhang, Shujuan

2018-03-01

Biodegradability and toxicity are two important indexes in considering the feasibility of a chemical process for environmental remediation. The acetylacetone (AA) mediated photochemical process has been proven as an efficient approach for dye decolorization. Both AA and its photochemical degradation products had a high bioavailability. However, the biocompatibility and ecotoxicology of the UV/AA treated solutions are unclear yet. In the present work, we evaluated the biocompatibility and toxicity of the UV/AA treated solutions at both biochemical and organismal levels. The biodegradability of the treated solution was evaluated with the ratio of 5-d biological oxygen demand (BOD 5 ) to chemical oxygen demand (COD) and a 28-d activated sludge assay (Zahn-Wellens tests). The UV/AA process significantly improved the biodegradability of the tested dye solutions. Toxicity was assessed with responses of microorganisms (microbes in activated sludge and Daphnia magna) and plants (bok choy, rice seed, and Arabidopsis thaliana) to the treated solutions, which showed that the toxicity of the UV/AA treated solutions was lower or comparable to that of the UV/H 2 O 2 counterparts. The results are helpful for us to determine whether the UV/AA process is applicable to certain wastewaters and how the UV/AA process could be effectively combined into a sequential chemical-biological water treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

Dual roles for CoAA and its counterbalancing isoform CoAM in human kidney cell tumorigenesis

Science.gov (United States)

Kang, Yun Kyoung; Schiff, Rachel; Ko, Lan; Wang, Tao; Tsai, Sophia Y.; Tsai, Ming-Jer; W. O’Malley, Bert

2008-01-01

Co-Activator Activator (CoAA) has been reported to be a coactivator that regulates steroid receptor-mediated transcription and alternative RNA splicing. Herein we show that CoAA is a dual-function coregulator that inhibits G1/S transition in human kidney cells and suppresses anchorage independent growth and xenograft tumor formation. Suppression occurs in part by downregulating c-myc and its downstream effectors ccnd1 and skp2, and causing accumulation of p27/Kip1 protein. In this cellular setting, CoAA directly represses the proto-oncogene, c-myc by recruiting HDAC3 protein and decreasing both the acetylation of histone H3 and the presence of RNA polymerase II on the c-myc promoter. Interestingly, a splicing isoform of CoAA, Coactivator Modulator (CoAM), antagonizes CoAA-induced G1/S transition and growth inhibition by negatively regulating the mRNA levels of the endogenous CoAA isoform. In addition, we found that expression of CoAA protein is significantly decreased in human renal cell carcinoma as compared to normal kidney. Our study presents evidence that CoAA is a potential tumor suppressor in renal carcinoma and that CoAM is a counterbalancing splice-isoform. This is so far the only example of a nuclear receptor coregulator involved in suppression of kidney cancer, and suggests potentially significant new roles for coregulators in renal cancer biology. PMID:18829545

Heavy metal concentrations in soils as determined by laser-induced breakdown spectroscopy (LIBS), with special emphasis on chromium

International Nuclear Information System (INIS)

Senesi, G.S.; Dell'Aglio, M.; Gaudiuso, R.; De Giacomo, A.; Zaccone, C.; De Pascale, O.; Miano, T.M.; Capitelli, M.

2009-01-01

Soil is unanimously considered as one of the most important sink of heavy metals released by human activities. Heavy metal analysis of natural and polluted soils is generally conducted by the use of atomic absorption spectroscopy (AAS) or inductively coupled plasma optical emission spectroscopy (ICP-OES) on adequately obtained soil extracts. Although in recent years the emergent technique of laser-induced breakdown spectroscopy (LIBS) has been applied widely and with increasing success for the qualitative and quantitative analyses of a number of heavy metals in soil matrices with relevant simplification of the conventional methodologies, the technique still requires further confirmation before it can be applied fully successfully in soil analyses. The main objective of this work was to demonstrate that new developments in LIBS technique are able to provide reliable qualitative and quantitative analytical evaluation of several heavy metals in soils, with special focus on the element chromium (Cr), and with reference to the concentrations measured by conventional ICP spectroscopy. The preliminary qualitative LIBS analysis of five soil samples and one sewage sludge sample has allowed the detection of a number of elements including Al, Ca, Cr, Cu, Fe, Mg, Mn, Pb, Si, Ti, V and Zn. Of these, a quantitative analysis was also possible for the elements Cr, Cu, Pb, V and Zn based on the obtained linearity of the calibration curves constructed for each heavy metal, i.e., the proportionality between the intensity of the LIBS emission peaks and the concentration of each heavy metal in the sample measured by ICP. In particular, a triplet of emission lines for Cr could be used for its quantitative measurement. The consistency of experiments made on various samples was supported by the same characteristics of the laser-induced plasma (LIP), i.e., the typical linear distribution confirming the existence of local thermodynamic equilibrium (LTE) condition, and similar excitation

Heavy metal concentrations in soils as determined by laser-induced breakdown spectroscopy (LIBS), with special emphasis on chromium.

Science.gov (United States)

Senesi, G S; Dell'Aglio, M; Gaudiuso, R; De Giacomo, A; Zaccone, C; De Pascale, O; Miano, T M; Capitelli, M

2009-05-01

Soil is unanimously considered as one of the most important sink of heavy metals released by human activities. Heavy metal analysis of natural and polluted soils is generally conducted by the use of atomic absorption spectroscopy (AAS) or inductively coupled plasma optical emission spectroscopy (ICP-OES) on adequately obtained soil extracts. Although in recent years the emergent technique of laser-induced breakdown spectroscopy (LIBS) has been applied widely and with increasing success for the qualitative and quantitative analyses of a number of heavy metals in soil matrices with relevant simplification of the conventional methodologies, the technique still requires further confirmation before it can be applied fully successfully in soil analyses. The main objective of this work was to demonstrate that new developments in LIBS technique are able to provide reliable qualitative and quantitative analytical evaluation of several heavy metals in soils, with special focus on the element chromium (Cr), and with reference to the concentrations measured by conventional ICP spectroscopy. The preliminary qualitative LIBS analysis of five soil samples and one sewage sludge sample has allowed the detection of a number of elements including Al, Ca, Cr, Cu, Fe, Mg, Mn, Pb, Si, Ti, V and Zn. Of these, a quantitative analysis was also possible for the elements Cr, Cu, Pb, V and Zn based on the obtained linearity of the calibration curves constructed for each heavy metal, i.e., the proportionality between the intensity of the LIBS emission peaks and the concentration of each heavy metal in the sample measured by ICP. In particular, a triplet of emission lines for Cr could be used for its quantitative measurement. The consistency of experiments made on various samples was supported by the same characteristics of the laser-induced plasma (LIP), i.e., the typical linear distribution confirming the existence of local thermodynamic equilibrium (LTE) condition, and similar excitation

Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

International Nuclear Information System (INIS)

Sagai Francis Britto, A.; Raj, R. Edwin; Mabel, M. Carolin

2017-01-01

Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

Prediction of shear and tensile strength of the diffusion bonded AA5083 and AA7075 aluminium alloy using ANN

Energy Technology Data Exchange (ETDEWEB)

Sagai Francis Britto, A. [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Raj, R. Edwin, E-mail: redwinraj@gmail.com [Department of Mechanical Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India); Mabel, M. Carolin [Department of Electrical and Electronics Engineering, St.Xavier' s Catholic College of Engineering, Nagercoil 629003,Tamil Nadu (India)

2017-04-24

Diffusion bonding is a pressure welding technique to establish bonds by inter diffusion of atoms. Bonding characteristics were generated by varying the significant process conditions such as the bonding temperature, the pressing load and the duration of pressure while bonding the aluminium alloys AA5083 and AA7075. Deriving analytical correlation with the process variables to weld strength is quite involved due to the non-linear dependency of the process variables with the mechanical strength of the joints. An arbitrary function approximation mechanism, the artificial neural network (ANN) is therefore employed to develop the models for predicting the mechanical properties of the bonded joints. Back propagation technique, which alters the network weights to minimize the mean square error was used to develop the ANN models. The models were tested, validated and found to be satisfactory with good prediction accuracy.

Parallelism between gradient temperature raman spectroscopy and differential scanning calorimetry results

Science.gov (United States)

Temperature dependent Raman spectroscopy (TDR) applies the temperature gradients utilized in differential scanning calorimetry (DSC) to Raman spectroscopy, providing a straightforward technique to identify molecular rearrangements that occur just prior to phase transitions. Herein we apply TDR and D...

AA, sandwich line with magnetic horn

CERN Multimedia

CERN PhotoLab

1980-01-01

Continuation from 8010293: Finally, the sandwich line with the horn is placed on the ground, for the horn to be inspected and, if needed, exchanged for a new one. The whole procedure was trained with several members of the AA team, for quick and safe handling, and to share the radiation dose amongst them.

AA, mating of BST magnet halves

CERN Multimedia

CERN PhotoLab

1980-01-01

The AA had 2 types of bending magnets: BLG (window-frame,long and narrow) and BST (H-type, short and wide). The BST had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the mating of two BST halves.

Antibacterial effect of PEO coating with silver on AA7075

Energy Technology Data Exchange (ETDEWEB)

Cerchier, P., E-mail: pietrogiovanni.cerchier@studenti.unipd.it [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy); Pezzato, L.; Brunelli, K. [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy); Dolcet, P. [Department of Chemical Science, University of Padua, INSTM, UdR Padova and ICMATE-CNR, Padova (Italy); Bartolozzi, A.; Bertani, R.; Dabalà, M. [Department of Industrial Engineering, University of Padua, Via Marzolo 9, 35131 Padova (Italy)

2017-06-01

In this work, plasma electrolytic oxidation (PEO) coatings were produced on AA7075 using alkaline solution containing silicates compounds and silver micrometric particles in order to give to the coating an antimicrobial effect. In the optic of circular economy, silver chloride derived from the acid pre-treatment of electronic scraps was used as raw material and successively silver powders were synthesized from silver chloride solution using glucose syrup as reducing agent. The coatings were characterized by scanning electron microscope (SEM), X-ray diffraction analysis (XRD), X-ray photoelectron spectroscopy (XPS), potentiodynamic polarization test and antimicrobial tests. The results evidenced that the obtained coatings were homogenous and give to the samples higher corrosion resistance than untreated alloy. The silver particles, found both inside and outside of the pores that characterize the PEO layer, produced an efficacious antimicrobial effect both against E. coli and S. aureus. - Highlights: • Silver particles were incorporated into PEO coatings produced on aluminum alloys. • The incorporation was performed with direct addition of the particles in the electrolyte. • The particles resulted equally distributed on the samples surfaces. • The obtained coatings show antimicrobial activity with both E. coli and S. aureus. • The obtained coatings were characterized by acceptable corrosion resistance.

Antibacterial effect of PEO coating with silver on AA7075

International Nuclear Information System (INIS)

Cerchier, P.; Pezzato, L.; Brunelli, K.; Dolcet, P.; Bartolozzi, A.; Bertani, R.; Dabalà, M.

2017-01-01

In this work, plasma electrolytic oxidation (PEO) coatings were produced on AA7075 using alkaline solution containing silicates compounds and silver micrometric particles in order to give to the coating an antimicrobial effect. In the optic of circular economy, silver chloride derived from the acid pre-treatment of electronic scraps was used as raw material and successively silver powders were synthesized from silver chloride solution using glucose syrup as reducing agent. The coatings were characterized by scanning electron microscope (SEM), X-ray diffraction analysis (XRD), X-ray photoelectron spectroscopy (XPS), potentiodynamic polarization test and antimicrobial tests. The results evidenced that the obtained coatings were homogenous and give to the samples higher corrosion resistance than untreated alloy. The silver particles, found both inside and outside of the pores that characterize the PEO layer, produced an efficacious antimicrobial effect both against E. coli and S. aureus. - Highlights: • Silver particles were incorporated into PEO coatings produced on aluminum alloys. • The incorporation was performed with direct addition of the particles in the electrolyte. • The particles resulted equally distributed on the samples surfaces. • The obtained coatings show antimicrobial activity with both E. coli and S. aureus. • The obtained coatings were characterized by acceptable corrosion resistance.

Recommendations concerning magnetic resonance spectroscopy

International Nuclear Information System (INIS)

1986-01-01

In medicine the technique of nuclear magnetic resonance (NMR) is applied in the form of in vivo nuclear magnetic resonance spectroscopy (MRS). In vivo MRS can be carried out non-invasively. The committee of the Dutch Health Council briefly discusses the qualities and potentialities of the nuclei that will probably be used in future clinical spectroscopy: 31 P, 13 C, 1 H (and possibly 19 F and 23 Na). The committee discusses several possibilities of combining imaging and spectroscopy. The imaging of nuclei other than protons is also possible with MRS. Potential applications are considered in oncology, cardiology, neurology and hepatology. (Auth.)

Conformational analysis of the partially disordered measles virus N(TAIL)-XD complex by SDSL EPR spectroscopy.

Science.gov (United States)

Kavalenka, Aleh; Urbancic, Iztok; Belle, Valérie; Rouger, Sabrina; Costanzo, Stéphanie; Kure, Sandra; Fournel, André; Longhi, Sonia; Guigliarelli, Bruno; Strancar, Janez

2010-03-17

To characterize the structure of dynamic protein systems, such as partly disordered protein complexes, we propose a novel approach that relies on a combination of site-directed spin-labeled electron paramagnetic resonance spectroscopy and modeling of local rotation conformational spaces. We applied this approach to the intrinsically disordered C-terminal domain of the measles virus nucleoprotein (N(TAIL)) both free and in complex with the X domain (XD, aa 459-507) of the viral phosphoprotein. By comparing measured and modeled temperature-dependent restrictions of the side-chain conformational spaces of 12 SL cysteine-substituted N(TAIL) variants, we showed that the 490-500 region of N(TAIL) is prestructured in the absence of the partner, and were able to quantitatively estimate, for the first time to our knowledge, the extent of the alpha-helical sampling of the free form. In addition, we showed that the 505-525 region of N(TAIL) conserves a significant degree of freedom even in the bound form. The latter two findings provide a mechanistic explanation for the reported rather high affinity of the N(TAIL)-XD binding reaction. Due to the nanosecond timescale of X-band EPR spectroscopy, we were also able to monitor the disordering in the 488-525 region of N(TAIL), in particular the unfolding of the alpha-helical region when the temperature was increased from 281 K to 310 K. Copyright 2010 Biophysical Society. Published by Elsevier Inc. All rights reserved.

Dynamic Response of AA2519 Aluminum Alloy under High Strain Rates

Science.gov (United States)

Olasumboye, Adewale Taiwo

Like others in the AA2000 series, AA2519 is a heat-treatable Al-Cu alloy. Its excellent ballistic properties and stress corrosion cracking resistance, combined with other properties, qualify it as a prime candidate for armored vehicle and aircraft applications. However, available data on its high strain-rate response remains limited. In this study, AA2519 aluminum alloy was investigated in three different temper conditions: T4, T6, and T8, to determine the effects of heat treatment on the microstructure and dynamic deformation behavior of the material at high strain rates ranging within 1000 ≤ epsilon ≤ 4000 s-1. Split Hopkinson pressure bar integrated with digital image correlation system was used for mechanical response characterization. Optical microscopy and scanning electron microscopy were used to assess the microstructure of the material after following standard metallographic specimen preparation techniques. Results showed heterogeneous deformation in the three temper conditions. It was observed that dynamic behavior in each condition was dependent on strength properties due to the aging type controlling the strengthening precipitates produced and initial microstructure. At 1500 s -1, AA2519-T6 exhibited peak dynamic yield strength and flow stress of 509 and 667 MPa respectively, which are comparable with what were observed in T8 condition at higher rate of 3500 s-1 but AA2519-T4 showed the least strength and flow stress properties. Early stress collapse, dynamic strain aging, and higher susceptibility to shear band formation and fracture were observed in the T6 condition within the selected range of high strain rates. The alloy's general mode of damage evolution was by dispersoid particle nucleation, shearing and cracking.

Selection and characterization of resistance to the Vip3Aa20 protein from Bacillus thuringiensis in Spodoptera frugiperda.

Science.gov (United States)

Bernardi, Oderlei; Bernardi, Daniel; Horikoshi, Renato J; Okuma, Daniela M; Miraldo, Leonardo L; Fatoretto, Julio; Medeiros, Fernanda Cl; Burd, Tony; Omoto, Celso

2016-09-01

Spodoptera frugiperda is one the main target pests of maize events expressing Vip3Aa20 protein from Bacillus thuringiensis (Bt) in Brazil. In this study, we selected a resistant strain of S. frugiperda on Bt maize expressing Vip3Aa20 protein and characterized the inheritance and fitness costs of the resistance. The resistance ratio of the Vip3Aa20-resistant strain of S. frugiperda was >3200-fold. Neonates of the Vip3Aa20-resistant strain were able to survive and emerge as fertile adults on Vip3Aa20 maize, while larvae from susceptible and heterozygous strains did not survive. The inheritance of Vip3Aa20 resistance was autosomal recessive and monogenic. Life history studies to investigate fitness cost revealed an 11% reduction in the survival rate until adult stage and a ∼50% lower reproductive rate of the Vip3Aa20-resistant strain compared with susceptible and heterozygous strains. This is the first characterization of S. frugiperda resistance to Vip3Aa protein. Our results provide useful information for resistance management programs designed to prevent or delay resistance evolution to Vip3Aa proteins in S. frugiperda. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Determination of the orbital lineup at reactive organic semiconductor interfaces using photoemission spectroscopy

International Nuclear Information System (INIS)

Schlaf, R.; Merritt, C. D.; Picciolo, L. C.; Kafafi, Z. H.

2001-01-01

We determined the orbital lineup of the tris (8-hydroxyquinolinato) gallium (Gaq 3 )/Mg interface using combined x-ray and ultraviolet photoemission spectroscopy (XPS and UPS) measurements. The Gaq 3 /Mg system is a prototypical model structure for organic electron/low work function electrode transporting materials interfaces found in organic light emitting diodes (OLED). A Gaq 3 thin film was grown in 15 steps on a previously sputter-cleaned Mg substrate starting at a 1 Aa nominal thickness up to a final thickness of 512 Aa. Before, and in between the growth steps, the sample surface was characterized by XPS and UPS. The results indicate the formation of a reaction layer of about 12 Aa thickness at the Mg interface, which resulted in a 0.96 V interface dipole potential. At Gaq 3 coverages higher than 256 Aa, a strong charging shift occurred in the overlayer related UPS-emission lines, which was identified by measuring the high binding energy cutoff (secondary edge) of both the XP and UP spectra. The several magnitudes different x-ray and ultraviolet source photon intensities allow pinpointing charging shifts with high sensitivity. Due to the low work function of the reacted interface layer, the Gaq 3 electronic states are aligned at a binding energy below the substrate Fermi edge that exceeds the magnitude of the optical gap between the highest occupied and lowest unoccupied molecular orbitals (HOMO and LUMO). This allowed the conclusion that the ground state exciton binding energy of Gaq 3 needs to be larger than 0.43 eV. Based on these considerations, the lowest possible electron injection barrier matching the experimental data was estimated to be 0.15 eV. copyright 2001 American Institute of Physics

Applications of Raman spectroscopy in life science

Science.gov (United States)

Martin, Airton A.; T. Soto, Cláudio A.; Ali, Syed M.; Neto, Lázaro P. M.; Canevari, Renata A.; Pereira, Liliane; Fávero, Priscila P.

2015-06-01

Raman spectroscopy has been applied to the analysis of biological samples for the last 12 years providing detection of changes occurring at the molecular level during the pathological transformation of the tissue. The potential use of this technology in cancer diagnosis has shown encouraging results for the in vivo, real-time and minimally invasive diagnosis. Confocal Raman technics has also been successfully applied in the analysis of skin aging process providing new insights in this field. In this paper it is presented the latest biomedical applications of Raman spectroscopy in our laboratory. It is shown that Raman spectroscopy (RS) has been used for biochemical and molecular characterization of thyroid tissue by micro-Raman spectroscopy and gene expression analysis. This study aimed to improve the discrimination between different thyroid pathologies by Raman analysis. A total of 35 thyroid tissues samples including normal tissue (n=10), goiter (n=10), papillary (n=10) and follicular carcinomas (n=5) were analyzed. The confocal Raman spectroscopy allowed a maximum discrimination of 91.1% between normal and tumor tissues, 84.8% between benign and malignant pathologies and 84.6% among carcinomas analyzed. It will be also report the application of in vivo confocal Raman spectroscopy as an important sensor for detecting advanced glycation products (AGEs) on human skin.

AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells.

Science.gov (United States)

Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

2016-01-01

Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy.

Bone Morphogenic Protein 4-Smad-Induced Upregulation of Platelet-Derived Growth Factor AA Impairs Endothelial Function.

Science.gov (United States)

Hu, Weining; Zhang, Yang; Wang, Li; Lau, Chi Wai; Xu, Jian; Luo, Jiang-Yun; Gou, Lingshan; Yao, Xiaoqiang; Chen, Zhen-Yu; Ma, Ronald Ching Wan; Tian, Xiao Yu; Huang, Yu

2016-03-01

Bone morphogenic protein 4 (BMP4) is an important mediator of endothelial dysfunction in cardio-metabolic diseases, whereas platelet-derived growth factors (PDGFs) are major angiogenic and proinflammatory mediator, although the functional link between these 2 factors is unknown. The present study investigated whether PDGF mediates BMP4-induced endothelial dysfunction in diabetes mellitus. We generated Ad-Bmp4 to overexpress Bmp4 and Ad-Pdgfa-shRNA to knockdown Pdgfa in mice through tail intravenous injection. SMAD4-shRNA lentivirus, SMAD1-shRNA, and SMAD5 shRNA adenovirus were used for knockdown in human and mouse endothelial cells. We found that PDGF-AA impaired endothelium-dependent vasodilation in aortas and mesenteric resistance arteries. BMP4 upregulated PDGF-AA in human and mouse endothelial cells, which was abolished by BMP4 antagonist noggin or knockdown of SMAD1/5 or SMAD4. BMP4-impared relaxation in mouse aorta was also ameliorated by PDGF-AA neutralizing antibody. Tail injection of Ad-Pdgfa-shRNA ameliorates endothelial dysfunction induced by Bmp4 overexpression (Ad-Bmp4) in vivo. Serum PDGF-AA was elevated in both diabetic patients and diabetic db/db mice compared with nondiabetic controls. Pdgfa-shRNA or Bmp4-shRNA adenovirus reduced serum PDGF-AA concentration in db/db mice. PDGF-AA neutralizing antibody or tail injection with Pdgfa-shRNA adenovirus improved endothelial function in aortas and mesenteric resistance arteries from db/db mice. The effect of PDGF-AA on endothelial function in mouse aorta was also inhibited by Ad-Pdgfra-shRNA to inhibit PDGFRα. The present study provides novel evidences to show that PDGF-AA impairs endothelium-dependent vasodilation and PDGF-AA mediates BMP4-induced adverse effect on endothelial cell function through SMAD1/5- and SMAD4-dependent mechanisms. Inhibition of PGDF-AA ameliorates vascular dysfunction in diabetic mice. © 2016 American Heart Association, Inc.

Joining of hybrid AA6063-6SiCp-3Grp composite and AISI 1030 steel by friction welding

Directory of Open Access Journals (Sweden)

N. Rajesh Jesudoss Hynes

2017-10-01

Full Text Available Joining of metals and aluminium hybrid metal matrix composites has significant applications in aviation, ship building and automotive industries. In the present work, investigation is carried out on Friction Welding of AISI 1030 steel and hybrid AA6063-6SiCp-3Grpcomposite, that are difficult to weld by fusion welding technique. Silicon carbide and graphite particle reinforced AA6063 matrix hybrid composite was developed successfully using stir casting method and the joining feasibility of AISI1030 steel with AA6063-6SiCp-3Grp hybrid composite was tried out by friction stud welding technique. During friction stage of welding process, the particulates (SiC & Graphite used for reinforcement, tend to increase the viscosity and lead to improper mixing of matrix and reinforcement. This eventually results in lower strength in dissimilar joints. To overcome this difficulty AA1100 interlayer is used while joining hybrid composite to AISI 1030 steel. Experimentation was carried out using Taguchi based design of experiments (DOE technique. Multiple regression methods were applied to understand the relationship between process parameters of the friction stud welding process. Micro structural examination reveals three separate zones namely fully plasticized zone, partially deformed zone and unaffected base material zone. Ultra fine dynamically recrystallized grains of about 341 nm were observed at the fully plasticized zone. EDX analysis confirms the presence of intermetallic compound Fe2Al5 at the joint interface. According to the experimental analysis using DOE, rotational speed and interlayer sheet thickness contribute about 39% and 36% respectively in determining the impact strength of the welded joints. It is found that joining with 0.5 mm interlayer sheet provides efficient joints. Developed regression model could be used to predict the axial shortening distance and impact strength of the welded joint with reasonable accuracy.

Co-deposition of basement membrane components during the induction of murine splenic AA amyloid

DEFF Research Database (Denmark)

Lyon, A W; Narindrasorasak, S; Young, I D

1991-01-01

Past studies have demonstrated that during murine AA amyloid induction there is co-deposition of the AA amyloid peptide and the basement membrane form of heparan sulfate proteoglycan. The synthesis and accumulation of heparan sulfate proteoglycan does not usually occur in the absence of other...... basement membrane components, such as type IV collagen, laminin, and fibronectin. Using immunohistochemical techniques, the present experiments have demonstrated that in addition to the heparan sulfate proteoglycan, there are other basement membrane components present in splenic AA amyloid deposits...... and these are present as soon as AA amyloid deposits are detectable. The results indicate that within the time constraints imposed by the experiments, the basement membrane components, fibronectin, laminin, type IV collagen, and heparan sulfate proteoglycan are co-deposited 36 to 48 hours after the AgNO3 and amyloid...

Effect of temperature on cyclic deformation behavior and residual stress relaxation of deep rolled under-aged aluminium alloy AA6110

International Nuclear Information System (INIS)

Juijerm, P.; Altenberger, I.

2007-01-01

Mechanical surface treatment (deep rolling) was performed at room temperature on the under-aged aluminium wrought alloy AA6110 (Al-Mg-Si-Cu). Afterwards, specimens were cyclically deformed at room and elevated temperatures up to 250 deg. C. The cyclic deformation behavior and s/n-curves of deep rolled under-aged AA6110 were investigated by stress-controlled fatigue tests and compared to the as-polished condition as a reference. The stability of residual stresses as well as diffraction peak broadening under high-loading and/or elevated-temperature conditions was investigated by X-ray diffraction methods before and after fatigue tests. Depth profiles of near-surface residual stresses as well as full width at half maximum (FWHM) values before and after fatigue tests at elevated temperatures are presented. Thermal residual stress relaxation of deep rolled under-aged AA6110 was investigated and analyzed by applying a Zener-Wert-Avrami function. Thermomechanical residual stress relaxation was analyzed through thermal residual stress relaxation and depth profiles of residual stresses before and after fatigue tests. Finally, an effective border line for the deep rolling treatment due to instability of near-surface work hardening was found and established in a stress amplitude-temperature diagram

Nutritional values in aspects of essential and non essential elements in variety of milk samples by AAS and FES

International Nuclear Information System (INIS)

Perween, R.; Haque, Q.

2011-01-01

Milk makes a significant contribution to the human diet through provision of macro nutrient, vitamins and minerals. The exact composition of milk varies by species to naturally or contamination. It is recognized that imbalance quantity of minerals and trace element being a serious health hazards especially for infants. Therefore, some essentials elements like K, Fe, Co and Pb (as a non essential element) have been determined in locally available milk powder of infant formulas, milk powder of growing children , processed milk or tetra pack milk of different brands and fresh milk samples (cow and buffalo) by sophisticated analytical techniques flame emissions spectroscopy (FES) and atomic absorption spectroscopy (AAS). The range of mean concentration of elements (K, Fe and Co) in milk samples was found to be 650.00-1500.00 mg/l, 2.76-8.93 mg/l and 0.05 mg/l respectively. The levels of these elements in milk powder of infant formulas (1 and 2) were compared with the standards of FAO/WHO, recommended values of the Committee on Nutrition of the American Academy of Pediatrics, human milk and cow's milk. (author)

Intrauterine, postpartum and adult relationships between arachidonic acid (AA) and docosahexaenoic acid (DHA)

NARCIS (Netherlands)

Kuipers, Remko S.; Luxwolda, Martine F.; Dijck-Brouwer, D. A. Janneke; Muskiet, Frits A. J.

Erythrocyte (RBC) fatty acid compositions from populations with stable dietary habits but large variations in RBC-arachidonic (AA) and RBC-docosahexaenoic acid (DHA) provided us with insight into relationships between DHA and AA. It also enabled us to estimate the maternal RBC-DHA (mRBC-DHA) status

AAS Publishing News: Preparing Your Manuscript Just Got Easier

Science.gov (United States)

Kohler, Susanna

2016-03-01

Watermarking using the command watermark{DRAFT, v2}.Are you an astronomer considering submitting a paper to an AAS journal (i.e., AJ, ApJ, ApJ Letters, or ApJ Supplements)? If so, this post is for you! Read on to find out about the exciting new things you can do with the AASs newest LaTeX class file, available for download now.Why the Update?AAS publishing has maintained a consistent class file for LaTeX manuscript preparation for the past decade. But academic publishing is changing rapidly in todays era of electronic journals! Since its journals went fully electronic, the AAS has been continuously adding new publishing capabilities based on the recommendations of the Journals Task Force and the needs and requests of AAS authors. The AASs manuscript preparation tools are now being updated accordingly.Whats New in AASTex 6.0?There are many exciting new features and capabilities in AASTex 6.0. Here are just a few:Tracking options for author revisions include added{text}, deleted{text}, replaced{old}{new}, and explain{text}.Based on emulateapjDo you use the popular class file emulateapj to prepare your manuscripts? AASTex 6.0 is based on emulateapj, rather than on the older AASTex 5.2 (though 5.2 is still supported). This means that it is easy to produce a double-columned, single-spaced, and astro-ph-ready manuscript. Since two thirds of the AAS journals authors use emulateapj, this transition was designed to make manuscript preparation and sharing an easier and more seamless process.Tools for collaborationsDo you work in a large collaboration? AASTex now includes new tools to make preparing a manuscript within a collaboration easier. Drafts can now be watermarked to differentiate between versions. New markup for large author lists streamlines the display so that readers can access article information immediately, yet they can still access the full author list and affiliations at the end of the paper. And author revision markup allows members of a collaboration to

Evaluation on corrosively dissolved gold induced by alkanethiol monolayer with atomic absorption spectroscopy

International Nuclear Information System (INIS)

Cao Zhong; Zhang Ling; Guo Chaoyan; Gong Fuchun; Long Shu; Tan Shuzhen; Xia Changbin; Xu Fen; Sun Lixian

2009-01-01

We have monitored a gold corrosive dissolution behavior accompanied in n-alkanethiol like n-dodecanethiol assembled process with in situ quartz crystal microbalance (QCM), and then observed it with atomic force microscopy (AFM) which showed an evident image of corrosive defects or holes produced on gold substrate, corresponding to gold dissolution induced by the alkanethiol molecules in the presence of oxygen. For detection of the dissolved gold defects during alkanethiol assembled process, an atomic absorption spectroscopy (AAS) has been carried out in this paper, and the detection limit for the dissolved gold could be evaluated to be 15.4 ng/mL. The amount of dissolved gold from the substrates of gold plates as functions of immersion time, acid media, solvents and thiol concentration has been examined in the oxygen saturated solutions. In comparison with in situ QCM method, the kinetics behavior of the long-term gold corrosion on the gold plates in 1.0 mmol/L of n-dodecanethiol solution determined with AAS method was a slow process, and its corrosion rate on gold dissolution could be evaluated to be about 4.4 x 10 -5 ng.cm -2 .s -1 , corresponding to 1.3 x 10 8 Au atoms.cm -2 .s -1 , that was much smaller than that of initial rate monitored with in situ QCM. Both kinetics equations obtained with QCM and AAS showed a consistent corrosion behavior on gold surfaces.

Overall view of AA in Bld. 193

CERN Multimedia

1980-01-01

See under 7911303, 7911597X, 8004261 and 8202324. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

The Use of a Microprocessor-Controlled, Video Output Atomic Absorption Spectrometer as an Educational Tool in a Two-Year Technical Curriculum.

Science.gov (United States)

Kerfoot, Henry B.

Based on instructional experiences at Charles County Community College, Maryland, this report examines the pedagogical advantage of teaching atomic absorption (AA) spectroscopy with an AA spectrophotometer that is equipped with a microprocessor and video output mechanism. The report first discusses the growing importance of AA spectroscopy in…

Adhesion of epoxy primer to hydrotalcite conversion coated AA2024

Science.gov (United States)

Leggat, Robert Benton, III

Hydrotalcite-based (HT) conversion coatings are being developed as an environmentally benign alternative to chromate conversion coatings (CCC). Accelerated exposure tests were conducted on epoxy primed, HT-modified AA2024 to gauge service performance. HT-based conversion coatings did not perform as well as the CCC when used with an epoxy primer. The current HT chemistries are optimized for stand-alone corrosion protection, however additional research into the primer/HT interactions is necessary before they can be implemented within a coating scheme. The relative contribution of mechanical and physico-chemical interactions in controlling adhesion has been investigated in this study. Practical adhesion tests were used to assess the dry and wet bond strength of epoxy primer on HT coatings using the pull-off tensile strength (POTS) as the figure of merit. The practical adhesion of HT coated samples generally fell between that observed for the CCC and bare AA2024. Laboratory testing was done to assess the physical and chemical properties of HT coatings. Contact angle measurements were performed using powders representative of different HT chemistries to evaluate the dispersive and acid-base character of the surface. The wet POTS correlated with the electrodynamic (dipole + dispersive) parameter of the surface tension. The HT surfaces were found to be predominantly basic. Given the basicity of epoxy, these results indicate that increasing the acidic character of HT coatings may increase the adhesion performance. This was supported by electrokinetic measurements in which the dry POTS was found to increase with decreasing conversion coating iso-electric point. The correlations with the dry and wet state adhesion are interpreted as indicating that dry state adhesion is optimized by minimizing unfavorable polar interactions between the basic epoxy and HT interfaces. Wet state adhesion, where polar interactions are disrupted, is dictated by non-polar bonding. FTIR

Gradient temperature Raman spectroscopy identifies flexible sites in proline and alanine peptides

Science.gov (United States)

Continuous thermo dynamic Raman spectroscopy (TDRS) applies the temperature gradients utilized in differential scanning calorimetry (DSC) to Raman spectroscopy, providing a straightforward technique to identify molecular rearrangements that occur just prior to phase transitions. Herein we apply TDRS...

First circulating beam in the AA

CERN Multimedia

CERN PhotoLab

1980-01-01

On 3 July 1980, two years after project authorization, beam circulated for the first time in the AA. It was a 3.5 GeV/c proton test beam. We see an expecting crowd, minutes before the happy event. The persons are to numerous to name them all. Heribert Koziol, apparently asleep, is answering the call from an impatient director. See also 8007094.

Technical feasibility study for a solar energy system at Amsterdam Airport Schiphol (AAS)

NARCIS (Netherlands)

Janssen, P.N.J.W.; Myrzik, J.M.A.; Kling, W.L.; Reinders, L.

2010-01-01

This work arises within the framework of the introduction of renewable energies at Amsterdam Airport Schiphol (AAS) and the focus is on the technical feasibility of a solar energy system (SES) on ground level. The flight safety must always be guaranteed if solar panels are implemented on AAS. The

AA-PMe, a novel asiatic acid derivative, induces apoptosis and suppresses proliferation, migration, and invasion of gastric cancer cells

Science.gov (United States)

Jing, Yue; Wang, Gang; Ge, Ying; Xu, Minjie; Tang, Shuainan; Gong, Zhunan

2016-01-01

Asiatic acid (AA; 2α,3β,23-trihydroxyurs-12-ene-28-oic acid) is widely used for medicinal purposes in many Asian countries due to its various bioactivities. A series of AA derivatives has been synthesized in attempts to improve its therapeutic potencies. Herein we investigated the anti-tumor activities of N-(2α,3β,23-acetoxyurs-12-en-28-oyl)-l-proline methyl ester (AA-PMe), a novel AA derivative. AA-PMe exhibited a stronger anti-cancer activity than its parent compound AA. AA-PMe inhibited the proliferation of SGC7901 and HGC27 human gastric cancer cells in a dose-dependent manner but had no significant toxicity in human gastric mucosa epithelial cells (GES-1). AA-PMe induced cell cycle arrest in G0/G1 phase and blocked G1-S transition, which correlated well with marked decreases in levels of cyclin D1, cyclin-dependent kinase CKD4, and phosphorylated retinoblastoma protein, and increase in cyclin-dependent kinase inhibitor P15. Further, AA-PMe induced apoptosis of human gastric cancer cells by affecting Bcl-2, Bax, c-Myc, and caspase-3. Moreover, AA-PMe suppressed the migration and invasion of human gastric cancer cells (SGC7901 and HGC27) cells by downregulating the expression of MMP-2 and MMP-9. Overall, this study investigated the potential anti-cancer activities of AA-PMe including inducing apoptosis and suppressing proliferation, migration and invasion of gastric cancer cells, as well as the underlying mechanisms, suggesting that AA-PMe is a promising anti-cancer drug candidate in gastric cancer therapy. PMID:27073325

Optimization of modified carbon paste electrode with multiwalled carbon nanotube/ionic liquid/cauliflower-like gold nanostructures for simultaneous determination of ascorbic acid, dopamine and uric acid

International Nuclear Information System (INIS)

Afraz, Ahmadreza; Rafati, Amir Abbas; Najafi, Mojgan

2014-01-01

We describe the modification of a carbon paste electrode (CPE) with multiwalled carbon nanotubes (MWCNTs) and an ionic liquid (IL). Electrochemical studies by using a D-optimal mixture design in Design-Expert software revealed an optimized composition of 60% graphite, 14.2% paraffin, 10.8% MWCNT and 15% IL. The optimal modified CPE shows good electrochemical properties that are well matched with model prediction parameters. In the next step, the optimized CPE was modified with gold nanostructures by applying a double-pulse electrochemical technique. The resulting electrode was characterized by scanning electron microscopy, energy dispersive X-ray spectroscopy, X-ray diffraction, and electrochemical impedance spectroscopy. It gives three sharp and well-separated oxidation peaks for ascorbic acid (AA), dopamine (DA), and uric acid (UA). The sensor enables simultaneous determination of AA, DA and UA with linear responses from 0.3 to 285, 0.08 to 200, and 0.1 to 450 μM, respectively, and with 120, 30 and 30 nM detection limits (at an S/N of 3). The method was successfully applied to the determination of AA, DA, and UA in spiked samples of human serum and urine. - Highlights: • New method for simultaneous determination of AA, DA and UA was developed. • MWCNT/ionic liquid/cauliflower-like Au nanostructure was used for CPE modification. • Optimization of electrode composition was done by Design-Expert software. • The pH effect, peak separation mechanism and real samples was thoroughly studied

Optimization of modified carbon paste electrode with multiwalled carbon nanotube/ionic liquid/cauliflower-like gold nanostructures for simultaneous determination of ascorbic acid, dopamine and uric acid

Energy Technology Data Exchange (ETDEWEB)

Afraz, Ahmadreza [Department of Physical Chemistry, Faculty of Chemistry, Bu-Ali Sina University, P.O. Box 65174, Hamedan (Iran, Islamic Republic of); Rafati, Amir Abbas, E-mail: aa_rafati@basu.ac.ir [Department of Physical Chemistry, Faculty of Chemistry, Bu-Ali Sina University, P.O. Box 65174, Hamedan (Iran, Islamic Republic of); Najafi, Mojgan [Department of Materials Engineering, Hamedan University of Technology (HUT), 65169 Hamedan (Iran, Islamic Republic of)

2014-11-01

We describe the modification of a carbon paste electrode (CPE) with multiwalled carbon nanotubes (MWCNTs) and an ionic liquid (IL). Electrochemical studies by using a D-optimal mixture design in Design-Expert software revealed an optimized composition of 60% graphite, 14.2% paraffin, 10.8% MWCNT and 15% IL. The optimal modified CPE shows good electrochemical properties that are well matched with model prediction parameters. In the next step, the optimized CPE was modified with gold nanostructures by applying a double-pulse electrochemical technique. The resulting electrode was characterized by scanning electron microscopy, energy dispersive X-ray spectroscopy, X-ray diffraction, and electrochemical impedance spectroscopy. It gives three sharp and well-separated oxidation peaks for ascorbic acid (AA), dopamine (DA), and uric acid (UA). The sensor enables simultaneous determination of AA, DA and UA with linear responses from 0.3 to 285, 0.08 to 200, and 0.1 to 450 μM, respectively, and with 120, 30 and 30 nM detection limits (at an S/N of 3). The method was successfully applied to the determination of AA, DA, and UA in spiked samples of human serum and urine. - Highlights: • New method for simultaneous determination of AA, DA and UA was developed. • MWCNT/ionic liquid/cauliflower-like Au nanostructure was used for CPE modification. • Optimization of electrode composition was done by Design-Expert software. • The pH effect, peak separation mechanism and real samples was thoroughly studied.

[Exposure degree of important non-target arthropods to Cry2Aa in Bt rice fields].

Science.gov (United States)

Zhang, Qing-Ling; Li, Yun-He; Hua, Hong-Xia; Yang, Chang-Ju; Wu, Hong-Jin; Peng, Yu-Fa

2013-06-01

Based on the principle of "risk = hazard x exposure", the selected representative nontarget organisms in the assessment of the potential effects of insect-resistant genetically modified (GM) crops on non-target arthropods in laboratory are generally the arthropod species highly exposed to the insecticidal proteins expressed by the GM crops in farmland ecosystem. In order to understand the exposure degree of the important arthropod species to Cry proteins in Bt rice fields, and to select the appropriate non-target arthropods in the risk assessment of insect-resistant GM crops, the enzyme-linked immunosorbent assay (ELISA) was conducted to measure the Cry2Aa protein concentration in the arthropods collected from the cry2Aa rice fields at different rice growth stages. The results showed that there was a significant difference in the Cry2Aa content protein concentration in different arthropod species. Some species did not contain Cry2Aa protein, while some species contained larger amounts of Cry2Aa protein. Relative to the arthropods colleted after rice anthesis, the arthropods colleted in rice anthesis contained relative higher concentrations of Cry2Aa protein, especially for the predacious arthropods. No Cry proteins were detected in parasitic arthropods. This study provided references for the laboratory assessment of the effects of GM rice on nontarget arthropods.

Rapid discrimination of geographical origin and evaluation of antioxidant activity of Salvia miltiorrhiza var. alba by Fourier transform near infrared spectroscopy.

Science.gov (United States)

Duan, Xiaoju; Zhang, Danlu; Nie, Lei; Zang, Hengchang

2014-03-25

Radix Salvia miltiorrhiza Bge. var. alba C.Y. Wu and H.W. Li and Radix S. miltrorrhiza belong to the same genus. S. miltiorrhiza var. alba has a unique effectiveness for thromboangiitis besides therapeutical efficay of S. miltrorrhiza. It exhibits antioxidant activity (AA), while its quality and efficacy also vary with geographic locations. Therefore, a rapid and nondestructive method based on Fourier transform near infrared spectroscopy (FT-NIRS) was developed for discrimination of geographical origin and evaluation of AA of S. miltiorrhiza var. alba. The discrimination of geographical origin was achieved by using discriminant analysis and the accuracy was 100%. Partial least squares (PLS) regression was employed to establish the model for evaluation of AA by NIRS. The spectral regions were selected by interval PLS (i-PLS) method. Different pre-treated methods were compared for the spectral pre-processing. The final optimal results of PLS model showed that correlation coefficients in the calibration set (Rc) and the prediction set (Rp), root mean square error of prediction (RMSEP) and residual prediction deviation (RPD) were 0.974, 0.950, 0.163 mg mL(-1) and 2.66, respectively. The results demonstrated that NIRs combined with chemometric methods could be a rapid and nondestructive tool to discriminate geographical origin and evaluate AA of S. miltiorrhiza var. alba. The developed NIRS method might have a potential application to high-throughput screening of a great number of raw S. miltiorrhiza var. alba samples for AA. Copyright © 2013 Elsevier B.V. All rights reserved.

Environmental samples analysis by Atomic Absorption Spectrophotometry and Inductively Coupled Plasma-Optical Emission Spectroscopy

International Nuclear Information System (INIS)

Popescu, I.V.; Iordan, M.; Stihi, C.; Bancuta, A.; Busuioc, G.; Dima, G.; Ciupina, V.; Belc, M.; Vlaicu, Gh.; Marian, R.

2002-01-01

Biological samples are interesting from many aspects of environmental monitoring. By analyzing tree leaves conclusions can be drown regarding the metal loading in the growth medium. So that, starting from assumption that the pollution factors from environmental medium can modify the normal concentration of elements, we decided to control the presence of toxic elements and the deviation from normal state of elements in leaves of different trees from areas situated at different distances of pollution source. The aim of this work is to determine the elemental composition of tree leaves using Atomic Absorption Spectrophotometry (AAS) method and Inductively Coupled Plasma-Optical Emission Spectroscopy (ICP-OES) method. Using AAS spectrophotometer SHIMADZU we identified and determined the concentration of: Cd, Co, Cu, Zn, Mn, Cr, Fe, Se, Pb with an instrumental error less than 1% for most of the elements analyzed. The same samples were analyzed by ICP-OES spectrometer, BAIRD ICP2070-Sequential Plasma spectrometer. We identified and determined in leaves of different trees the concentration of Mg, Ca, and Sr with a precision less than 6%. (authors)

Short wavelength Raman spectroscopy applied to the discrimination and characterization of three cultivars of extra virgin olive oils in different maturation stages.

Science.gov (United States)

Gouvinhas, Irene; Machado, Nelson; Carvalho, Teresa; de Almeida, José M M M; Barros, Ana I R N A

2015-01-01

Extra virgin olive oils produced from three cultivars on different maturation stages were characterized using Raman spectroscopy. Chemometric methods (principal component analysis, discriminant analysis, principal component regression and partial least squares regression) applied to Raman spectral data were utilized to evaluate and quantify the statistical differences between cultivars and their ripening process. The models for predicting the peroxide value and free acidity of olive oils showed good calibration and prediction values and presented high coefficients of determination (>0.933). Both the R(2), and the correlation equations between the measured chemical parameters, and the values predicted by each approach are presented; these comprehend both PCR and PLS, used to assess SNV normalized Raman data, as well as first and second derivative of the spectra. This study demonstrates that a combination of Raman spectroscopy with multivariate analysis methods can be useful to predict rapidly olive oil chemical characteristics during the maturation process. Copyright © 2014 Elsevier B.V. All rights reserved.

Two-colour dip spectroscopy of jet-cooled molecules

Science.gov (United States)

Ito, Mitsuo

In optical-optical double resonance spectroscopy, the resonance transition from an intermediate state to a final state can be detected by a dip of the signal (fluorescence or ion) associated with the intermediate state. This method probing the signal of the intermediate state may be called `two-colour dip spectroscopy'. Various kinds of two-colour dip spectroscopy such as two-colour fluorescence/ion dip spectroscopy, two-colour ionization dip spectroscopy employing stimulated emission, population labelling spectroscopy and mass-selected ion dip spectroscopy with dissociation were briefly described, paying special attention to their characteristics in excitation, detection and application. They were extensively and successfully applied to jet-cooled large molecules and provided us with new useful information on the energy and dynamics of excited molecules.

AR, HEA and AAS in Rural Development Projects--Benchmarking towards the Best Processes.

Science.gov (United States)

Westermarck, Harri

In most countries, agricultural research (AR), institutions of higher education in agriculture (HEA), and agricultural advisory services (AAS) function as separate agencies. So far, in most countries, AR, HEA, and AAS have not had a common vision for rural development. In Finland, domination of agricultural production in Finland has led to a lack…

Clinical implications of eicosapentaenoic acid/arachidonic acid ratio (EPA/AA) in adult patients with congenital heart disease.

Science.gov (United States)

Kanoh, Miki; Inai, Kei; Shinohara, Tokuko; Tomimatsu, Hirofumi; Nakanishi, Toshio

2017-12-01

Recent studies showed that a low ratio between the levels of eicosapentaenoic acid and those of arachidonic acid (EPA/AA) is associated with higher incidence of coronary artery disease and poor prognosis of heart failure, arrhythmia, and cardiac sudden death. However, the clinical implications of EPA/AA in adult patients with congenital heart disease remain unclear. We aimed to assess the prognostic value of EPA/AA regarding cardiac events in adult patients with congenital heart disease. We measured the serum levels of eicosapentaenoic acid and arachidonic acid in 130 adult patients (median age, 31 years) stratified into two groups according to their EPA/AA (low, ≤0.22; high, >0.22). We prospectively analyzed the association between EPA/AA and incidence of cardiac events during a mean observation period of 15 months, expressed in terms of hazard ratio (HR) with 95% confidence interval (95% CI). In the subgroup of patients with biventricular circulation (2VC) (n = 76), we analyzed the same clinical endpoints. In our study population, EPA/AA was not associated with the incidence of arrhythmic events (HR, 1.52; 95% CI, 0.82-2.85; p = 0.19), but low EPA/AA was a predictor of heart failure hospitalization (HR, 2.83; 95% CI, 1.35-6.30; p AA of ≤0.25 was associated with a significantly higher risk of arrhythmic events (HR, 2.55; 95% CI, 1.11-6.41; p = 0.03) and heart failure hospitalization (HR, 5.20; 95% CI, 1.78-18.1; p AA represents a useful predictor of cardiac events in adult patients with congenital heart disease.

A Novel Tenebrio molitor Cadherin Is a Functional Receptor for Bacillus thuringiensis Cry3Aa Toxin*

Science.gov (United States)

Fabrick, Jeff; Oppert, Cris; Lorenzen, Marcé D.; Morris, Kaley; Oppert, Brenda; Jurat-Fuentes, Juan Luis

2009-01-01

Cry toxins produced by the bacterium Bacillus thuringiensis are effective biological insecticides. Cadherin-like proteins have been reported as functional Cry1A toxin receptors in Lepidoptera. Here we present data that demonstrate that a coleopteran cadherin is a functional Cry3Aa toxin receptor. The Cry3Aa receptor cadherin was cloned from Tenebrio molitor larval midgut mRNA, and the predicted protein, TmCad1, has domain structure and a putative toxin binding region similar to those in lepidopteran cadherin B. thuringiensis receptors. A peptide containing the putative toxin binding region from TmCad1 bound specifically to Cry3Aa and promoted the formation of Cry3Aa toxin oligomers, proposed to be mediators of toxicity in lepidopterans. Injection of TmCad1-specific double-stranded RNA into T. molitor larvae resulted in knockdown of the TmCad1 transcript and conferred resistance to Cry3Aa toxicity. These data demonstrate the functional role of TmCad1 as a Cry3Aa receptor in T. molitor and reveal similarities between the mode of action of Cry toxins in Lepidoptera and Coleoptera. PMID:19416969

Experimental study on joining of AA6063 and AISI 1040 steel

Science.gov (United States)

Hynes, N. Rajesh Jesudoss; Raja, S.

2018-05-01

Feasibility of joining of dissimilar metals with different physical, chemical and thermal properties such as AA6063 alloy and AISI 1040 steel is worthwhile study, since it has tremendous applications in all most of all engineering domains. The mechanism of bonding is studied using scanning electron microscopy. Impact strength of AA2024/AISI joints, axial shortening distance, micro hardness distribution and joint strength are determined. Micro hardness profile shows increased hardness value at the joint interface, due to grain refinement.

Changing epidemiology of AA amyloidosis: clinical observations over 25 years at a single national referral centre.

Science.gov (United States)

Lane, Thirusha; Pinney, Jennifer H; Gilbertson, Janet A; Hutt, David F; Rowczenio, Dorota M; Mahmood, Shameem; Sachchithanantham, Sajitha; Fontana, Marianna; Youngstein, Taryn; Quarta, Candida C; Wechalekar, Ashutosh D; Gillmore, Julian D; Hawkins, Philip N; Lachmann, Helen J

2017-09-01

Systemic AA amyloidosis is a serious complication of chronic inflammation; however, there are relatively few published data on its incidence. We investigated the changing epidemiology of AA amyloidosis over a 25-year period at a single national referral centre. We conducted a retrospective study of all patients diagnosed with AA amyloidosis who had attended the centre between 1990 and 2014 inclusive. Six hundred and twenty-five patients were studied in three cohorts: C1: 1990-1997; C2: 1998-2006; C3: 2007-2014. Mean age at presentation increased from 46 in C1 to 56 in C3 (p AA amyloidosis over a quarter of a century, reflecting advances in therapeutics and overall management of complex chronic disease in an ageing population. AA amyloidosis of uncertain aetiology presents an emerging major problem. Newer techniques such as next-generation sequencing may aid diagnosis and effective treatment, thereby improving overall survival.

Study of processes of interligand exchange between Cu(AA)2 and Y(DPM)3 in geseous phase

International Nuclear Information System (INIS)

Girichev, G.V.; Giricheva, N.I.; Belova, N.V.; Kuz'mina, N.P.; Kaul', A.R.; Gorbenko, O.Yu.

1993-01-01

Mass-spectrometric method was used to study the process, proceeding between gaseous copper acetylacetonate and yttrium dipivaloylmethanate in 150-630 deg C range. It was established that intensive ligand exchange with formation of Cu(DPM) (AA), Y(DPM) 2 (AA), Cu(DPM) 2 compounds in gaseous mixture took place between components. Thermal decomposition of copper and yttrium β-diketonates was observed with temperature growth, along with reactions of interligand exchange. Molecular forms of Y(DPM) 2 , Y(DPM)(AA), Cu(DPM) 2 and Cu(DPM)(AA) were the most thermally stable at that

Influence of titanium–boron additions on grain refinement of AA6082 gas tungsten arc welds

International Nuclear Information System (INIS)

Kishore Babu, N.; Talari, Mahesh Kumar; Dayou, Pan; Zheng, Sun; Jun, Wei; SivaPrasad, K.

2012-01-01

Highlights: ► Ti in the weld metal resulted in grain refinement due to growth restriction effect. ► Weld metal strength improved due to grain refinement caused by Tibor™ addition. ► Weld metal responded to post-weld ageing treatment due to dilution from base metal. ► Weld metal with AA5356 filler are stronger then AA4043 for all Tibor™ additions. -- Abstract: Grain refinement of weld metal plays a vital role in improving mechanical properties (ductility and toughness) as well as weldability. The present study has investigated the influence of Tibor™ additions on the structure and mechanical properties of AA6082 gas tungsten arc (GTA) weldments. Controlled amounts of Tibor™ grain refiner (containing Ti and B in a ratio of 5:1) were introduced into the molten pool of AA6082 by pre-deposited cast inserts (AA4043 and AA5356) under different welding conditions by GTA welding. Full penetration GTA welds were prepared using alternating current (AC). It was observed that grain size was decreased with increasing amounts of Tibor™. The grain refinement is mainly caused grain nucleation associated with constitutional undercooling during solidification. It has been shown that welds prepared with 5356 cast insert exhibited high strength and ductility when compared with other welds. The observed grain refinement was shown to result in an appreciable increase in fusion zone hardness, strength and ductility.

Study of clusters using negative ion photodetachment spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Zhao, Yuexing [Univ. of California, Berkeley, CA (United States)

1995-12-01

The weak van der Waals interaction between an open-shell halogen atom and a closed-shell atom or molecule has been investigated using zero electron kinetic energy (ZEKE) spectroscopy. This technique is also applied to study the low-lying electronic states in GaAs and GaAs^-. In addition, the spectroscopy and electron detachment dynamics of several small carbon cluster anions are studied using resonant multiphoton detachment spectroscopy.

Study of clusters using negative ion photodetachment spectroscopy

International Nuclear Information System (INIS)

Zhao, Yuexing.

1995-12-01

The weak van der Waals interaction between an open-shell halogen atom and a closed-shell atom or molecule has been investigated using zero electron kinetic energy (ZEKE) spectroscopy. This technique is also applied to study the low-lying electronic states in GaAs and GaAs - . In addition, the spectroscopy and electron detachment dynamics of several small carbon cluster anions are studied using resonant multiphoton detachment spectroscopy

Cold Antihydrogen for Precise Laser Spectroscopy

CERN Multimedia

Gabrielse, G S; Walz, J; Hessels, E A; Tan, J; Oelert, W; George, M C; Grzonka, D J; Kossick, M; Storry, C H; Sefzick, T

2002-01-01

%AD-2 %title\\\\ \\\\The Antihydrogen TRAP Collaboration (ATRAP) seeks to do precise laser spectroscopy of antihydrogen. Comparisons of antihydrogen and hydrogen atoms should provide the most stringent test of CPT invariance involving baryons and leptons. ATRAP is an expansion of the TRAP collaboration that developed the techniques to take CERN antiprotons from an energy of 6 MeV (momentum 100 MeV/c) all the way down to thermal equilibrium at 4 K for storage. This storage energy is lower than realized previously by more than ten orders of magnitude. The TRAP techniques include slowing, capturing, electron cooling and stacking of antiprotons. ATRAP and other collaborations will use antiprotons from the Antiproton Decelerator (AD). This new facility makes sense for such experiments because we showed that antiprotons can be accumulated in a trap at much lower expense than was required in the earlier CERN AC-AA-LEAR complex. In the closest approach yet to the production of cold antihydrogen, collaboration members wer...

Renal AA amyloidosis in a patient with hereditary complete complement C4 deficiency

Directory of Open Access Journals (Sweden)

Imed Helal

2011-01-01

Full Text Available Hereditary complete C4 deficiency has until now been reported in 30 cases only. A disturbed clearance of immune- complexes probably predisposes these individuals to systemic lupus erythematosus, other immune- complex diseases and recurrent microbial infections. We present here a 20- year- old female with hereditary complete C4 deficiency. Renal biopsy demonstrated renal AA amyloidosis. This unique case further substantiates that deficiency of classical pathway components predisposes to the development of recurrent microbial infections and that the patients may develop AA amyloidosis. Furthermore, in clinical practice, the nephrotic syndrome occurring in a patient with hereditary complete complement C4 deficiency should lead to the suspicion of renal AA amyloidosis.

The use of atomic spectroscopy in the pharmaceutical industry for the determination of trace elements in pharmaceuticals.

Science.gov (United States)

Lewen, Nancy

2011-06-25

The subject of the analysis of various elements, including metals and metalloids, in the pharmaceutical industry has seen increasing importance in the last 10-15 years, as modern analytical instrumentation has afforded analysts with the opportunity to provide element-specific, accurate and meaningful information related to pharmaceutical products. Armed with toxicological data, compendial and regulatory agencies have revisited traditional approaches to the testing of pharmaceuticals for metals and metalloids, and analysts have begun to employ the techniques of atomic spectroscopy, such as flame- and graphite furnace atomic absorption spectroscopy (FAAS, Flame AA or FAA and GFAAS), inductively coupled plasma-atomic emission spectroscopy (ICP-AES) and inductively coupled plasma-mass spectrometry (ICP-MS), to meet their analytical needs. Newer techniques, such as laser-induced breakdown spectroscopy (LIBS) and Laser Ablation ICP-MS (LAICP-MS) are also beginning to see wider applications in the analysis of elements in the pharmaceutical industry.This article will provide a perspective regarding the various applications of atomic spectroscopy in the analysis of metals and metalloids in drug products, active pharmaceutical ingredients (API's), raw materials and intermediates. The application of atomic spectroscopy in the analysis of metals and metalloids in clinical samples, nutraceutical, metabolism and pharmacokinetic samples will not be addressed in this work. Copyright © 2010 Elsevier B.V. All rights reserved.

Therapeutic Benefits of Tocilizumab Vary in Different Organs of a Patient with AA Amyloidosis

Directory of Open Access Journals (Sweden)

Masaru Matsui

2014-01-01

Full Text Available Systemic reactive AA amyloidosis is a life-threatening complication of chronic inflammatory diseases. Anti-interleukin-6 receptor, tocilizumab (TCZ, has been shown to improve clinical symptoms of patients with AA amyloidosis, accompanied with regression of the amyloid deposition. We report a case of AA amyloidosis evaluated by histology of multiple organs before and after TCZ treatment. A woman in her 60s with rheumatoid arthritis was referred to our hospital because of cardiac and renal dysfunction. A gastric and renal biopsy revealed the deposition of AA amyloid, and echocardiography revealed concentric left ventricular hypertrophy. Her estimated glomerular filtration rate was decreased to 8.6 mL/min/1.73 m2, and B-type natriuretic peptide, C-reactive protein, and serum amyloid A protein were significantly elevated. TCZ treatments markedly decreased her serum amyloid A protein and C-reactive protein levels, but hemodialysis was required 1 year later. Endoscopic gastric rebiopsy 3 years after initiation of TCZ treatments revealed the regression of amyloid deposition and echocardiography revealed improvement of her left ventricular hypertrophy. However, a renal rebiopsy revealed that the amyloid deposition had not regressed. In conclusion, these observations suggest that the therapeutic effects of TCZ can vary among organs in patients with AA amyloidosis.

Storage Stability Improvement of Copolymer Grafted Polypropylene-AcrylicAcid (PP-AA), by means of Various After Treatment Processes

International Nuclear Information System (INIS)

Gitopadmojo, Isminingsih

2000-01-01

Polypropylene yams that have been subjected to irradiation induced graftco-polymerization with acrylic acid, have gained its moisture regain and dyeability, that fulfilled the requirement as textile material for garment.However, the copolymer grafted PP-AA has suffered from degradation in thestorage, which was indicated in the previous study that the strengthretention has dropped tremendously by photo-oxidation or photo-degradation.After treatments of PP-AA yams with chemical compound that was able toprevent further photo-oxidation, will be expected to improve the stability ofPP-AA in storage. In this research activity, the polypropylene (PP) yams weresubjected to irradiation induced graft co-polymerization by means ofγ-Ray Co-60 as irradiation source with acrylic acid (AA) as monomer.Various after treatments were subjected to the grafted PP-AA yams such asalkalisation process; dyeing (anionic dyes, cationic dyes and nonionic dyes);as well as processing with optical brightening agent and UV stabilizer,separately. The PP-AA yams (before and after treatment) were subjected tostorage from 1 month up to 42 months, and then being tested for theirmoisture regain, strength retention and elongation at breaks. The samplesbeing stored for 12 months were subjected to radical analysis. It isconcluded from the experiment that after treatment of grafted PP-AA by meansof those various processes were able to improve the stability of copolymergrafted PP-AA in storage. The presence of peroxide radical in the ESR(electron spin resonance) spectrum on PP-AA yams before treatment and theones after treated with alkaline and being stored for 12 months haveindicated the presence of photo oxidation or photo degradation, while thepresence of poly enyl radical in the ESR spectrum of after treated PP-AA withdyes having azo and azine compound as chromophore, as well as with UVstabilizer with carbonyl as chromophore and being stored for 12 months haveproved that its presence have protected such

AA, closed orbit observation pickup

CERN Multimedia

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. See also 8001372, 8010042, 8010045

Avaliação agronômica em híbridos diplóides (AA de bananeira Agronomical evaluation of (AA banana diploid hybrids

Directory of Open Access Journals (Sweden)

Lauro Saraiva Lessa

2009-01-01

Full Text Available Objetivou-se avaliar características agronômicas em híbridos diplóides (AA de bananeira. No experimento, conduzido no campo experimental da Embrapa Mandioca e Fruticultura Tropical, em blocos casualizados com quatro repetições, foram avaliados 11 híbridos diplóides (AA de bananeira (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 e SH3263. Os dados dos caracteres agronômicos avaliados foram submetidos à análise de variância e as médias dos genótipos foram agrupadas pelo teste de Scott-Knott, a 5% de probabilidade. O genótipo SH3263 apresentou valores favoráveis ao melhoramento para número de pencas e de frutos por cacho e baixa incidência de Sigatoka-amarela na floração, além de menor número de dias da floração à colheita, maior peso da segunda penca e comprimento de fruto acima de 10 cm. O híbrido 0323-03 apresentou a maior retenção de folhas vivas na colheita do cacho e, também, a menor nota para incidência de sigatoka-amarela na colheita. A alta variabilidade encontrada com a avaliação dos híbridos permite a seleção de diplóides (AA com potencial para utilização em programas de melhoramento da cultura.The aim of the present work was to characterize horticultural characteristics in (AA banana diploid hybrids. The experiment was carried out at the experimental field of Embrapa Cassava and Tropical Fruits in randomized blocks with four replicates and 11 (AA banana diploid hybrids were evaluated: (4279-06, TH03-01, 8987-01, 0323-03, 1318-01, 0116-01, 8694-20, 1304-06, 9179-03, 4223-06 and SH3263. Data of the agronomical characteristics evaluated were submitted to the analysis of variance and the averages of the genotypes grouped by the Scott-Knott test at 5% of probability. The SH3263 genotype presented favorable values to the breeding for number of hands per bunch, number of fruits per bunch, low yellow-sigatoka incidence during flowering and also lower number of days

The association between Interleukin (IL)-4 gene intron 3 VNTR polymorphism and alopecia areata (AA) in Turkish population.

Science.gov (United States)

Kalkan, Göknur; Karakus, Nevin; Baş, Yalçın; Takçı, Zennure; Ozuğuz, Pınar; Ateş, Omer; Yigit, Serbulent

2013-09-25

Alopecia areata (AA) is hypothesized to be an organ-specific autoimmune disease of hair follicles mediated by T cells. As immunological and genetic factors have been implicated in the pathogenesis of AA, the purpose of the present study was to investigate possible associations between the functional Interleukin (IL)-4 gene intron 3 VNTR polymorphism and AA susceptibility and disease progression in Turkish population. The study group consisted of 116 unrelated patients with AA and 125 unrelated healthy controls. Genomic DNA was isolated and IL-4 gene 70 bp VNTR polymorphism determined by using polymerase chain reaction (PCR) with specific primers. No association was observed between AA patients and controls according to genotype distribution (p=0.051). The allele distribution of IL-4 gene intron 3 VNTR polymorphism was statistically different between AA patients and control group (p=0.026). The frequency of P1 allele in patients was significantly higher than that in the control group. When the P2P2 genotype was compared with P1P2+P1P1 genotypes, a statistically significant difference was observed between patients and controls (p=0.036). Intron 3 VNTR polymorphism in the IL-4 gene was found to be associated with AA susceptibility in Turkish population. The results suggest that IL-4 VNTR polymorphism in the intron 3 region may be a risk factor for the development of AA among Turkish population. This is the first to report that intron 3 VNTR polymorphism in the IL-4 gene is associated with AA susceptibility. © 2013.

Mechanical properties of aluminium–copper–lithium alloy AA2195 at cryogenic temperatures

International Nuclear Information System (INIS)

Nayan, Niraj; Narayana Murty, S.V.S.; Jha, Abhay K.; Pant, Bhanu; Sharma, S.C.; George, Koshy M.; Sastry, G.V.S.

2014-01-01

Highlights: • 4 mm thick sheet of AA2195 was imparted T87 temper. • 7% cold work to impart T87 was given by combination of cold rolling and stretching. • Mechanical properties were evaluated at RT and cryogenic temperatures. • Strength of AA2195 are superior to the conventional aluminum alloy 2219 at all temperatures. • Strength decreases with decrease in temperature whereas ductility remains unchanged. - Abstract: Tensile testing was performed on a 4 mm thick sheet of the aluminum–lithium alloy AA2195 in T87 (solution treatment + water quenching + 7% cold work + peak aging) temper which was subjected to 7% cold working by combination of cold rolling and stretching, over a temperature range from ambient to liquid hydrogen (20 K) conditions. Properties were evaluated in longitudinal as well as transverse directions to characterize anisotropy with respect to strength and ductility. Strength and ductility were compared to the conventional aluminum alloy AA2219-T87, developed for similar cryogenic applications. Decreases in test temperature led to higher strengths with little or no change in ductility. As the temperature decreases, the differences between ultimate tensile strength as well as yield strength for two different combinations of cold roll and stretch studied in the present work, narrows down and become equal at 20 K

Profile of renal AA amyloidosis in older and younger individuals: a single-centre experience.

Science.gov (United States)

Erdogmus, Siyar; Kendi Celebi, Zeynep; Akturk, Serkan; Kumru, Gizem; Duman, Neval; Ates, Kenan; Erturk, Sehsuvar; Nergizoglu, Gokhan; Kutlay, Sim; Sengul, Sule; Keven, Kenan

2018-05-18

In epidemiological studies of amyloid A (AA) amyloidosis from Turkey, the most frequently cause was familial Mediterranean fever (FMF) and it occurs generally in young age population. However, there are no sufficient data regarding aetiology, clinical presentation and prognosis of renal AA amyloidosis in advanced age patients. In this study, we aimed to investigate demographic, clinical presentation, aetiology and outcomes of adults aged 60 years or older patients with biopsy-proven renal AA amyloidosis. This is a retrospective study involving 53 patients who were diagnosed with AA amyloidosis by kidney biopsy from 2006 to 2016. In all patients, kidney biopsies were performed due to asymptomatic proteinuria, nephrotic syndrome and/or renal insufficiency. The patients were separated into two groups on the basis of age (group I: ≥60 years and group II: AA amyloidosis were as follows: FMF 16 (50%), bronchiectasis 7 (23%), chronic osteomyelitis 2 (6%), inflammatory bowel disease 2 (6%), rheumatoid arthritis 2 (6%), ankylosing spondylitis 1 (3%) and unknown aetiology 2 (6%). The underlying disorders of AA amyloidosis in group II patients were as follows: FMF 17 (81%), Behcet's disease 1 (5%) and unknown aetiology 3 (14%). No statistically significant differences were detected between two groups with regard to systolic and diastolic blood pressures, albumin, proteinuria and lipids. The combination of chronic kidney disease and nephrotic syndrome was the most common clinical presentation in group I (73%) and group II (43%) (p = .05). Compared to the group II, estimated glomerular filtration rate was significantly lower in group I at the time of kidney biopsy (p = .003). At 12-month follow-up, 61% of the group I and 33% of the group II developed end-stage kidney disease requiring dialysis, while 11% of the group I died. Our results indicated that renal AA amyloidosis is a rare disease in advanced age patients. At baseline and follow-up period, advanced age

Investigation of Microstructure and Microhardness in Self-Reacting Friction Stir Welded AA2014-T6 and AA2219-T87

Science.gov (United States)

Horton, K. Renee; McGill, Preston; Barkey, Mark

2011-01-01

Friction stir welding (FSW) is a solid state welding process with potential advantages for aerospace and automotive industries dealing with light alloys. Self-reacting friction stir welding (SR-FSW) is one variation of the FSW process being developed at the National Aeronautics and Space Administration (NASA) for use in the fabrication of propellant tanks. This work reports on the microstructure and microhardness of SR-FSW between two dissimilar aluminum alloys. Specifically, the study examines the cross section of the weld joint formed between an AA2014-T6 plate on the advancing side and an AA2219-T87 plate on the retreating side. The microstructural analysis shows an irregularly displaced weld seam from the advancing side past the thermo-mechanical affected zone (TMAZ) into the weld nugget region. There are sharp variations in the microhardness across the weld. These variations are described in the paper and mechanisms for their formation are discussed.

Churg-Strauss syndrome associated with AA amyloidosis: a case report.

Science.gov (United States)

Maamar, Mouna; Tazi-Mezalek, Zoubida; Harmouche, Hicham; El Hamany, Zitouna; Adnaoui, Mohammed; Aouni, Mohammed

2012-01-01

Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/µL), positive p-ANCA, microscopic haematuria and proteinuria at 2g/day. A diagnosis of Churg-Strauss syndrome was established based on five criteria of the American College of Rheumatology (ACR). Renal biopsy showed an important type AA amyloid deposit. The patient was treated with steroids with a good response of the vasculitis and amyloidosis with disappearance of the proteinuria.

Scorpion neurotoxin AaIT-expressing Beauveria bassiana enhances the virulence against Aedes albopictus mosquitoes.

Science.gov (United States)

Deng, Sheng-Qun; Cai, Qun-Di; Deng, Ming-Zhi; Huang, Qiang; Peng, Hong-Juan

2017-12-01

To improve the insecticidal efficacy of this entomopathogen Beauveria bassiana, the fungus was genetically modified to express an insect-specific scorpion neurotoxin AaIT. The virulence of the recombinant B. bassiana strain (Bb-AaIT) against Aedes albopictus adults (which occurs via penetration through the cuticle during spore germination or by conidia ingestion), and the larvae (by conidia ingestion) was measured with bioassays. The median lethal concentration (LC 50 ) of Bb-AaIT against A. albopictus larvae was 313.3-fold lower on day 4 and 11.3-fold lower on day 10 than that of the wild type (WT). Through conidia feeding or body contact, Bb-AaIT killed 50% of adult female mosquitoes at 3.9- or 1.9-fold reduced concentrations on day 4 and at 2.1- or 2.4-fold reduced concentrations on day 10. Compared with the results for the WT, the median lethal time (LT 50 ) of Bb-AaIT was reduced by 28.6% at 1 × 10 7 conidia ml -1 and 34.3% at 1 × 10 6 conidia ml -1 in the larvae bioassay by conidia ingestion, while it decreased 32.3% at 1 × 10 7 conidia ml -1 by conidia ingestion and 24.2% at 1 × 10 8 conidia ml -1 by penetrating through the cuticle in the adult bioassay. All the differences were significant. Our findings indicated that Bb-AaIT had higher virulence and faster action than the WT in killing the larval and adult mosquitoes, and therefore, it is valuable for development as a commercial mosquito pesticide.

Distinguishing diffuse alopecia areata (AA) from pattern hair loss (PHL) using CD3(+) T cells.

Science.gov (United States)

Kolivras, Athanassios; Thompson, Curtis

2016-05-01

Distinguishing between diffuse subacute alopecia areata (AA), in which the peribulbar infiltrate is absent, and pattern hair loss is challenging, particularly in cases that lack marked follicular miniaturization and a marked catagen/telogen shift. We sought to distinguish diffuse AA from pattern hair loss using CD3(+) T lymphocytes. A total of 28 cases of subacute AA and 31 cases of pattern hair loss were selected and a 4-mm punch biopsy was performed. All the specimens were processed using the "HoVert" (horizontal and vertical) technique. In all cases, hematoxylin-eosin and immunohistochemical stains for CD3, CD4, CD8, and CD20 were performed. The presence of CD3(+) lymphocytes within empty follicular fibrous tracts (stela), even without a concomitant peribulbar infiltrate, is a reliable histopathological clue in supporting a diagnosis of AA (sensitivity 0.964, specificity 1, P ≤ .001). Limited tissue for analysis remained in the clinical sample tissue blocks. The presence of CD3(+) T-cells within empty follicular fibrous tracts (stela) supports a diagnosis of AA. Copyright © 2015 American Academy of Dermatology, Inc. Published by Elsevier Inc. All rights reserved.

Air Pollution Studies in Central Russia (Tula Region) Using Moss Biomonitoring Technique, NAA and AAS

CERN Document Server

Ermakova, E V; Steinnes, E

2002-01-01

For the first time the moss biomonitoring technique has been applied to air pollution monitoring in Central Russia (Tula Region). Moss samples were collected from 83 sites in accordance with the sampling strategy of European projects on biomonitoring of atmospheric deposition. Neutron activation analysis (NAA) at the IBR-2 reactor has made it possible to determine the concentration of 33 elements (Na, Mg, Al, Cl, K, Ca, Sc, V, Cr, Mn, Fe, Co, Ni, Zn, As, Br, Rb, Sr, Mo, Sb, I, Cs, Ba, La, Ce, Sm, Tb, Yb, Hf, Ta, W, Th, U) over a large concentration range (from 10000 mg/kg for K to 0.001 mg/kg for Tb and Ta). In addition to NAA, flame AAS (atomic absorption spectrometry) was applied to determine the concentration of Cd, Cu and Pb. Factor analysis was applied to determine possible sources of elements detected in the investigated mosses. Eight factors were identified. The geographical distribution of factor scores is presented. The interpretation of the factor analysis findings points to natural as well as anthr...

Near infrared spectroscopy of human muscles

Science.gov (United States)

Gasbarrone, R.; Currà, A.; Cardillo, A.; Bonifazi, G.; Serranti, S.

2018-02-01

Optical spectroscopy is a powerful tool in research and industrial applications. Its properties of being rapid, non-invasive and not destructive make it a promising technique for qualitative as well as quantitative analysis in medicine. Recent advances in materials and fabrication techniques provided portable, performant, sensing spectrometers readily operated by user-friendly cabled or wireless systems. We used such a system to test whether infrared spectroscopy techniques, currently utilized in many areas as primary/secondary raw materials sector, cultural heritage, agricultural/food industry, environmental remote and proximal sensing, pharmaceutical industry, etc., could be applied in living humans to categorize muscles. We acquired muscles infrared spectra in the Vis-SWIR regions (350-2500 nm), utilizing an ASD FieldSpec 4 Standard-Res Spectroradiometer with a spectral sampling capability of 1.4 nm at 350-1000 nm and 1.1 nm at 1001-2500 nm. After a preliminary spectra pre-processing (i.e. signal scattering reduction), Principal Component Analysis (PCA) was applied to identify similar spectral features presence and to realize their further grouping. Partial Least-Squares Discriminant Analysis (PLS-DA) was utilized to implement discrimination/prediction models. We studied 22 healthy subjects (age 25-89 years, 11 females), by acquiring Vis-SWIR spectra from the upper limb muscles (i.e. biceps, a forearm flexor, and triceps, a forearm extensor). Spectroscopy was performed in fixed limb postures (elbow angle approximately 90‡). We found that optical spectroscopy can be applied to study human tissues in vivo. Vis-SWIR spectra acquired from the arm detect muscles, distinguish flexors from extensors.

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles QFW, at maximum dispersion. See also 8001372, 8001383, 8010045

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The wide ones (very wide indeed: 70 cm), like the one we see here, were placed inside the vacuum chamber of the wide quadrupoles, QFW, at maximum dispersion. See also 8001372,8001383, 8010042

AA, closed orbit observation pickup

CERN Multimedia

CERN PhotoLab

1980-01-01

Electrostatic pickups around the circumference of the AA served for the measurement of the closed orbits across the wide momentum range of +- 3% to either side of central orbit. The pickups were of the "shoebox" type, with diagonal cuts, a horizontal and a vertical one mechanically coupled together. They were located where they would not require extra space. The small ones, like the one we see here, were inserted into the vacuum chamber of the BLG (long and narrow) bending magnets. Werner Sax contemplates his achievement. See also 8001383, 8010042, 8010045.

Laser spectroscopy used in nuclear physics; La spectroscopie laser appliquee a la physique nucleaire

Energy Technology Data Exchange (ETDEWEB)

Le Blanc, F

2001-04-05

The study of nuclear shapes is a basic topic since it constitutes an excellent ground for testing and validating nuclear models. Measurements of the electron quadrupolar moment, of the nuclear charge radius and of the magnetic dipolar moment shed light on the nuclear deformation. Laser spectroscopy is a specific tool for such measurements, it is based on the interaction of the nucleus with the surrounding electron cloud (hyperfine structure), it is then an external approach of the shape of the nucleus whereas the classical nuclear spectroscopy ({alpha}, {beta} or {gamma}) gives information on the deformation from the inside of the nucleus. The author describes 2 techniques of laser spectroscopy: the colinear spectroscopy directly applied to a beam issued from an isotope separator and the resonant ionization spectroscopy linked with atom desorption that allows the study of particular nuclei. In order to illustrate both methods some effective measurements are presented: - the colinear spectroscopy has allowed the achievement of the complete description of the isomeric state (T = 31 years) of hafnium-178; - The experiment Complis has revealed an unexpected even-odd zigzag effect on very neutron-deficient platinum isotopes; and - the comparison of 2 isotopes of gold and platinum with their isomers has shown that the inversion of 2 levels of neutron, that was found out by nuclear spectroscopy, is in fact a consequence of a change in the nuclear shape. (A.C.)

Laser-induced breakdown spectroscopy applied to the characterization of rock by support vector machine combined with principal component analysis

International Nuclear Information System (INIS)

Yang Hong-Xing; Fu Hong-Bo; Wang Hua-Dong; Jia Jun-Wei; Dong Feng-Zhong; Sigrist, Markus W

2016-01-01

Laser-induced breakdown spectroscopy (LIBS) is a versatile tool for both qualitative and quantitative analysis. In this paper, LIBS combined with principal component analysis (PCA) and support vector machine (SVM) is applied to rock analysis. Fourteen emission lines including Fe, Mg, Ca, Al, Si, and Ti are selected as analysis lines. A good accuracy (91.38% for the real rock) is achieved by using SVM to analyze the spectroscopic peak area data which are processed by PCA. It can not only reduce the noise and dimensionality which contributes to improving the efficiency of the program, but also solve the problem of linear inseparability by combining PCA and SVM. By this method, the ability of LIBS to classify rock is validated. (paper)

AA, assembly of wide bending magnet

CERN Multimedia

CERN PhotoLab

1980-01-01

The very particular lattice of the AA required 2 types of dipoles (bending magnets; BST, short and wide; BLG, long and narrow). The wide ones had a steel length of 2.71 m, a "good field" width of 0.564 m, and a weight of about 75 t. Here we see the copper coils being hoisted onto the lower half of a BST. See also 7811105, 8006050. For a BLG, see 8001044.

Effect of pin tool design on the material flow of dissimilar AA7075-AA6061 friction stir welds

Science.gov (United States)

Hasan, Mohammed M.; Ishak, M.; Rejab, M. R. M.

2017-10-01

Tool design is the most influential aspect in the friction stir welding (FSW) technology. Influence of pin tool geometry on material flow pattern are studied in this work during the FSW of dissimilar AA7075 and AA6061 aluminium alloys. Three truncated pin tool profiles (threaded, threaded with single flat, and unthreaded with single flat) were used to prepare the weldments. The workpieces were joined using a custom-made clamping system under 1100 rpm of spindle speed, 300 mm/min of traverse rate and 3° of tilt angle. The metallographic analysis showed that defect-free welds can be produced using the three pin tools with significant changes in the mixing stir zone structure. The results declared that the introducing of the flat on the cone of the probe deviates the pattern of the onion rings without changing the chemical composition of the created layers. This in turn improves the hardness distribution and tensile strength of the welded joint. It was also noted that both heat affected zone (HAZ) and thermal-mechanical affected zone (TMAZ) are similar in composition to their corresponding base materials (BM).

Effective corrosion protection of AA6061 aluminum alloy by sputtered Al-Ce coatings

International Nuclear Information System (INIS)

Dominguez-Crespo, M.A.; Torres-Huerta, A.M.; Rodil, S.E.; Ramirez-Meneses, E.; Suarez-Velazquez, G.G.; Hernandez-Perez, M.A.

2009-01-01

Al-Ce coatings were deposited on silicon and AA6061 aluminum alloy substrates by DC magnetron sputtering using aluminum in combination with pure cerium targets. The materials were characterized by X-ray diffraction (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM), high resolution transmission electron microscopy (HRTEM) and electrochemical impedance spectroscopy (EIS) in order to consider their application as high corrosion resistance coatings. The corrosion behavior of the films was studied using a NaCl aqueous solution (3.5 wt%). As for the characterization results, an apparent amorphous phase of aluminum oxide with small cerium compounds embedded in the matrix was detected by the X-ray diffraction patterns and HRTEM on the deposited films at 200 W and 4 Pa. At these conditions, AFM and SEM images evidenced crack-free coatings with low-roughness nanometric structures and columnar growth. EIS and Tafel results converged to indicate an inhibition of the corrosion reactions. The film displayed good stability in the aggressive medium and after 1 day of exposure underwent very little degradation. The variations in the impedance and Tafel characteristics were found to occur as a function of cerium content, which provokes important changes in the film protective properties.

Effective corrosion protection of AA6061 aluminum alloy by sputtered Al-Ce coatings

Energy Technology Data Exchange (ETDEWEB)

Dominguez-Crespo, M.A., E-mail: mdominguezc@ipn.m [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Torres-Huerta, A.M. [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Rodil, S.E. [Instituto de Investigacion en Materiales, Universidad Nacional Autonoma de Mexico, Circuito Exterior s/n, Ciudad Universitaria, Del. Coyoacan, C.P. 04510 Mexico, D.F. (Mexico); Ramirez-Meneses, E. [Instituto Politecnico Nacional, GIPMAT CICATA-Altamira, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Suarez-Velazquez, G.G. [Alumna del PTA del CICATA-Altamira IPN, km 14.5, Carretera Tampico-Puerto Industrial Altamira, C.P. 89600 Altamira, Tamps (Mexico); Hernandez-Perez, M.A. [Instituto Politecnico Nacional, ESIQIE, C.P. 07738 Mexico, D.F. (Mexico)

2009-12-30

Al-Ce coatings were deposited on silicon and AA6061 aluminum alloy substrates by DC magnetron sputtering using aluminum in combination with pure cerium targets. The materials were characterized by X-ray diffraction (XRD), atomic force microscopy (AFM), scanning electron microscopy (SEM), high resolution transmission electron microscopy (HRTEM) and electrochemical impedance spectroscopy (EIS) in order to consider their application as high corrosion resistance coatings. The corrosion behavior of the films was studied using a NaCl aqueous solution (3.5 wt%). As for the characterization results, an apparent amorphous phase of aluminum oxide with small cerium compounds embedded in the matrix was detected by the X-ray diffraction patterns and HRTEM on the deposited films at 200 W and 4 Pa. At these conditions, AFM and SEM images evidenced crack-free coatings with low-roughness nanometric structures and columnar growth. EIS and Tafel results converged to indicate an inhibition of the corrosion reactions. The film displayed good stability in the aggressive medium and after 1 day of exposure underwent very little degradation. The variations in the impedance and Tafel characteristics were found to occur as a function of cerium content, which provokes important changes in the film protective properties.

NCBI nr-aa BLAST: CBRC-DYAK-08-0043 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DYAK-08-0043 ref|YP_026048.1| NADH dehydrogenase subunit 4 [Speleonectes tulum...ensis] gb|AAS00889.1| NADH dehydrogenase subunit 4 [Speleonectes tulumensis] YP_026048.1 0.41 37% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-2150 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2150 ref|YP_073317.1| NADH dehydrogenase subunit 6 [Neomaskellia andro...pogonis] gb|AAS75443.1| NADH dehydrogenase subunit 6 [Neomaskellia andropogonis] YP_073317.1 0.86 27% ...

NCBI nr-aa BLAST: CBRC-BTAU-01-1417 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-BTAU-01-1417 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 0.025 25% ...

NCBI nr-aa BLAST: CBRC-ETEL-01-1447 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ETEL-01-1447 ref|YP_026033.1| NADH dehydrogenase subunit 3 [Hutchinsoniella ma...cracantha] gb|AAS00874.1| NADH dehydrogenase subunit 3 [Hutchinsoniella macracantha] YP_026033.1 0.92 36% ...

Impact of as-cast structure on structure and properties of twin-roll cast AA8006 alloy

Energy Technology Data Exchange (ETDEWEB)

Slamova, M.; Ocenasek, V. [Vyzkumny Ustav Kovu, Panenske Brezany (Czechoslovakia); Juricek, Z.

2000-07-01

Sheet production by twin-roll casting (TRC) process is a well established practice in the aluminium industry because it offers several advantages in comparison with DC casting and hot rolling, esp. lower production and investment costs. Thin strips exhibiting a combination of good strength and high ductility are required for various applications and for this reason alloys with higher Fe and Mn content such as AA 8006 displace AA 1xxx or AA 8011 alloys. However, TRC of AA 8006 strips involves several problems, e.g. casting conditions and subsequent treatment procedures need fine tuning. The results of an investigation of the effect of casting conditions on structure and properties of AA 8006 strips are presented. The influence of casting speed, grain refiner addition, molten metal level in the tundish, tip setback and roll separating force was investigated. The impact of imperfect as-cast structure on structure and properties of thin strips in H22 and O tempers was evaluated and compared with strips from good as-cast material. (orig.)

Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

Science.gov (United States)

Oppert, Brenda; Dowd, Scot E; Bouffard, Pascal; Li, Lewyn; Conesa, Ana; Lorenzen, Marcé D; Toutges, Michelle; Marshall, Jeremy; Huestis, Diana L; Fabrick, Jeff; Oppert, Cris; Jurat-Fuentes, Juan Luis

2012-01-01

Bacillus thuringiensis (Bt) crystal (Cry) proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence dataset for T. molitor

Transcriptome profiling of the intoxication response of Tenebrio molitor larvae to Bacillus thuringiensis Cry3Aa protoxin.

Directory of Open Access Journals (Sweden)

Brenda Oppert

Full Text Available Bacillus thuringiensis (Bt crystal (Cry proteins are effective against a select number of insect pests, but improvements are needed to increase efficacy and decrease time to mortality for coleopteran pests. To gain insight into the Bt intoxication process in Coleoptera, we performed RNA-Seq on cDNA generated from the guts of Tenebrio molitor larvae that consumed either a control diet or a diet containing Cry3Aa protoxin. Approximately 134,090 and 124,287 sequence reads from the control and Cry3Aa-treated groups were assembled into 1,318 and 1,140 contigs, respectively. Enrichment analyses indicated that functions associated with mitochondrial respiration, signalling, maintenance of cell structure, membrane integrity, protein recycling/synthesis, and glycosyl hydrolases were significantly increased in Cry3Aa-treated larvae, whereas functions associated with many metabolic processes were reduced, especially glycolysis, tricarboxylic acid cycle, and fatty acid synthesis. Microarray analysis was used to evaluate temporal changes in gene expression after 6, 12 or 24 h of Cry3Aa exposure. Overall, microarray analysis indicated that transcripts related to allergens, chitin-binding proteins, glycosyl hydrolases, and tubulins were induced, and those related to immunity and metabolism were repressed in Cry3Aa-intoxicated larvae. The 24 h microarray data validated most of the RNA-Seq data. Of the three intoxication intervals, larvae demonstrated more differential expression of transcripts after 12 h exposure to Cry3Aa. Gene expression examined by three different methods in control vs. Cry3Aa-treated larvae at the 24 h time point indicated that transcripts encoding proteins with chitin-binding domain 3 were the most differentially expressed in Cry3Aa-intoxicated larvae. Overall, the data suggest that T. molitor larvae mount a complex response to Cry3Aa during the initial 24 h of intoxication. Data from this study represent the largest genetic sequence

ORF Sequence: ch_oct10_gene_aa_db [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GTGMKSFLEKLDEATKEFETQYKKWINDRREAIKKQRENEKLQKWNEISNIFKSDGVELNRDAQTPCIPEHLVEGFEESNESEDLSEIDQIEQVMLNPKGRLNFV* ... ch_oct10_gene_aa_db Chro.50191 >Chro.50191 hypothetical protein MSNSFLRDLKFVGVSSFL

NCBI nr-aa BLAST: CBRC-TTRU-01-0857 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TTRU-01-0857 ref|YP_073322.1| NADH dehydrogenase subunit 2 [Neomaskellia andro...pogonis] gb|AAS75448.1| NADH dehydrogenase subunit 2 [Neomaskellia andropogonis] YP_073322.1 5e-04 23% ...

Trust Building Recruitment Strategies for Researchers Conducting Studies in African American (AA) Churches: Lessons Learned.

Science.gov (United States)

Bonner, Gloria; Williams, Sharon; Wilkie, Diana; Hart, Alysha; Burnett, Glenda; Peacock, Geraldine

2017-12-01

An initial and vital important step in recruiting participants for church-based hospice and palliative care research is the establishment of trust and credibility within the church community. Mistrust of medical research is an extremely important barrier hindering recruitment in African American (AA) communities. A church-based EOL dementia education project is currently being conducted at four large urban AA churches. Church leaders voiced mistrust concerns of previous researchers who conducted investigations in their faith-based institutions. We explored strategies to ameliorate the mistrust concerns. Specific aim: To identify trust-rebuilding elements for researchers following others who violated trust of AA church leaders. Face-to-face, in-depth interviews were conducted from a convenient sample of four established AA church leaders. Interviews were held in the informants' churches to promote candor and comfort in revealing sensitive information about trust /mistrust. Content analysis framework was used to analyze the data. Elements identified from the analysis were then used to create themes. Multidimensional overarching themes emerged from the analysis included: Experience with researchers (positive and extremely negative), violation of trust and trust building strategies. Findings suggest that researchers who wish to conduct successful studies in the AA religious institutions must implement trust rebuilding strategies that include mutual respect, collaboration and partnership building. If general moral practices continue to be violated, threat to future hospice and palliative care research within the institutions may prevail. Thus, potential benefits are thwarted for the church members, AA community, and advancement of EOL care scholarship.

Hot Deformation Behavior of Hot-Extruded AA7175 Through Hot Torsion Tests.

Science.gov (United States)

Lee, Se-Yeon; Jung, Taek-Kyun; Son, Hyeon-Woo; Kim, Sang-Wook; Son, Kwang-Tae; Choi, Ho-Joon; Oh, Sang-Ho; Lee, Ji-Woon; Hyun, Soong-Keun

2018-03-01

The hot deformation behavior of hot-extruded AA7175 was investigated with flow curves and processing maps through hot torsion tests. The flow curves and the deformed microstructures revealed that dynamic recrystallization (DRX) occurred in the hot-extruded AA7175 during hot working. The failure strain was highest at medium temperature. This was mainly influenced by the dynamic precipitation of fine rod-shaped MgZn2. The processing map determined the optimal deformation condition for the alloy during hot working.

Proton magnetic resonance spectroscopy in the distinction of high-grade cerebral gliomas from single metastatic brain tumors

International Nuclear Information System (INIS)

Server, Andres; Schellhorn, Till; Haakonsen, Monika; Nakstad, Per H.; Josefsen, Roger; Kulle, Bettina; Maehlen, Jan; Kumar, Theresa; Gadmar, Oeystein; Langberg, Carl W.

2010-01-01

Background: Brain metastases and primary high-grade gliomas, including glioblastomas multiforme (GBM) and anaplastic astrocytomas (AA), may be indistinguishable by conventional magnetic resonance (MR) imaging. Identification of these tumors may have therapeutic consequences. Purpose: To assess the value of MR spectroscopy (MRS) using short and intermediate echo time (TE) in differentiating solitary brain metastases and high-grade gliomas on the basis of differences in metabolite ratios in the intratumoral and peritumoral region. Material and Methods: We performed MR imaging and MRS in 73 patients with histologically verified intraaxial brain tumors: 53 patients with high-grade gliomas (34 GBM and 19 AA) and 20 patients with metastatic brain tumors. The metabolite ratios of Cho/Cr, Cho/NAA, and NAA/Cr at intermediate TE and the presence of lipids at short TE were assessed from spectral maps in the tumoral core, peritumoral edema, and contralateral normal-appearing white matter. The differences in the metabolite ratios between high-grade gliomas/GBM/AA and metastases were analyzed statistically. Cutoff values of Cho/Cr, Cho/NAA, and NAA/Cr ratios in the peritumoral edema, as well as Cho/Cr and NAA/Cr ratios in the tumoral core for distinguishing high-grade gliomas/GBM/AA from metastases were determined by receiver operating characteristic (ROC) curve analysis. Results: Significant differences were noted in the peritumoral Cho/Cr, Cho/NAA, and NAA/ Cr ratios between high-grade gliomas/GBM/AA and metastases. ROC analysis demonstrated a cutoff value of 1.24 for peritumoral Cho/Cr ratio to provide sensitivity, specificity, positive (PPV), and negative predictive values (NPV) of 100%, 88.9%, 80.0%, and 100%, respectively, for discrimination between high-grade gliomas and metastases. By using a cutoff value of 1.11 for peritumoral Cho/NAA ratio, the sensitivity was 100%, the specificity was 91.1%, the PPV was 83.3%, and the NPV was 100%. Conclusion: The results of this

Near-infrared spectroscopy for cocrystal screening. A comparative study with Raman spectroscopy.

Science.gov (United States)

Allesø, Morten; Velaga, Sitaram; Alhalaweh, Amjad; Cornett, Claus; Rasmussen, Morten A; van den Berg, Frans; de Diego, Heidi Lopez; Rantanen, Jukka

2008-10-15

Near-infrared (NIR) spectroscopy is a well-established technique for solid-state analysis, providing fast, noninvasive measurements. The use of NIR spectroscopy for polymorph screening and the associated advantages have recently been demonstrated. The objective of this work was to evaluate the analytical potential of NIR spectroscopy for cocrystal screening using Raman spectroscopy as a comparative method. Indomethacin was used as the parent molecule, while saccharin and l-aspartic acid were chosen as guest molecules. Molar ratios of 1:1 for each system were subjected to two types of preparative methods. In the case of saccharin, liquid-assisted cogrinding as well as cocrystallization from solution resulted in a stable 1:1 cocrystalline phase termed IND-SAC cocrystal. For l-aspartic acid, the solution-based method resulted in a polymorphic transition of indomethacin into the metastable alpha form retained in a physical mixture with the guest molecule, while liquid-assisted cogrinding did not induce any changes in the crystal lattice. The good chemical peak selectivity of Raman spectroscopy allowed a straightforward interpretation of sample data by analyzing peak positions and comparing to those of pure references. In addition, Raman spectroscopy provided additional information on the crystal structure of the IND-SAC cocrystal. The broad spectral line shapes of NIR spectra make visual interpretation of the spectra difficult, and consequently, multivariate modeling by principal component analysis (PCA) was applied. Successful use of NIR/PCA was possible only through the inclusion of a set of reference mixtures of parent and guest molecules representing possible solid-state outcomes from the cocrystal screening. The practical hurdle related to the need for reference mixtures seems to restrict the applicability of NIR spectroscopy in cocrystal screening.

Making ET AAS Determination Less Dependent on Vapourization ...

African Journals Online (AJOL)

NICO

The quantification of the analytes in ET AAS is normally attained by the measurement and integration of transient absorbance. High degree of atomization and constant vapour transportation rate for the analyte atoms in the absorption volume are considered to be crucial to grant correctness of the measurements. However ...

Overall view of the AA hall dominated by the 50 ton crane (Donges).

CERN Multimedia

1980-01-01

A 50 ton, 32 metre span overhead travelling cranre was mounted in one of the bays of Hall 193 (AA). An identical crane was mounted on the other bay. See also photo 8004261. For photos of the AA in different phases of completion (between 1979 and 1982) see: 7911303, 7911597X, 8004261, 8004608X, 8005563X, 8005565X, 8006716X, 8006722X, 8010939X, 8010941X, 8202324, 8202658X, 8203628X .

NCBI nr-aa BLAST: CBRC-XTRO-01-3068 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-3068 ref|NP_960250.1| AppC [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS03633.1| AppC [Mycobacterium avium subsp. paratuberculosis K-10] NP_960250.1 2.1 28% ...

Chemical analysis of acoustically levitated drops by Raman spectroscopy.

Science.gov (United States)

Tuckermann, Rudolf; Puskar, Ljiljana; Zavabeti, Mahta; Sekine, Ryo; McNaughton, Don

2009-07-01

An experimental apparatus combining Raman spectroscopy with acoustic levitation, Raman acoustic levitation spectroscopy (RALS), is investigated in the field of physical and chemical analytics. Whereas acoustic levitation enables the contactless handling of microsized samples, Raman spectroscopy offers the advantage of a noninvasive method without complex sample preparation. After carrying out some systematic tests to probe the sensitivity of the technique to drop size, shape, and position, RALS has been successfully applied in monitoring sample dilution and preconcentration, evaporation, crystallization, an acid-base reaction, and analytes in a surface-enhanced Raman spectroscopy colloidal suspension.

AAS 227: Day 3

Science.gov (United States)

Kohler, Susanna

2016-01-01

Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

Deep-ultraviolet cavity ringdown spectroscopy

NARCIS (Netherlands)

Sneep, M.C.; Hannemann, S.; van Duijn, E.J.; Ubachs, W.M.G.

2004-01-01

The sensitive optical detection technique of cavity ringdown spectroscopy is extended to the wavelength range 197-204 nm. A novel design narrowband Fourier-transform-limited laser is used, and the technique is applied to gas-phase extinction measurements in CO

NCBI nr-aa BLAST: CBRC-CREM-01-1284 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CREM-01-1284 ref|NP_962383.1| SugI [Mycobacterium avium subsp. paratuberculosis... K-10] gb|AAS05999.1| SugI [Mycobacterium avium subsp. paratuberculosis K-10] NP_962383.1 2e-85 55% ...

NCBI nr-aa BLAST: CBRC-FCAT-01-0804 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-FCAT-01-0804 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 24% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-1349 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-1349 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.8 25% ...

NCBI nr-aa BLAST: CBRC-DNOV-01-2699 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DNOV-01-2699 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 0.055 30% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0782 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0782 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 1.9 26% ...

Effect of heating produced by welding on the microstructure and on the stress corrosion cracking susceptibility of AA7028 alloy

International Nuclear Information System (INIS)

Calatayud, A.; Rodenas, M.; Ferrer, C.; Amigo, V.; Salvador, M.D.

1997-01-01

The microstructural and stress corrosion cracking changes due to welding are studied for the AA7028 aluminium alloy. Special attention is paid to the characterization of what is known as the white zone. The influence of the delay step between quenching and aging in a T73 treatment on the microstructure and on the characteristics of the heat-affected zone (HAZ) is also studied. Finally the effect of thermal treatments applied on this zone after the welding is analysed. (Author) 7 refs

Time-resolved ESR spectroscopy

International Nuclear Information System (INIS)

Beckert, D.

1986-06-01

The time-resolved ESR spectroscopy is one of the modern methods in radiospectroscopy and plays an important role in solving various problems in chemistry and biology. Proceeding from the basic ideas of time-resolved ESR spectroscopy the experimental equipment is described generally including the equipment developed at the Central Institute of Isotope and Radiation Research. The experimental methods applied to the investigation of effects of chemically induced magnetic polarization of electrons and to kinetic studies of free radicals in polymer systems are presented. The theory of radical pair mechanism is discussed and theoretical expressions are summarized in a computer code to compute the theoretical polarization for each pair of the radicals

Ultrafast laser spectroscopy in complex solid state materials

Energy Technology Data Exchange (ETDEWEB)

Li, Tianqi [Iowa State Univ., Ames, IA (United States)

2014-12-01

This thesis summarizes my work on applying the ultrafast laser spectroscopy to the complex solid state materials. It shows that the ultrafast laser pulse can coherently control the material properties in the femtosecond time scale. And the ultrafast laser spectroscopy can be employed as a dynamical method for revealing the fundamental physical problems in the complex material systems.

NCBI nr-aa BLAST: CBRC-MDOM-04-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-04-0135 ref|YP_073313.1| ATP synthase F0 subunit 6 [Neomaskellia andropog...onis] gb|AAS75439.1| ATP synthase F0 subunit 6 [Neomaskellia andropogonis] YP_073313.1 3e-04 28% ...

AA, inner conductor of a magnetic horn

CERN Multimedia

CERN PhotoLab

1981-01-01

At the start-up of the AA and during its initial operation, magnetic horns focused the antiprotons emanating from the production target. These "current-sheet lenses" had a thin inner conductor (for minimum absorption of antiprotons), machined from aluminium to wall thicknesses of 0.7 or 1 mm. The half-sine pulses rose to 150 kA in 8 microsec. The angular acceptance was 50 mrad.

Valsartan reduces AT1-AA-induced apoptosis through suppression oxidative stress mediated ER stress in endothelial progenitor cells.

Science.gov (United States)

Wang, Z-C; Qi, J; Liu, L-M; Li, J; Xu, H-Y; Liang, B; Li, B

2017-03-01

Valsartan has been reported to have the function of treating hypertension and improving the prognosis of patients. Many studies indicated that valsartan can also increase angiotensin II, andosterone and plasma renin activity (PRA). Autoantibodies against the angiotensin II type 1 receptor (AT1-AA) have been showed to increase reactive oxygen species (ROS) and calcium (Ca2+) and result in apoptosis in vascular smooth muscle cells. In this study, we attempted to explore the effect of valsartan on AT1-AA-induced apoptosis in endothelial progenitor cells. Endothelial progenitor cells (EPCs) were cultured. The cytotoxicity was determined by MTT assay. EPCs apoptosis was determined by DAPI staining and flow cytometry. Reactive oxygen species, intracellular calcium concentration and calpain activity were measured using Fluostar Omega Spectrofluorimeter. The expression of p-ERK, p-eIF-2a, CHOP, Bcl-2 and caspase-3 were detected by Western blot. MTT assays showed valsartan significantly inhibited AT1-AA- induced decline of the viability of EPCs. DAPI staining and flow cytometry results indicated valsartan inhibited AT1-AA-induced decline of the viability of EPCs via inhibiting AT1-AA-induced apoptosis. Furthermore, the increasing of reactive oxygen species, intracellular calcium and calpain activity induced by AT1-AA in EPCs were also recovered after pre-treated with valsartan. Meanwhile, the upregulation of p-ERK, p-eIF-2a and CHOP, downregulation of Bcl-2, and activation of Caspase-3 caused by AT1-AA were reversed after pre-incubated with valsartan. Valsartan could inhibit AT1-AA-induced apoptosis through inhibiting oxidative stress mediated ER stress in EPCs.

Drawing attention to a neglected injecting-related harm: a systematic review of AA amyloidosis among people who inject drugs.

Science.gov (United States)

Harris, Magdalena; Brathwaite, Rachel; Scott, Jenny; Gilchrist, Gail; Ciccarone, Dan; Hope, Vivian; McGowan, Catherine R

2018-04-26

Chronic skin and soft tissue infections (SSTI) among people who inject drugs (PWID) can lead to AA amyloidosis: a serious, yet neglected, multi-organ disease. We aim to synthesize findings on the epidemiology, risk factors, clinical outcomes, screening recommendations and challenges to treatment for AA amyloidosis among PWID. A systematic review was conducted in accordance with the Preferred Reporting Items for Systematic Reviews and Meta-Analyses (PRISMA). We searched the following bibliographic databases in July 2017: CINAHL Plus, Embase, Global Health, MEDLINE, PsycEXTRA, PsycINFO and SCOPUS. Studies were included if they investigated AA amyloidosis in PWID. Studies were not restricted to location, study type, year or language of publication. Study heterogeneity precluded meta-analysis; we present a narrative review of the literature. Thirty-seven papers from eight countries met inclusion criteria. A total of 781 PWID are reported on, of whom 177 had AA amyloidosis. Where disease causality is established, it is attributed to chronic inflammation caused by injecting-related SSTIs. Most (88.7%) PWID with AA amyloidosis had SSTIs. The proportion of PWID with AA amyloidosis at post-mortem ranged from 1.6% (Germany) to 22.5% (Serbia). Biopsy studies reported from 5.26% (Portugal) to 50% (Germany) of AA amyloidosis in PWID with suspected or known kidney disease. Following diagnosis, the typical trajectory for PWID with AA amyloidosis was rapid deterioration of renal function requiring haemodialysis. Treatment difficulties, end-stage renal failure and premature death from sepsis were observed. Good outcomes, including reversibility of AA amyloidosis, are attributed to rapid treatment of the underlining inflammation and injecting cessation. Notably, given the population in question, no studies were published in addiction or harm reduction journals; most (92%) appeared in specialist nephrology and medical journals. There is strong evidence of an association between skin

Molecular cloning and expression analysis of the aqp1aa gene in half-smooth tongue sole (Cynoglossus semilaevis.

Directory of Open Access Journals (Sweden)

Hua Guo

Full Text Available Aquaporin 1 (AQP1 is a member of the transmembrane water channel family of proteins with special structural features, and two AQP1 paralogous genes (aqp1aa and aqp1ab are reported in teleosts. In the present study, the aqp1aa gene of half-smooth tongue sole (Cynoglossus semilaevis was cloned and characterized. The full-length cDNA of aqp1aa is 1411 bp with a 786 bp open reading frame encoding a 261-amino acid putative protein with a characteristic structure consisting of 6 membrane-spanning α-helical domains and two highly conserved asparagine-proline-alanine motifs. Real-time quantitative PCR revealed that aqp1aa mRNA is expressed predominantly in the testis of males and pseudo-males, while its expression is low in the ovary and lowest in doublesex and mab-3-related transcription factor 1(DMRT1 knock out fish and triploid males. In situ hybridization indicated that aqp1aa mRNA is expressed mainly in the germ cells of males and pseudo-males, especially in spermatozoa and spermatids. These results suggest that the aqp1aa may play a role in spermatogenesis of C. semilaevis.

Space-resolved characterization of high frequency atmospheric-pressure plasma in nitrogen, applying optical emission spectroscopy and numerical simulation

International Nuclear Information System (INIS)

Rajasekaran, Priyadarshini; Ruhrmann, Cornelia; Bibinov, Nikita; Awakowicz, Peter

2011-01-01

Averaged plasma parameters such as electron distribution function and electron density are determined by characterization of high frequency (2.4 GHz) nitrogen plasma using both experimental methods, namely optical emission spectroscopy (OES) and microphotography, and numerical simulation. Both direct and step-wise electron-impact excitation of nitrogen emissions are considered. The determination of space-resolved electron distribution function, electron density, rate constant for electron-impact dissociation of nitrogen molecule and the production of nitrogen atoms, applying the same methods, is discussed. Spatial distribution of intensities of neutral nitrogen molecule and nitrogen molecular ion from the microplasma is imaged by a CCD camera. The CCD images are calibrated using the corresponding emissions measured by absolutely calibrated OES, and are then subjected to inverse Abel transformation to determine space-resolved intensities and other parameters. The space-resolved parameters are compared, respectively, with the averaged parameters, and an agreement between them is established. (paper)

Etanercept In the treatment of AA-amyloidosis in juvenile rheumatoid arthritis

Directory of Open Access Journals (Sweden)

H Mihels

2004-01-01

Full Text Available Objective. To study effect of etanercept, an antagonist of serum A amyloid production in the AA amyloidosis treatment in juvenile idiopathic arthritis (JIA. Material and methods. Etanercept was administered to all pts with AA amyloidosis admitted to Garmisch-Paterkirchen pediatric rheumatological clinic beginning with 2000. C-reactive protein (CRP, degree of proteinuria and serum creatinin were used as preliminary outcome measures. Results. 11 pts with seronegative JIA (6 boys and 5 girls were included in the study. Mean follow up duration was l,9±l.01 years. 8 children had systemic, 2 - olygoarticular and one - polyarticular disease onset. Before the study all pts had CRP level elevation (1,03-8,29 mg/dl, mean 4,53 mg/dl. 8 from 11 had marked proteinuria (364-7400 mg/24 hours, mean 1186 mg/24 hours. 2 from 11 had serum creatinin elevation. During etanercept treatment CRP level normalized in 2 and significantly decreased in 4 pts. Proteinuria decreased in 4 from 8 pts. Significant change of creatinin level was not achieved. One girl who did not have improvement during etanercept treatment showed CRP normalization and decrease of proteinuria when the drug was changed to infliximab. Conclusion. Treatment with etanercept provided improvement in almost 2/3 from 11 pts with JIA and AA amyloidosis. Etanercept may be the drug of choice in pts with normal creatinine level in the absence of proteinuria. When it fails another tumor necrosis factor antagonist such as infliximab should be used. It is necessary to extend volume and duration of the study to get more reliable data on etanercept efficacy in JIA pts with AA amyloidosis.

Binding specificity of Bacillus thuringiensis Cry1Aa for purified, native Bombyx mori aminopeptidase N and cadherin-like receptors

Directory of Open Access Journals (Sweden)

Jenkins Jeremy L

2001-10-01

Full Text Available Abstract Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm aminopeptidase N (APN and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM, and unusually tight binding to the cadherin-like receptor (2.6 nM, which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research.

Binding specificity of Bacillus thuringiensis Cry1Aa for purified, native Bombyx mori aminopeptidase N and cadherin-like receptors

Science.gov (United States)

Jenkins, Jeremy L; Dean, Donald H

2001-01-01

Background To better understand the molecular interactions of Bt toxins with non-target insects, we have examined the real-time binding specificity and affinity of Cry1 toxins to native silkworm (Bombyx mori) midgut receptors. Previous studies on B. mori receptors utilized brush border membrane vesicles or purifed receptors in blot-type assays. Results The Bombyx mori (silkworm) aminopeptidase N (APN) and cadherin-like receptors for Bacillus thuringiensis insecticidal Cry1Aa toxin were purified and their real-time binding affinities for Cry toxins were examined by surface plasmon resonance. Cry1Ab and Cry1Ac toxins did not bind to the immobilized native receptors, correlating with their low toxicities. Cry1Aa displayed moderate affinity for B. mori APN (75 nM), and unusually tight binding to the cadherin-like receptor (2.6 nM), which results from slow dissociation rates. The binding of a hybrid toxin (Aa/Aa/Ac) was identical to Cry1Aa. Conclusions These results indicate domain II of Cry1Aa is essential for binding to native B. mori receptors and for toxicity. Moreover, the high-affinity binding of Cry1Aa to native cadherin-like receptor emphasizes the importance of this receptor class for Bt toxin research. PMID:11722800

Variation of amino acid sequences of serum amyloid a (SAA) and immunohistochemical analysis of amyloid a (AA) in Japanese domestic cats.

Science.gov (United States)

Tei, Meina; Uchida, Kazuyuki; Chambers, James K; Watanabe, Ken-Ichi; Tamamoto, Takashi; Ohno, Koichi; Nakayama, Hiroyuki

2018-02-02

Amyloid A (AA) amyloidosis, a fatal systemic amyloid disease, occurs secondary to chronic inflammatory conditions in humans. Although persistently elevated serum amyloid A (SAA) levels are required for its pathogenesis, not all individuals with chronic inflammation necessarily develop AA amyloidosis. Furthermore, many diseases in cats are associated with the elevated production of SAA, whereas only a small number actually develop AA amyloidosis. We hypothesized that a genetic mutation in the SAA gene may strongly contribute to the pathogenesis of feline AA amyloidosis. In the present study, genomic DNA from four Japanese domestic cats (JDCs) with AA amyloidosis and from five without amyloidosis was analyzed using polymerase chain reaction (PCR) amplification and direct sequencing. We identified the novel variation combination of 45R-51A in the deduced amino acid sequences of four JDCs with amyloidosis and five without. However, there was no relationship between amino acid variations and the distribution of AA amyloid deposits, indicating that differences in SAA sequences do not contribute to the pathogenesis of AA amyloidosis. Immunohistochemical analysis using antisera against the three different parts of the feline SAA protein-i.e., the N-terminal, central, and C-terminal regions-revealed that feline AA contained the C-terminus, unlike human AA. These results indicate that the cleavage and degradation of the C-terminus are not essential for amyloid fibril formation in JDCs.

Bt rice expressing Cry2Aa does not harm Cyrtorhinus lividipennis, a main predator of the nontarget herbivore Nilapavarta lugens.

Directory of Open Access Journals (Sweden)

Yu Han

Full Text Available T2A-1 is a newly developed transgenic rice that expresses a synthesized cry2Aa gene driven by the maize ubiquitin promoter. T2A-1 exhibits high resistance against lepidopteran pests of rice. The brown planthopper, Nilapavarta lugens (Stål, is a main nontarget sap-sucking insect pest of rice, and Cyrtorhinus lividipennis (Reuter is the major predator of the eggs and young nymphs of planthoppers. As C. lividipennis may expose to the Cry2Aa protein via N. lugens, it is therefore essential to assess the potential effects of transgenic cry2Aa rice on this predator. In the present study, three experiments were conducted to evaluate the ecological risk of transgenic cry2Aa rice to C. lividipennis: (1 a direct feeding experiment in which C. lividipennis was fed an artificial diet containing Cry2Aa at the dose of 10-time higher than that it may encounter in the realistic field condition; (2 a tritrophic experiment in which the Cry2Aa protein was delivered to C. lividipennis indirectly through prey eggs or nymphs; (3 a realistic field experiment in which the population dynamics of C. lividipennis were investigated using vacuum-suction. Both direct exposure to elevated doses of the Cry2Aa protein and prey-mediated exposure to realistic doses of the protein did not result in significant detrimental effects on the development, survival, female ratio and body weight of C. lividipennis. No significant differences in population density and population dynamics were observed between C. lividipennis in transgenic cry2Aa and nontransgenic rice fields. It may be concluded that transgenic cry2Aa rice had no detrimental effects on C. lividipennis. This study represents the first report of an assessment continuum for the effects of transgenic cry2Aa rice on C. lividipennis.

Lack of evidence for protein AA reactivity in amyloid deposits of lattice corneal dystrophy and amyloid corneal degeneration.

Science.gov (United States)

Gorevic, P D; Rodrigues, M M; Krachmer, J H; Green, C; Fujihara, S; Glenner, G G

1984-08-15

Amyloid fibrils occurring in primary and myeloma-associated (AL), secondary (AA), and certain neuropathic hereditary forms of systemic amyloidosis can be distinguished biochemically or immunohistologically as being composed of immunoglobulin light chain, protein AA, or prealbumin respectively. All types of systemic and several localized forms of amyloidosis contain amyloid P component (protein AP). We studied formalin-fixed tissue from eight cases of lattice corneal dystrophy by the immunoperoxidase method using antisera to proteins AA and AP, to normal serum prealbumin and prealbumin isolated from a case of hereditary amyloidosis, and to light-chain determinants; additional cases were examined by indirect immunofluorescence of fresh-frozen material. We found weak (1:10 dilution) staining with anti-AP, but no reactivity with other antisera. Congo red staining was resistant to pretreatment of sections with potassium permanganate, a characteristic of non-AA amyloid. Two-dimensional gels of solubilized proteins from frozen tissue from two cases of lattice corneal dystrophy resembled those obtained from normal human cornea. Western blots of two cases of polymorphous amyloid degeneration and solubilized protein from normal cornea did not react with radioactive iodine-labeled anti-AA or anti-AP with purified protein AP and unfixed protein AA amyloid tissue as controls. We were unable to corroborate the presence of protein AA in the amyloid deposits of lattice corneal dystrophy. Although staining with antiserum to protein AP was demonstrable, the molecular configuration of this protein in stromal deposits remains to be defined.

The Influences of Artificial Aging Temperature and Time on Pitting Susceptibility of SiCp/ AA2024 MMCs

International Nuclear Information System (INIS)

Kim, S. K.; Jo, C. J.; Kwon, B. H.; Hwang, W. S.

2000-01-01

The effects of artificial aging temperature and time were investigated on the pitting behaviors of SiCp/ AA2024 composites through measuring the changes of open circuit potential, pitting potential, and repassivation potential in a 3.5 wt% NaCl solution. And, the influence of microstructure on the pitting susceptibility was studied by measurement of TEM images. AA2024 Al alloy and 15vol%SiCp/ AA2024 composites were fabricated by vacuum hot pressing and hot extrusion with an extrusion ratio of 25 : 1. They were solutionized at 495 .deg. C for 4 hours, and aged at 130, 150, 170, and 190 .deg. C for 1, 2, 4, 8, and 16 hours. In aerated 3.5% NaCl solutions, the open circuit potential and pitting potential of both AA2024 alloy and composites were similar each other, and pitting occurred immediately at immersed condition. The pitting potential was decreased with increasing aging temperature and time. Also, the repassivation potential of SiCp/ AA2024 composites was decreased as increasing aging temperature and time. It was concluded that formation and growth of S' and S phase by artificial aging promoted the pitting susceptibility of SiCp/ AA2024 composites because these phases, easily soluble by forming galvanic couples with substrate Al alloy, served as preferential sites for nucleation of pits

Cold metal transfer spot plug welding of AA6061-T6-to-galvanized steel for automotive applications

International Nuclear Information System (INIS)

Cao, R.; Huang, Q.; Chen, J.H.; Wang, Pei-Chung

2014-01-01

Highlights: • Two Al-to-galvanized steel spot plug welding joints were studied by CMT method. • The optimum process variables for the two joints were gotten by orthogonal test. • Connection mechanism of the two joints were discussed. -- Abstract: In this study, cold metal transfer (CMT) spot plug joining of 1 mm thick Al AA6061-T6 to 1 mm thick galvanized steel (i.e., Q235) was studied. Welding variables were optimized for a plug weld in the center of a 25 mm overlap region with aluminum 4043 wire and 100% argon shielding gas. Microstructures and elemental distributions were characterized by scanning electron microscopy with energy dispersive X-ray spectrometer. Mechanical testing of CMT spot plug welded joints was conducted. It was found that it is feasible to join Al AA6061T6-to-galvanized steel by CMT spot plug welding method. The process variables for two joints with Al AA6061T6-to-galvanized mild steel and galvanized mild steel-to-Al AA6061T6 are optimized. The strength of CMT spot welded Al AA6061T6-to-galvanized mild steel is determined primarily by the strength and area of the brazed interface. While, the strength of the galvanized mild steel-to-Al AA6061T6 joint is mainly dependent upon the area of the weld metal

'Care and Prevent': rationale for investigating skin and soft tissue infections and AA amyloidosis among people who inject drugs in London.

Science.gov (United States)

Harris, M; Brathwaite, R; McGowan, Catherine R; Ciccarone, D; Gilchrist, G; McCusker, M; O'Brien, K; Dunn, J; Scott, J; Hope, V

2018-05-08

Skin and soft tissue infections (SSTIs) are a leading cause of morbidity and mortality among people who inject drugs (PWID). International data indicate up to one third of PWID have experienced an SSTI within the past month. Complications include sepsis, endocarditis and amyloid A (AA) amyloidosis. AA amyloidosis is a serious sequela of chronic SSTI among PWID. Though there is a paucity of literature reporting on AA amyloidosis among PWID, what has been published suggests there is likely a causal relationship between AA amyloidosis and injecting-related SSTI. If left untreated, AA amyloidosis can lead to renal failure; premature mortality among diagnosed PWID is high. Early intervention may reverse disease. Despite the high societal and individual burden of SSTI among PWID, empirical evidence on the barriers and facilitators to injecting-related SSTI prevention and care or the feasibility and acceptability of AA amyloidosis screening and treatment referral are limited. This study aims to fill these gaps and assess the prevalence of AA amyloidosis among PWID. Care and Prevent is a UK National Institute for Health Research-funded mixed-methods study. In five phases (P1-P5), we aim to assess the evidence for AA amyloidosis among PWID (P1); assess the feasibility of AA amyloidosis screening, diagnostic and treatment referral among PWID in London (P2); investigate the barriers and facilitators to AA amyloidosis care (P3); explore SSTI protection and risk (P4); and co-create harm reduction resources with the affected community (P5). This paper describes the conceptual framework, methodological design and proposed analysis for the mixed-methods multi-phase study. We are implementing the Care and Prevent protocol in London. The systematic review component of the study has been completed and published. Care and Prevent will generate an estimate of AA amyloidosis prevalence among community recruited PWID in London, with implications for the development of screening

Fourier Transform Infrared Radiation Spectroscopy Applied for Wood Rot Decay and Mould Fungi Growth Detection

Directory of Open Access Journals (Sweden)

Bjørn Petter Jelle

2012-01-01

Full Text Available Material characterization may be carried out by the attenuated total reflectance (ATR Fourier transform infrared (FTIR radiation spectroscopical technique, which represents a powerful experimental tool. The ATR technique may be applied on both solid state materials, liquids, and gases with none or only minor sample preparations, also including materials which are nontransparent to IR radiation. This facilitation is made possible by pressing the sample directly onto various crystals, for example, diamond, with high refractive indices, in a special reflectance setup. Thus ATR saves time and enables the study of materials in a pristine condition, that is, the comprehensive sample preparation by pressing thin KBr pellets in traditional FTIR transmittance spectroscopy is hence avoided. Materials and their ageing processes, both ageing by natural and accelerated climate exposure, decomposition and formation of chemical bonds and products, may be studied in an ATR-FTIR analysis. In this work, the ATR-FTIR technique is utilized to detect wood rot decay and mould fungi growth on various building material substrates. An experimental challenge and aim is to be able to detect the wood rot decay and mould fungi growth at early stages when it is barely visible to the naked eye. Another goal is to be able to distinguish between various species of fungi and wood rot.

Acoustic resonance spectroscopy for the advanced undergraduate laboratory

International Nuclear Information System (INIS)

Franco-Villafañe, J A; Méndez-Sánchez, R A; Flores-Olmedo, E; Báez, G; Gandarilla-Carrillo, O

2012-01-01

We present a simple experiment that allows advanced undergraduates to learn the principles and applications of spectroscopy. The technique, known as acoustic resonance spectroscopy, is applied to study a vibrating rod. The setup includes electromagnetic-acoustic transducers, an audio amplifier and a vector network analyzer. Typical results of compressional, torsional and bending waves are analyzed and compared with analytical results. (paper)

Overview. Department of Nuclear Spectroscopy. Section 2

Energy Technology Data Exchange (ETDEWEB)

Styczen, J. [Institute of Nuclear Physics, Cracow (Poland)

1995-12-31

The 1994 year activity in the Nuclear Spectroscopy Department was like in previous years spread over large variety of subjects concerned with the in-beam nuclear spectroscopy and many nucleon transfer reactions, properties of high excited nuclear states, and the applied nuclear spectroscopy. The studies in the first two groups were mostly carried out in a vast international collaboration which enabled us to carry out experiments on highly sophisticated experimental facilities abroad like EUROGAM, GASP, HECTOR or OSIRIS, and others. Some preparations for `home` experiments have been carried out on the very much looked forward and recently obtained heavy ion beam from the cyclotron at the Warsaw University. The applied nuclear spectroscopy works, on the other hand, were based on using our own installations: an elaborated set-up for perturbed angular correlations, the RBS and PIXE set-ups at the Van de Graaff accelerator, the implanter, an atomic force microscope and several others. Much of the effort manifests itself in several valuable results which are summarized in the following pages. It is to be underlined that those results, as well as some new instrumentation developments were possible due to additional support via special grants and the promotion of the international cooperation by the State Committee for Scientific Research (KBN). (author).

Overview. Department of Nuclear Spectroscopy. Section 2

Energy Technology Data Exchange (ETDEWEB)

Styczen, J [Institute of Nuclear Physics, Cracow (Poland)

1996-12-31

The 1994 year activity in the Nuclear Spectroscopy Department was like in previous years spread over large variety of subjects concerned with the in-beam nuclear spectroscopy and many nucleon transfer reactions, properties of high excited nuclear states, and the applied nuclear spectroscopy. The studies in the first two groups were mostly carried out in a vast international collaboration which enabled us to carry out experiments on highly sophisticated experimental facilities abroad like EUROGAM, GASP, HECTOR or OSIRIS, and others. Some preparations for `home` experiments have been carried out on the very much looked forward and recently obtained heavy ion beam from the cyclotron at the Warsaw University. The applied nuclear spectroscopy works, on the other hand, were based on using our own installations: an elaborated set-up for perturbed angular correlations, the RBS and PIXE set-ups at the Van de Graaff accelerator, the implanter, an atomic force microscope and several others. Much of the effort manifests itself in several valuable results which are summarized in the following pages. It is to be underlined that those results, as well as some new instrumentation developments were possible due to additional support via special grants and the promotion of the international cooperation by the State Committee for Scientific Research (KBN). (author).

Transgenic plants expressing the AaIT/GNA fusion protein show increased resistance and toxicity to both chewing and sucking pests.

Science.gov (United States)

Liu, Shu-Min; Li, Jie; Zhu, Jin-Qi; Wang, Xiao-Wei; Wang, Cheng-Shu; Liu, Shu-Sheng; Chen, Xue-Xin; Li, Sheng

2016-04-01

The adoption of pest-resistant transgenic plants to reduce yield losses and decrease pesticide use has been successful. To achieve the goal of controlling both chewing and sucking pests in a given transgenic plant, we generated transgenic tobacco, Arabidopsis, and rice plants expressing the fusion protein, AaIT/GNA, in which an insecticidal scorpion venom neurotoxin (Androctonus australis toxin, AaIT) is fused to snowdrop lectin (Galanthus nivalis agglutinin, GNA). Compared with transgenic tobacco and Arabidopsis plants expressing AaIT or GNA, transgenic plants expressing AaIT/GNA exhibited increased resistance and toxicity to one chewing pest, the cotton bollworm, Helicoverpa armigera. Transgenic tobacco and rice plants expressing AaIT/GNA showed increased resistance and toxicity to two sucking pests, the whitefly, Bemisia tabaci, and the rice brown planthopper, Nilaparvata lugens, respectively. Moreover, in the field, transgenic rice plants expressing AaIT/GNA exhibited a significant improvement in grain yield when infested with N. lugens. This study shows that expressing the AaIT/GNA fusion protein in transgenic plants can be a useful approach for controlling pests, particularly sucking pests which are not susceptible to the toxin in Bt crops. © 2015 Institute of Zoology, Chinese Academy of Sciences.

On the merits of conversion electron Mossbauer spectroscopy in geosciences

DEFF Research Database (Denmark)

Gunnlaugsson, H.P.; Bertelsen, P.; Budtz-Jørgensen, Carl

2006-01-01

Described are some applications of conversion electron Mossbauer spectroscopy (CEMS) in geosciences. It is shown how easily this technique can be applied in existing Mossbauer laboratories to investigate natural samples. Some examples demonstrate the kind of information CEMS can give on the weath......Described are some applications of conversion electron Mossbauer spectroscopy (CEMS) in geosciences. It is shown how easily this technique can be applied in existing Mossbauer laboratories to investigate natural samples. Some examples demonstrate the kind of information CEMS can give...

A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau

Energy Technology Data Exchange (ETDEWEB)

Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A., E-mail: rloomis@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States)

2017-05-01

AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO{sup +} and {sup 13}CO ( J = 3–2) line emission. The HCO{sup +} emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO{sup +} line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.

A Multi-ringed, Modestly Inclined Protoplanetary Disk around AA Tau

International Nuclear Information System (INIS)

Loomis, Ryan A.; Öberg, Karin I.; Andrews, Sean M.; MacGregor, Meredith A.

2017-01-01

AA Tau is the archetype for a class of stars with a peculiar periodic photometric variability thought to be related to a warped inner disk structure with a nearly edge-on viewing geometry. We present high resolution (∼0.″2) ALMA observations of the 0.87 and 1.3 mm dust continuum emission from the disk around AA Tau. These data reveal an evenly spaced three-ringed emission structure, with distinct peaks at 0.″34, 0.″66, and 0.″99, all viewed at a modest inclination of 59.°1 ± 0.°3 (decidedly not edge-on). In addition to this ringed substructure, we find non-axisymmetric features, including a “bridge” of emission that connects opposite sides of the innermost ring. We speculate on the nature of this “bridge” in light of accompanying observations of HCO + and 13 CO ( J = 3–2) line emission. The HCO + emission is bright interior to the innermost dust ring, with a projected velocity field that appears rotated with respect to the resolved disk geometry, indicating the presence of a warp or inward radial flow. We suggest that the continuum bridge and HCO + line kinematics could originate from gap-crossing accretion streams, which may be responsible for the long-duration dimming of optical light from AA Tau.

Annonaceous acetogenin mimic AA005 induces cancer cell death via apoptosis inducing factor through a caspase-3-independent mechanism.

Science.gov (United States)

Han, Bing; Wang, Tong-Dan; Shen, Shao-Ming; Yu, Yun; Mao, Chan; Yao, Zhu-Jun; Wang, Li-Shun

2015-03-18

Annonaceous acetogenins are a family of natural products with antitumor activities. Annonaceous acetogenin mimic AA005 reportedly inhibits mammalian mitochondrial NADH-ubiquinone reductase (Complex I) and induces gastric cancer cell death. However, the mechanisms underlying its cell-death-inducing activity are unclear. We used SW620 colorectal adenocarcinoma cells to study AA005 cytotoxic activity. Cell deaths were determined by Trypan blue assay and flow cytometry, and related proteins were characterized by western blot. Immunofluorescence and subcellular fractionation were used to evaluate AIF nuclear translocation. Reactive oxygen species were assessed by using redox-sensitive dye DCFDA. AA005 induces a unique type of cell death in colorectal adenocarcinoma cells, characterized by lack of caspase-3 activation or apoptotic body formation, sensitivity to poly (ADP-ribose) polymerase inhibitor Olaparib (AZD2281) but not pan-caspase inhibitor Z-VAD.fmk, and dependence on apoptosis-inducing factor (AIF). AA005 treatment also reduced expression of mitochondrial Complex I components, and leads to accumulation of intracellular reactive oxygen species (ROS) at the early stage. Blocking ROS formation significantly suppresses AA005-induced cell death in SW620 cells. Moreover, blocking activation of RIP-1 by necroptosis inhibitor necrotatin-1 inhibits AIF translocation and partially suppresses AA005-induced cell death in SW620 cells demonstrating that RIP-1 protein may be essential for cell death. AA005 may trigger the cell death via mediated by AIF through caspase-3 independent pathway. Our work provided new mechanisms for AA005-induced cancer cell death and novel clues for cancer treatment via AIF dependent cell death.

Scanning Kelvin probe force microscopy as a means of predicting the electrochemical characteristics of the surface of a modified AA4xxx/AA3xxx (Al alloys) brazing sheet

International Nuclear Information System (INIS)

Afshar, F. Norouzi; Wit, J.H.W. de; Terryn, H.; Mol, J.M.C.

2013-01-01

Highlights: ► Macro- and micro-electrochemical surface properties of an aluminium brazing sheet were investigated. ► Electrochemical surface properties before and after brazing were studied and compared. ► Scanning Kelvin probe force microscopy and potentiodynamic polarization measurements were performed. ► The electrochemical responses were correlated to the pre- and post-brazing treatment microstructure. -- Abstract: Macro- and micro-electrochemical properties of clad and core surfaces of a modified AA4xxx/AA3xxx brazing sheet material, before and after brazing, have been evaluated and compared. By scanning Kelvin probe force microscopy (SKPFM), the Volta potential distribution over the brazed and non-brazed clad surfaces was measured. The changes in the Volta potential maps were correlated to the macro-electrochemical responses of the surfaces and the microstructural features that evolve as a result of brazing. By performing potentiodynamic polarization experiments and microscopic analysis of the corroded surfaces and cross sections, the suitability of SKPFM analysis for corrosion performance prediction of the aluminium brazing sheet material in a sea water acidified accelerated test (SWAAT) environment was confirmed. Considering the purity of Si phase in the structures of both brazed and non-brazed material, it is suggested that Si can be applied as a reliable local reference in both structures to compare the changes in Volta potential differences as the result of different heat treatments of aluminium brazing sheet. Increasing the copper content of the re-solidified clad material as a result of brazing treatment was found to increase the Volta potential of the matrix which in turn reduces the cathodic protection power of the re-solidified clad material towards the core material

Influence of steam-based pre-treatment using acidic chemistries on the adhesion performance of powder coated aluminium alloy AA6060

DEFF Research Database (Denmark)

Din, Rameez Ud; Nikogeorgos, Nikolaos; Jellesen, Morten Stendahl

2017-01-01

In this study, the adhesion of a commercially applied powder coating on a steam treated AA6060 surface withpure steam and steam with citric and phosphoric acid chemistries has been investigated. Contact angle,roughness, and nanoscale pull off forces were determined as a function of the steam trea...... with citric and phosphoric acid resulted in poor penetration of th eadhesive over the intermetallic particles, and the interface showed mixed (cohesive/adhesive) fracture during interface indentation, while the pure steam treated surface showed dominant cohesive fracture....

The Hidden Cost of Untreated Paragangliomas of the Head and Neck: Systemic Reactive (AA Amyloidosis

Directory of Open Access Journals (Sweden)

Erkan Dervisoglu

2015-01-01

Full Text Available We report a case of a 51-year-old man who was diagnosed with systemic reactive (AA amyloidosis in association with untreated glomus jugulare and glomus caroticum tumors. He refused radiotherapy and renal replacement therapy. Paragangliomas, although rare, should be considered one of the tumors that can result in AA amyloidosis.

Effect of precipitates on mechanical properties of AA2195

International Nuclear Information System (INIS)

Kim, Jae-Hee; Jeun, Jeong-Hoon; Chun, Hyun-Jin; Lee, Ye Rim; Yoo, Joon-Tae; Yoon, Jong-Hoon; Lee, Ho-Sung

2016-01-01

Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al_2Cu), ß′ (Al_3Zr), and T (Al_xLi_yCu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al_2Cu), ß′ (Al_3Zr), and T_1 (Al_2LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

Effect of precipitates on mechanical properties of AA2195

Energy Technology Data Exchange (ETDEWEB)

Kim, Jae-Hee [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Jeun, Jeong-Hoon [Department of Materials Science and Engineering, Seoul National University, Seoul (Korea, Republic of); Chun, Hyun-Jin [Southeast University, Nanjing (China); Lee, Ye Rim [Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Yoo, Joon-Tae [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Yoon, Jong-Hoon [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of); Lee, Ho-Sung, E-mail: hslee@kari.re.kr [Launcher Structure and Materials Team, Korea Aerospace Research Institute, Daejeon (Korea, Republic of); Department of Aerospace System Engineering, University of Science & Technology, Daejeon (Korea, Republic of)

2016-06-05

Addition of 1–4 wt.% lithium into a conventional Al–Cu–Mg alloy allows lower density and higher mechanical properties, which are attractive for aerospace applications. In this study, fundamental investigations including phase and microstructure evolution, resulting in strengthening, of the AA2195 are conducted to observe a possibility of production with commercial level. Precipitation sequence and kinetics during post-annealing were evaluated with variations of temperature and holding time. Microstructures revealed formation and evolution in representative precipitates including θ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T (Al{sub x}Li{sub y}Cu) series. Aluminum alloys have low hardness, modulus, and strength before aging, but precipitates such as θ′ (Al{sub 2}Cu), ß′ (Al{sub 3}Zr), and T{sub 1} (Al{sub 2}LiCu) show enhanced mechanical properties of AA2195 tempered because of their interaction with dislocation. However, longer holding time and higher annealing temperature result in significant decreases in mechanical properties due to the presence of incoherent precipitates (θ phase) and coarsening of the precipitates via grain-boundary diffusion. In the current study, the tensile strength of 560 MPa was obtained with post-heat treatment without work hardening. This value has never been achieved in other studies. The maximum strength was reported as 500 MPa without a work hardening process. - Highlights: • A relationship between microstructure and mechanical properties to post annealing AA2195. • A formation and dissolution of the precipitates were observed for various treatment. • An optimum post-annealing condition was obtained.

Highly sensitive fiber grating chemical sensors: An effective alternative to atomic absorption spectroscopy

Science.gov (United States)

Laxmeshwar, Lata. S.; Jadhav, Mangesh S.; Akki, Jyoti. F.; Raikar, Prasad; Kumar, Jitendra; prakash, Om; Raikar, U. S.

2017-06-01

Accuracy in quantitative determination of trace elements like Zinc, present in drinking water in ppm level, is a big challenge and optical fiber gratings as chemical sensors may provide a promising solution to overcome the same. This paper presents design of two simple chemical sensors based on the principle of shift in characteristic wavelength of gratings with change in their effective refractive index, to measure the concentration of Zinc in drinking water using etched short period grating (FBG) and Long period grating (LPG) respectively. Three samples of drinking water from different places have been examined for presence of Zinc. Further, the results obtained by our sensors have also been verified with the results obtained by a standard method, Atomic absorption spectroscopy (AAS). The whole experiment has been performed by fixing the fibers in a horizontal position with the sensor regions at the center of the fibers, making it less prone to disturbance and breaking. The sensitivity of LPG sensor is about 205 times that of the FBG sensor. A few advantages of Fiber grating sensors, besides their regular features, over AAS have also been discussed, that make our sensors potential alternatives for existing techniques in determination of trace elements in drinking water.

The effect of welding parameters on surface quality of AA6351 aluminium alloy

International Nuclear Information System (INIS)

Yacob, S; Ariffin, N; Ali, R; Arshad, A; Wahab, M I A; Ismail, S A; Roji, NS M; Din, W B W; Zakaria, M H; Abdullah, A; Yusof, M I; Kamarulzaman, K Z; Mahyuddin, A; Hamzah, M N; Roslan, R; MAli, M A; Ahsan, Q

2015-01-01

In the present work, the effects of gas metal arc welding-cold metal transfer (GMAW-CMT) parameters on surface roughness are experimentally assessed. The purpose of this study is to develop a better understanding of the effects of welding speed, material thickness and contact tip to work distance on the surface roughness. Experiments are conducted using single pass gas metal arc welding-cold metal transfer (GMAW-CMT) welding technique to join the material. The material used in this experiment was AA6351 aluminum alloy with the thickness of 5mm and 6mm. A Mahr Marsuft XR 20 machine was used to measure the average roughness (Ra) of AA6351 joints. The main and interaction effect analysis was carried out to identify process parameters that affect the surface roughness. The results show that all the input process parameters affect the surface roughness of AA6351 joints. Additionally, the average roughness (Ra) results also show a decreasing trend with increased of welding speed. It is proven that gas metal arc welding-cold metal transfer (GMAW-CMT)welding process has been successful in term of providing weld joint of good surface quality for AA6351 based on the low value surface roughness condition obtained in this setup. The outcome of this experimental shall be valuable for future fabrication process in order to obtained high good quality weld. (paper)

Transient thermal analysis during friction stir welding between AA2014-T6 and pure copper

Science.gov (United States)

Gadhavi, A. R.; Ghetiya, N. D.; Patel, K. M.

2018-04-01

AA2xxx-Cu alloys showed larger applications in the defence sectors and in aerospace industries due to high strength to weight ratio and toughness. FSW in a butt joint configuration was carried out between AA2014-T6 and pure Copper placing AA2014 on AS and Cu on RS. Temperature profiles were observed by inserting K-type thermocouples in the mid-thickness at various locations of the plate. A sharp decrease in temperature profiles was observed on Copper side due to its higher thermal conductivity. A thermal numerical model was prepared in ANSYS to compare the simulated temperature profiles with the experimental temperature profiles and both the temperature profiles were found to be in good agreement.

Wear behavior of AA 5083/SiC nano-particle metal matrix composite: Statistical analysis

Science.gov (United States)

Hussain Idrisi, Amir; Ismail Mourad, Abdel-Hamid; Thekkuden, Dinu Thomas; Christy, John Victor

2018-03-01

This paper reports study on statistical analysis of the wear characteristics of AA5083/SiC nanocomposite. The aluminum matrix composites with different wt % (0%, 1% and 2%) of SiC nanoparticles were fabricated by using stir casting route. The developed composites were used in the manufacturing of spur gears on which the study was conducted. A specially designed test rig was used in testing the wear performance of the gears. The wear was investigated under different conditions of applied load (10N, 20N, and 30N) and operation time (30 mins, 60 mins, 90 mins, and 120mins). The analysis carried out at room temperature under constant speed of 1450 rpm. The wear parameters were optimized by using Taguchi’s method. During this statistical approach, L27 Orthogonal array was selected for the analysis of output. Furthermore, analysis of variance (ANOVA) was used to investigate the influence of applied load, operation time and SiC wt. % on wear behaviour. The wear resistance was analyzed by selecting “smaller is better” characteristics as the objective of the model. From this research, it is observed that experiment time and SiC wt % have the most significant effect on the wear performance followed by the applied load.

Effects of long-term AA attendance and spirituality on the course of depressive symptoms in individuals with alcohol use disorder.

Science.gov (United States)

Wilcox, Claire E; Pearson, Matthew R; Tonigan, J Scott

2015-06-01

Alcohol use disorder (AUD) is associated with depression. Although attendance at Alcoholics Anonymous (AA) meetings predicts reductions in drinking, results have been mixed about the salutary effects of AA on reducing depressive symptoms. In this single-group study, early AA affiliates (n = 253) were recruited, consented, and assessed at baseline, 3, 6, 9, 12, 18, and 24 months. Lagged growth models were used to investigate the predictive effect of AA attendance on depression, controlling for concurrent drinking and treatment attendance. Depression was measured using the Beck Depression Inventory (BDI) and was administered at baseline 3, 6, 12, 18, and 24 months. Additional predictors of depression tested included spiritual gains (Religious Background and Behavior questionnaire [RBB]) and completion of 12-step work (Alcoholics Anonymous Inventory [AAI]). Eighty-five percent of the original sample provided follow-up data at 24 months. Overall, depression decreased over the 24 month follow-up period. AA attendance predicted later reductions in depression (slope = -3.40, p = .01) even after controlling for concurrent drinking and formal treatment attendance. Finally, increased spiritual gains (RBB) also predicted later reductions in depression (slope = -0.10, p = .02) after controlling for concurrent drinking, treatment, and AA attendance. In summary, reductions in alcohol consumption partially explained decreases in depression in this sample of early AA affiliates, and other factors such as AA attendance and increased spiritual practices also accounted for reductions in depression beyond that explained by drinking. (PsycINFO Database Record (c) 2015 APA, all rights reserved).

Directional cell migration and chemotaxis in wound healing response to PDGF-AA are coordinated by the primary cilium in fibroblasts

DEFF Research Database (Denmark)

Schneider, Linda; Cammer, Michael; Lehman, Jonathan

2010-01-01

Cell motility and migration play pivotal roles in numerous physiological and pathophysiological processes including development and tissue repair. Cell migration is regulated through external stimuli such as platelet-derived growth factor-AA (PDGF-AA), a key regulator in directional cell migration....... Here we used micropipette analysis to show that a normal chemosensory response to PDGF-AA in fibroblasts requires the primary cilium. In vitro and in vivo wound healing assays revealed that in ORPK mouse (IFT88(Tg737Rpw)) fibroblasts, where ciliary assembly is defective, chemotaxis towards PDGF-AA...

Churg-Strauss syndrome associated with AA amyloidosis: a case ...

African Journals Online (AJOL)

Churg Strauss syndrome is a rare systemic and pulmonary vasculitis exceptionally associated with AA amyloidosis. We report the case of a 65-year old woman with past medical history of asthma. She developed polyarthralgia, headache and purpura. A laboratory workout found hypereosinophilia (1150/μL), positive ...

Contribution to comprehensive study of aluminium alloy Aa 5083 ...

African Journals Online (AJOL)

PROMOTING ACCESS TO AFRICAN RESEARCH ... Corrosion induced by elemental mercury in aqueous media of industrial Aluminium alloys AA5083 used in heat exchanger industries of natural gas liquefaction has been studied by linear sweep voltammétry on ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

AA, Inner Conductor of Magnetic Horn

CERN Multimedia

CERN PhotoLab

1979-01-01

Antiprotons emerging at large angles from the production target (hit by an intense 26 GeV proton beam from the PS), were focused into the acceptance of the injection line of the AA by means of a "magnetic horn" (current-sheet lens). Here we see an early protype of the horn's inner conductor, machined from solid aluminium to a thickness of less than 1 mm. The 1st version had to withstand pulses of 150 kA, 15 us long, every 2.4 s. See 8801040 for a later version.

Simultaneous determination of Cr, Ni and V in urine by electrothermal atomic absorption spectrometry (ET AAS); Determinacion simultanea de Cr, Ni y V en orina mediante et aas

Energy Technology Data Exchange (ETDEWEB)

Alvarez, Maria A.; Hermida, Jeymi [Universidad Central de Venezuela, Caracas (Venezuela, Bolivarian Republic of). Escuela de Quimica. Centro de Quimica Analitica

2011-07-01

A procedure for the simultaneous determination of Cr, Ni, and V in urine by electrothermal atomic absorption spectrometry (ET AAS) was optimized by factorial design, and performed at a pyrolysis and atomization temperatures of 1300 and 2500 deg C, respectively, using 15 {mu}g de Mg(NO{sub 3}){sub 2} as chemical modifier. Characteristics mass of 14, 6 and 220 {rho}g and detection limits of the method of 0.07, 0.38 and 0.75 {mu}g L{sup -1} were obtained for Cr, Ni and V respectively. The methodology was validated using a Liphochek Urine Metals Control sample (Bio-Rad) (P=0.05). The methodology was applied to samples of voluntary Venezuelan people, not environmentally exposed to specific emissions, and results ranging from < LOD-1.1 and 1.3-3.3 {mu}g L{sup -1} was observed for Cr and V, respectively, and not detectable levels for Ni. (author)

Photoemission spectroscopy using synchrotron radiation

International Nuclear Information System (INIS)

Kobayashi, K.L.I.

1980-01-01

It is an epoch making event for photoemission spectroscopy that the light sources of continuous wavelength from vacuum ultra-violet to X-ray region have become available by the advent of synchrotron radiation. Specifically the progress after stable intense light has become obtainable from storage rings is very significant. One of the features of these synchrotron radiation is its extreme polarization of radiating pattern. Though the elementary processes of photoemission out of solids are the basic themes, phenomenalistic 3-stage model is usually applied to the analysis of experiments. In this model, the process of photoemission is considered by dividing into three stages, namely the generation of photoelectrons due to optical transition between electron status -- the transportation of photoelectrons to solid surfaces -- breaking away from the surfaces. The spectrometers, the energy analyzers of photoelectrons, and sample-preparing room used for photoemission spectroscopy are described. Next, energy distribution curves are explained. At the end, photoelectron yield spectroscopy, CFS (constant final energy spectroscopy) and CIS (constant initial energy spectroscopy), Auger yield and interatomic Auger yield, the determination of surface structure by normal emission CIS, and surface EXAFS (extended X-ray absorption fine structure) are described. As seen above, the application specifically to surface physics is promising in the future. (Wakatsuki, Y.)

Effect of cryogenic cooling on corrosion of friction stir welded AA7010-T7651

DEFF Research Database (Denmark)

Jariyaboon, Manthana; Davenport, A. J.; Ambat, Rajan

2010-01-01

Purpose - The purpose of this paper is to study how cryogenic CO2 cooling during the welding process affects corrosion behaviour of friction stir welding (FSW) AA7010-T7651. Design/methodology/approach - Friction stir welded AA7010-17651 was produced with a rotation speed of 288 rpm and a travel...... speed of 58 mm/min. The liquid CO2 was sprayed onto the weld centre line immediately after the toolpiece. The microstructures of welds in different regions were observed using Field Emission Gun Scanning Electron Microscope (FEG-SEM). The effect on the corrosion susceptibility was investigated using...... a gel visualisation test and potentiodynamic polarisation measurements using a micro-electrochemical technique. Findings - The main corrosion region for both FSWs AA7010-T7651 produced with and without cryogenic CO2 cooling is in the HAZ region, which exhibited intergranular attack. Cryogenic cooling...

Continuous gradient temperature Raman spectroscopy of oleic and linoleic acids from -100 to 50°C

Science.gov (United States)

Gradient Temperature Raman spectroscopy (GTRS) applies the temperature gradients utilized in differential scanning calorimetry (DSC) to Raman spectroscopy, providing a straightforward technique to identify molecular rearrangements that occur near and at phase transitions. Herein we apply GTRS and DS...

Corrosion Susceptibility of AA5083-H116 in Biologically Active Atmospheric Marine Environments

Science.gov (United States)

2014-03-01

Ahn, D. J. Quesnel, S. B. Jung, "Behavior of beta phase (A13Mg2) in AA 5083 during friction stir welding ," Intermetallics 35 (2013) p. 120-127. 4. R... Metallurgy and Materials Science 43A, 13 (2012) p. 4933-4939. 7. D. Mizuno, R. G. Kelly, "Galvanically Induced Intergranular Corrosion of AA5083-H131 Under...Behavior of Al-5083," Metallurgical and Materials Transactions a-Physical Metallurgy and Materials Science 42A, 2 (2011) p. 348-355. 13. R. L. Holtz, P

Effect of the reinforced boron carbide particulate content of AA6061 alloy on formation of the passive film in seawater

International Nuclear Information System (INIS)

Katkar, V.A.; Gunasekaran, G.; Rao, A.G.; Koli, P.M.

2011-01-01

Highlights: → Presence of boron carbide increases the corrosion rate of A6061 alloy in seawater. → Increasing the B 4 C content decreases passive layer thickness. → Passive films formed on A6061 and its B 4 C composites are n-type semiconductors. - Abstract: The effect of boron carbide (B 4 C) reinforcement on the corrosion of AA6061 alloy was studied by investigating passive films formed in seawater. The higher passive current and its potential-dependence for these composites indicated formation of porous passive film. Electrochemical impedance spectroscopy (EIS) graph suggests that the alloy surface is partly or totally active. The formed passive film is n-type semiconductor junction in nature. The difference between corrosion potential (E corr ) and potential at zero charge (PZC) suggests that the chloride ions responsible for film breakdown exist within the passive film. A suitable mechanism is proposed for the passive film breakdown.

Otimização das condições de pré-redução do As(V em extratos do método BCR para quantificação de arsênio por HG-AAS Optimization of pre-reduction conditions of as(V in BCR extracts to quantify arsenic by HG-AAS

Directory of Open Access Journals (Sweden)

Eduardo Vinícius Vieira Varejão

2009-08-01

Full Text Available A determinação de As por espectrometria de absorção atômica com geração de hidretos (HG-AAS constitui um método simples, sensível, preciso e de baixo custo. Entretanto, essa técnica requer a pré-redução das espécies de As(V, o que se obtém através do uso de agentes redutores como o KI. Em extratos contendo agentes oxidantes, a pré-redução do As é comprometida, como acontece em extratos obtidos pela aplicação do método BCR (acrônimo francês para Community Bureau of Reference para a extração sequencial de As em sedimentos. O objetivo deste trabalho foi avaliar as condições de redução do As(V a As(III, de modo a permitir o uso da HG-AAS para a quantificação do arsênio em extratos obtidos a partir do método BCR. Foram avaliadas condições reacionais utilizando KI, L-cisteína e ácido ascórbico. Para cada uma das etapas de extração do método BCR, diferentes condições de pré-redução possibilitaram a detecção quantitativa do As presente. O uso do método BCR para a extração de arsênio em amostras de sedimentos contaminadas e a aplicação das condições de pré-redução do As(V selecionadas, seguida pela detecção por HG-AAS, forneceram percentagens de recuperação entre 91 e 99 %.The determination of As by hydride generation atomic absorption spectroscopy (HG-AAS is a simple, sensitive, precise and low-cost method. However, this technique requires the pre-reduction of the existing As(V species, which is obtained by the use of reducing agents such as KI. In extracts containing oxidizing agents, the pre-reduction of As is impaired, as it occurs in extracts obtained by the BCR (French acronym for Community Bureau of Reference method for the sequential extraction of As in sediments. The objective of this study was to evaluate the conditions for the reduction of As(V to As(III in a way that allows the use of HG-AAS for the quantification of arsenic in extracts obtained using the BCR method. Reaction

Rapid Identification of Bacterial Pathogens of Military Interest Using Surface-Enhanced Raman Spectroscopy

Science.gov (United States)

2014-06-11

Failloux, N., Bonnet, 1., Baron, M. H., & Perrier, E. (2003). Quantitative analysis of vitamin A degradation by raman spectroscopy. Applied Spectroscopy...analysis of the Raman-active modes of the anti-tumor agent 6- mercaptopurine . Journal of Raman Spectroscopy, 32(1), 1-8. doi: Doi 10.1002/1097- 4555

Vibrational Micro-Spectroscopy of Human Tissues Analysis: Review.

Science.gov (United States)

Bunaciu, Andrei A; Hoang, Vu Dang; Aboul-Enein, Hassan Y

2017-05-04

Vibrational spectroscopy (Infrared (IR) and Raman) and, in particular, micro-spectroscopy and micro-spectroscopic imaging have been used to characterize developmental changes in tissues, to monitor these changes in cell cultures and to detect disease and drug-induced modifications. The conventional methods for biochemical and histophatological tissue characterization necessitate complex and "time-consuming" sample manipulations and the results are rarely quantifiable. The spectroscopy of molecular vibrations using mid-IR or Raman techniques has been applied to samples of human tissue. This article reviews the application of these vibrational spectroscopic techniques for analysis of biological tissue published between 2005 and 2015.

Slot-type pickup/kicker for AA stochastic cooling

CERN Multimedia

CERN PhotoLab

1979-01-01

A "slotted transmission line" was used for both pickups and kickers of the stochastic cooling systems of the AA. They served for the cooling of the high-density antiproton stack, in momentum and both transverse planes. In the beginning in a single band, 1-2 GHz, later in 2 bands, 2-4 and 4-8 GHz. See also 7906190, 7906193.

Evaluation of sol-gel coatings modified with Al2O3 nanoparticles for the protection of AA 2024 aluminum alloy

International Nuclear Information System (INIS)

Vargas, E; Pineda, F; Sancy, M; Paez, M.A

2008-01-01

AA 2024 aluminum alloys have broad applications in the aeronautics industry, since they have an excellent mechanical resistance: weight ratio. The increased mechanical resistance of aluminum is achieved by alloying copper with other metals, as well as by submitting the material to thermal treatments. However, its heterogeneous composition and metallurgical history fosters the generation of galvanic piles that cause localized pitting and intergranular corrosion on the metallic surface in aggressive environments. Given the catastrophic corrosion of aluminum alloys used in aeronautics, the traditional methods of protection include multi-stage processes that involve anodizing, the incorporation of additives in case of water permeability and painting of the metallic piece. This is an efficient process in terms of protection but highly toxic and contaminating due to the handling of elevated concentrations of Cr 6+ . Among alternative methodologies the most outstanding are protective coatings obtained with the sol-gel technique. This type of coating, however, has drawbacks, mostly associated with its low adherence and limited mechanical properties. Considering the above, this work studied the effect of adding AI 2 0 3 to zirconium polymeric matrices, for their application as anticorrosive coatings in the protection of AA 2024 surfaces. The evaluation of the doped coatings with nanoparticles compared to those without doping was carried out using potentiodynamic polarization, electrochemical impedance spectroscopy and scanning electron microscopy. The results show that the zirconium coatings doped with a low concentration of nanoparticulated additive and submitted to a consolidation treatment at reduced pressure display a significant drop in the population of fractures, responding directly to an increase in their corrosion protection

Detection of AA-type amyloid protein in labial salivary glands.

Science.gov (United States)

Sacsaquispe, Sonia-Julia; Antúnez-de Mayolo, Eleazar-Antonio; Vicetti, Rodolfo; Delgado, Wilson-Alejandro

2011-03-01

Among the diverse forms of amyloidosis, secondary type is the most frequent one. Diagnosis of amyloid deposition is based on the identification of the fibrillary protein amyloid by means of Congo Red (CR) or crystal violet (CV) stains, but these techniques do not differentiate between the different types of amyloid fibrils. The aim of this study was to identify by immunofluorescence (IF) AA amyloid a pathological fibrillar low-molecular-weight protein formed by cleavage of serum amyloid A (SAA) protein in labial salivary gland (LSG) biopsies from patients with secondary amyloidosis. 98 LSG were studied, 65 were from patients with secondary amyloidosis and 33 from subjects with chronic inflammatory diseases without evidence of this anomaly. All sections were stained with hematoxylin and eosin (H &E), CV, CR and IF using anti-AA antibodies. Positive and negative controls were used for all techniques. CV and CR demonstrated that the amyloid substance was found mainly distributed periductally (93.8%), followed by periacinar and perivascular locations (p <0.001); however, the IF demonstrated that amyloid AA substance predominates in the periacinar area (73.8%), followed by periductal and perivascular locations (p <0.001). IF has a sensitivity of 83%, 100% of specificity, 100% of predictive positive value and 75% of predictive negative value. The results of this study confirm the efficacy of the LSG biopsy as a highly reliable method for diagnosis of secondary amyloidosis.

Interdiffusion studies on hot rolled U-10Mo/AA1050

Energy Technology Data Exchange (ETDEWEB)

Saliba-Silva, A.M.; Martins, I.C.; Carvalho, E.U.; Durazzo, M.; Riella, H.G. [Instituto de Pesquisas Energeticas e Nucleares (CCN/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Combustivel Nuclear], e-mail: saliba@ipen.br

2010-07-01

The U-Mo alloys are investigated with the goal of becoming nuclear material to fabricate high-density fuel elements for high performance research reactors. This enrichment level suggests that the U-Mo alloys should be between 6 to 10wt%, which can give up to 9gU/cm{sup 3} as fuel density. Nevertheless, the U-Mo alloys are very reactive with Al. Interdiffusion reaction products are formed since nuclear fission promotes chemical interaction layer during operation, leading to potential structural failure. Present studies were made with treated hot rolled diffusion couples of U-10Mo inserted in Al (AA1050). The U-10Mo/AA1050 pairs were treated in two temperature (150 degree C and 550 degree C) with three soaking times (5h, 40h and 80h). From microstructure analyses, rapid diffusion of Al happened inside U-10Mo in the first heating at 540 degree C during 15 min, reaching 8 at%Al in a range of 200 {mu}m towards U-10Mo. Longer time (5, 40, 80h) at 550 degree C maintain this level of Al-content up to 1000 {mu}m inside U-10Mo. A minor depth ({approx}1 {mu}m) near the interdiffusion contact had higher Al-content, but not sufficient to form identifiable (U,Mo)Al{sub x} structures. Probably, residual elements reduced drastically the interdiffusion phenomena between U-10Mo and AA1050, maybe due to silicon presence. (author)

The development of photoemission spectroscopy and its application to the study of semiconductor interfaces Observations on the interplay between basic and applied research (Welch Memorial Lecture)

Science.gov (United States)

Spicer, W. E.

1985-01-01

A sketch is given of the development of photoemission electron spectroscopy (PES) with emphasis on the author's own experience. Emphasis is placed: (1) on the period between 1958-1970; (2) on the various developments which were required for PES to emerge; and (3) on the strong interactions between applied/fundamental and knowledge/empirically based research. A more detailed discussion is given of the recent (1975-present) application of PES to study the interfaces of III-V semiconductors.

Study of microstructure of modified polyethylene films with acrylic and methacrylic acids, by positron annihilation spectroscopy

International Nuclear Information System (INIS)

Lopez C, R.

1995-09-01

Low density polyethylene (LDPE) was preirradiated with γ -rays and after some contact time with the monomers AA and MAA, suitable graft copolymers were obtained at different grafting grades. After their physical-chemistry characterization, the copolymers were studied using the Positron Annihilation Lifetime Spectroscopy (PALS). Owing to its sensitive and non-destructive nature PALS has proven to be very useful in studying free-volume properties -at the molecular level- during phase transitions in molecular solids, such as the graft copolymers of LDPE/AA and LDPE/MAA. Using PALS it was possible to detect the changes in the melting point of the LDPE as a function of the grafting degree, obtaining thus, valuable information about the microstructure of this kind of copolymers. The increase in the values of the o-Ps lifetime, was interpreted as suggesting that the melting transition is followed by a free-volume cavity expansion as the temperature increased. The o-Ps intensity of formation behavior is in accord with the distortions occurring in the electronic density surrounding the o-Ps as well as the changes in the number of cavities available to the formation of o-Ps. (Author)

Electron spin resonance (ESR) spectroscopy applied to radiation dosimetry and other fields

International Nuclear Information System (INIS)

Schneider, C.C.J.

1994-12-01

A short introduction to the theory and practice of ESR spectroscopy is given. ESR alanine dosimetry for low and high LET (linear energy transfer) ionising radiation is described, indicating its advantages over traditional methods. Problems arising in the therapy dose range (below 5 Gy), and possible future developments, are mentioned. The application of ESR to the radiation processing of materials and foodstuffs, to geological dating, biology, molecular chemistry and to medicine is discussed. Some examples of chemical analyses are also presented. (orig.)

Raman spectroscopy of optical properties in CdS thin films

Directory of Open Access Journals (Sweden)

Trajić J.

2015-01-01

Full Text Available Properties of CdS thin films were investigated applying atomic force microscopy (AFM and Raman spectroscopy. CdS thin films were prepared by using thermal evaporation technique under base pressure 2 x 10-5 torr. The quality of these films was investigated by AFM spectroscopy. We apply Raman scattering to investigate optical properties of CdS thin films, and reveal existence of surface optical phonon (SOP mode at 297 cm-1. Effective permittivity of mixture were modeled by Maxwell - Garnet approximation. [Projekat Ministarstva nauke Republike Srbije, br. 45003

Two distinct clinical courses of renal involvement in rheumatoid patients with AA amyloidosis.

Science.gov (United States)

Uda, Hiroshi; Yokota, Akira; Kobayashi, Kumiko; Miyake, Tadao; Fushimi, Hiroaki; Maeda, Akira; Saiki, Osamu

2006-08-01

We conducted a prospective study to investigate whether a correlation exists between the clinical course of renal involvement and the pathological findings of renal amyloidosis in patients with rheumatoid arthritis (RA). Patients with RA of more than 5 years' duration and who did not show renal manifestations were selected and received a duodenal biopsy for the diagnosis of amyloidosis. After the diagnosis of AA amyloidosis, patients received a renal biopsy, and patterns of amyloid deposition were examined. We followed the renal functions (serum levels of blood urea nitrogen and creatinine) of patients diagnosed with AA amyloidosis for 5 years. We diagnosed 53 patients with AA amyloidosis and monitored the renal function of 38 of them for > 5 years. The histological patterns were examined; in the 38 patients there were appreciable variations in the patterns of amyloid deposition. In 27 patients, amyloid deposits were found exclusively in the glomerulus (type 1). In the other 11 patients, however, amyloid deposits were found selectively around blood vessels and were totally absent in the glomerulus (type 2). In type 1 patients with glomerular involvement, renal function deteriorated rapidly regardless of disease state; most patients received hemodialysis. In type 2 patients with purely vascular involvement, however, renal function did not deteriorate significantly. In patients with RA and AA amyloidosis, 2 distinct clinical courses in terms of renal involvement were identified. It is suggested that renal function does not deteriorate when amyloid deposition is totally lacking in the glomerulus.

Comparative haematological parameters of HbAA and HbAS genotype children infected with Plasmodium falciparum malaria in Yemen.

Science.gov (United States)

Albiti, Anisa H; Nsiah, Kwabena

2014-04-01

Sickle haemoglobin (HbS) is known to offer considerable protection against falciparum malaria. However, the mechanism of protection is not yet completely understood. In this study, we investigate how the presence of the sickle cell trait affects the haematological profile of AS persons with malaria, in comparison with similarly infected persons with HbAA. This study is based on the hypothesis that the sickle cell trait plays a protective role against malaria. Children from an endemic malaria transmission area in Yemen were enrolled in this study. Hematological parameters were estimated using manual methods, the percentage of parasite density on stained thin smear was calculated, haemoglobin genotypes were determined on paper electrophoresis, ferritin was measured using enzyme-linked immunosorbent assay, serum iron and TIBC were assayed using spectrophotometer, transferrin saturation index was calculated by dividing serum iron by TIBC and expressing the result as a percentage. Haematological parameters were compared in HbAA- and HbAS-infected children. Falciparum malaria parasitaemia was confirmed in the blood smears of 62 children, 44 (55.7%) of AA and 18 (37.5%) AS, so there was higher prevalence in HbAA children (P = 0.047). Parasite density was lower in HbAS- than HbAA-infected children (P = 0.003). Anaemia was prominent in malaria-infected children, with high proportions of moderate and severe forms in HbAA (P = 0.001). The mean levels of haemoglobin, packed cell volume, reticulocyte count, platelets count, lymphocytes, eosinophils, and serum iron were significantly lower while total leukocytes, immature granulocytes, monocytes, erythrocyte sedimentation rate, transferrin saturation, and serum ferritin were significantly higher in HbAA-infected children than HbAS-infected children. Infection with Plasmodium falciparum malaria caused more significant haematological alterations of HbAA children than HbAS. This study supports the observation that sickle cell trait

(e,2e) spectroscopy: from atoms to solids

Energy Technology Data Exchange (ETDEWEB)

Vos, M.; McCarthy, I.E.

1994-11-01

This paper describes briefly the theory of (e,2e) of atoms and molecules. Subsequently, introduces a simple model for a one-dimensional crystal. The (e,2e) spectra is calculated as would be measured for this hypothetical case, and use this model to make a link between (e,2e) spectroscopy as applied to atoms and molecules and this technique as applied to solids. Slight modifications of the model allow for the simulation of the effects of different band-structures on the (e,2e) spectra. Special attention is paid to the difference in the type of information obtained from (e,2e) spectroscopy and that obtained from angular resolved photo emission. 19 refs., 9 figs.

Analysis of ethyl acrylate (EA) and acrylic acid (AA) residues from rat tissues following oral ea dosing

International Nuclear Information System (INIS)

Udinsky, J.R.; Frederick, C.B.

1990-01-01

Gavage dosing of rats with EA at high dose levels (100 or 200 mg/kg) has resulted in tumors at the dosing site, forestomach (FST), but no lesions of the glandular stomach (GST) or other remote tissues. Since previous in vitro studies have demonstrated that EA is very rapidly metabolized to AA and glutathione conjugates, EA and AA residues were analyzed 0-24 hr following gavage dosing of non-fasted F-344/N male rats with [1- 14 C]EA in corn oil at 10, 50, and 200 mg/kg. Analysis of total 14 C indicated that the dose solution was primarily in the FST at ≥5 min after dosing, although 14 C was detected in the GST, duodenum, and small intestine (attributed to distension of the FST and leakage from the FST to the GST). HPLC analysis of the gut contents, gut wall, liver, kidneys, lungs, and blood indicated that EA and AA could only be detected at ≥15 min in the FST and GST contents, and in the FST tissue. AA alone was detected in the GST tissue, duodenum tissue and contents, and small intestine tissue and contents. The minimum level of detection was 0.0005% of the dose. The remaining 14 C was primarily attributed to binding to the gut contents or bioincorporation of AA. The detection of EA and AA residues only in the upper gastrointestinal tract following gavage dosing is consistent with rapid detoxification of EA by hydrolysis and conjugation which prevents toxicity at sites remote form the site of dosing

Double pulse laser induced breakdown spectroscopy applied to natural and artificial materials from cultural heritages

International Nuclear Information System (INIS)

Brai, Maria; Gennaro, Gaetano; Schillaci, Tiziano; Tranchina, Luigi

2009-01-01

The laser-induced breakdown spectroscopy (LIBS) is an applied physical technique that has shown in recent years its great potential for rapid qualitative analysis of materials. Thanks to the possibility to implement a portable instrument that perform LIBS analysis, this technique is revealed to be particularly useful for in situ analysis in the field of cultural heritages. The purpose of this work is to evaluate the potentiality of LIBS technique in the field of cultural heritages, with respect to the chemical characterization of complex matrix as calcareous and refractory materials for further quantitative analyses on cultural heritages. X-Ray Fluorescence (XRF) analyses were used as reference. Calibration curves of certified materials used as standards were obtained by XRF analyses. The LIBS measurements were performed with a new mobile instrument called Modi (Mobile Double pulse Instrument for LIBS Analysis). The XRF analyses were performed with a portable instrument ArtTAX. LIBS and XRF measurement were performed on both reference materials and samples (bricks and mortars) sampled in the ancient Greek-Roman Theatre of Taormina. Although LIBS measurements performed on reference materials have shown non linear response to concentrations, and so we were not able to obtain quantitative results, an integrated study of XRF and LIBS signals permitted us to distinguish among chemical features and degradation state of measured building materials.

Double pulse laser induced breakdown spectroscopy applied to natural and artificial materials from cultural heritages

Energy Technology Data Exchange (ETDEWEB)

Brai, Maria; Gennaro, Gaetano [Dipartimento di Fisica e Tecnologie Relative, Universita di Palermo, Viale delle Scienze Ed.18, 90128 Palermo (Italy); Schillaci, Tiziano, E-mail: tschillaci@unipa.i [Dipartimento di Fisica e Tecnologie Relative, Universita di Palermo, Viale delle Scienze Ed.18, 90128 Palermo (Italy); Tranchina, Luigi [Dipartimento di Fisica e Tecnologie Relative, Universita di Palermo, Viale delle Scienze Ed.18, 90128 Palermo (Italy)

2009-10-15

The laser-induced breakdown spectroscopy (LIBS) is an applied physical technique that has shown in recent years its great potential for rapid qualitative analysis of materials. Thanks to the possibility to implement a portable instrument that perform LIBS analysis, this technique is revealed to be particularly useful for in situ analysis in the field of cultural heritages. The purpose of this work is to evaluate the potentiality of LIBS technique in the field of cultural heritages, with respect to the chemical characterization of complex matrix as calcareous and refractory materials for further quantitative analyses on cultural heritages. X-Ray Fluorescence (XRF) analyses were used as reference. Calibration curves of certified materials used as standards were obtained by XRF analyses. The LIBS measurements were performed with a new mobile instrument called Modi (Mobile Double pulse Instrument for LIBS Analysis). The XRF analyses were performed with a portable instrument ArtTAX. LIBS and XRF measurement were performed on both reference materials and samples (bricks and mortars) sampled in the ancient Greek-Roman Theatre of Taormina. Although LIBS measurements performed on reference materials have shown non linear response to concentrations, and so we were not able to obtain quantitative results, an integrated study of XRF and LIBS signals permitted us to distinguish among chemical features and degradation state of measured building materials.

NCBI nr-aa BLAST: CBRC-MDOM-08-0245 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MDOM-08-0245 ref|YP_045158.1| putative fimbrial usher protein [Acinetobacter s...p. ADP1] gb|AAS90700.1| AcuC [Acinetobacter sp. BD413] emb|CAG67336.1| protein AcuC; putative fimbrial usher protein [Acinetobacter sp. ADP1] YP_045158.1 0.47 32% ...

NCBI nr-aa BLAST: CBRC-TBEL-01-0397 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-TBEL-01-0397 ref|YP_005572.1| competence factor comEC [Thermus thermophilus HB...27] gb|AAG34707.1|AF319938_2 competence factor ComEC [Thermus thermophilus] gb|AAS81945.1| competence factor comEC [Thermus thermophilus HB27] YP_005572.1 0.10 31% ...

Work capacity and anticipation in A.A. Ukhtomsky's concept of dominance

Science.gov (United States)

Pavlova, L. P.

2015-08-01

This paper presents the results of theoretical and experimental investigations of human activity and anticipation based on A.A. Ukhtomsky's concept of brain dominance - a non-equilibrium system-forming factor in living systems. Facts on the stages of dominance formation are presented in relation to the creative abilities of the human brain and the role of fatigue as a "lever" for increasing systems' work capacity on the basis of "trace exaltation". Individually, specific features of dominantogenesis are compared with variations in behavioural types. On the basis of chronotopic EEG analysis, we delineate cortical dominants that underlie individual specifics of cognitive processes. The relation is shown between anticipation and the "expansion of dominants" - the broadening of "distal perception" in time and space, as framed by A.A. Ukhtomsky.

Volta potential of clad AA2024 aluminium after exposure to CeCl3 solution

International Nuclear Information System (INIS)

Andreatta, F.; Druart, M.-E.; Marin, E.; Cossement, D.; Olivier, M.-G.; Fedrizzi, L.

2014-01-01

Highlights: • Alkaline etch of clad AA2024 enhances precipitation of Ce compounds. • Exposure to CeCl 3 solution decreases Volta potential of alkaline etched substrate. • Ce compounds reduce the driving force for initiation of localized attack. - Abstract: AA2024 clad with AA1050 was immersed in CeCl 3 solution to promote deposition of cerium species. The deposition occurs on the entire sample surface for the alkaline etched substrate, while it is very limited for the degreased substrate. The surface potential (Volta potential) was investigated by scanning Kelvin probe force microscopy after different immersion times in CeCl 3 solution. The preferential deposition of Ce compounds at Al–Fe intermetallic sites progressively reduces their Volta potential difference relative to the matrix in the alkaline etched substrate. This reduces the susceptibility to localized attack of the intermetallics as proven by potentiodynamic polarization measurements

A.A. BRUSILOV - FULL GENERAL OF RUSSIAN ARMY AND LAST COMMANDER OF RUSSIAN TSAR

Directory of Open Access Journals (Sweden)

Сергей Сергеевич Синютин

2014-12-01

Full Text Available The article analyzes the biography of Russian full general A.A. Brusilov − the hero of World War I, whose name is associated with the term “Brusilov Offensive”. The author exa-mines his views on the new situation which developed in Russia during the two revolutions of 1917, and then in the Soviet period. The author highly appreciates the theoretical preparation level of A.A. Brusilov, who got full military education in tsarist Russia; reveals the pre-sence of numerous analogous episodes in the biographies of A.A. Brusilov and A.V. Suvorov. He focuses on the similar origin of two Russian heroes, whose families belonged to the military dynasties of imperial Russia. The author concludes that the continuity of generations is very important in the issue of effective army’s functioning. This tradition was preserved in the new Soviet state.

Construction and characterization of the interdomain chimeras using Cry11Aa and Cry11Ba from Bacillus thuringiensis and identification of a possible novel toxic chimera.

Science.gov (United States)

Sun, Yunjun; Zhao, Qiang; Zheng, Dasheng; Ding, Xuezhi; Wang, Jingfang; Hu, Quanfang; Yuan, Zhiming; Park, Hyun-Woo; Xia, Liqiu

2014-01-01

Three structural domains of mosquitocidal Cry11Aa and Cry11Ba from Bacillus thuringiensis were exchanged to produce interdomain chimeras [BAA (11Ba/11Aa/11Aa), ABA (11Aa/11Ba/11Aa), AAB (11Aa/11Aa/11Ba), ABB (11Aa/11Ba/11Ba), BAB (11Ba/11Aa/11Ba), BBA (11Ba/11Ba/11Aa]. Chimeras BAB, BAA, BBA, and AAB formed inclusion bodies in the crystal-negative B. thuringiensis host and produced expected protein bands on SDS-PAGE gel. However, no inclusion body or target protein could be found for chimeras ABA and ABB. In bioassays using the fourth-instar larvae of Culex quinquefasciatus and Aedes aegypti, AAB had ~50 % lethal concentrations of 4.8 and 2.2 μg ml(-1), respectively; however, the rest of chimeras were not toxic. This study thus helps to understand the domain-function relationships of the Cry11Aa and Cry11Ba toxins. The toxic chimera, AAB, might be a candidate for mosquito control as its amino acid sequence is different from the two parental toxins.

Time-resolved photoelectron spectroscopy and ab initio multiple spawning studies of hexamethylcyclopentadiene

DEFF Research Database (Denmark)

Wolf, T. J. A.; Kuhlman, Thomas Scheby; Schalk, O.

2014-01-01

Time-resolved photoelectron spectroscopy and ab initio multiple spawning were applied to the ultrafast non-adiabatic dynamics of hexamethylcyclopentadiene. The high level of agreement between experiment and theory associates wavepacket motion with a distinct degree of freedom.......Time-resolved photoelectron spectroscopy and ab initio multiple spawning were applied to the ultrafast non-adiabatic dynamics of hexamethylcyclopentadiene. The high level of agreement between experiment and theory associates wavepacket motion with a distinct degree of freedom....

Microstructural evolution and mechanical properties of as-cast and T6-treated AA2195 DC cast alloy

International Nuclear Information System (INIS)

Hekmat-Ardakan, A.; Elgallad, E.M.; Ajersch, F.; Chen, X.-G.

2012-01-01

The use of direct chill (DC) cast ingot plates of AA2195 alloys has been recently extended for large mold applications in the plastics and automotive industries. The microstructural evolution of the as-cast AA2195 alloy was investigated using the Factsage thermodynamic software under both equilibrium and non-equilibrium conditions, and was compared with the results from differential scanning calorimetry (DSC) analysis and microstructural observations. The as-cast microstructure exhibited the presence of Al 2 CuMg, Al 2 Cu and Al 2 CuLi intermetallic phases formed at the aluminum dendrite boundaries, which can be completely dissolved in the α-Al matrix during the solution treatment. A significant improvement in the mechanical properties of the AA2195 cast alloy after the T6 heat treatment is attributed to the formation of nano-scale θ′ (Al 2 Cu) and T1 (Al 2 CuLi) precipitates. However, the non-uniform distribution of T1 precipitates together with the large size and low density indicate that the role of θ′ precipitates in strengthening the AA2195 cast alloy is more dominant than that of the T1 precipitates, in contrast with the strengthening mechanism of the pre-deformed AA2195-T8 rolled products.

Current Trends in Atomic Spectroscopy.

Science.gov (United States)

Wynne, James J.

1983-01-01

Atomic spectroscopy is the study of atoms/ions through their interaction with electromagnetic radiation, in particular, interactions in which radiation is absorbed or emitted with an internal rearrangement of the atom's electrons. Discusses nature of this field, its status and future, and how it is applied to other areas of physics. (JN)

The AAS Taskforce on Diversity and Inclusion in Graduate Education: a Proposed White Paper

Science.gov (United States)

Rudolph, Alexander L.

2018-06-01

At the January 2017 AAS meeting in Texas, the AAS Council approved the creation of a Graduate Education Taskforce focusing on Diversity and Inclusion. This task force is conducting a review of practices in recruiting, admissions, and retention in PhD programs in astronomy (including astronomy programs in departments of physics and astronomy). It is also engaging the broader astronomical community and selected outside experts in diversity in STEM in a discussion of best practices in these activities, with the goal of promoting diversity (race/ethnicity, gender, LGBTQ+, disability status, etc.) and inclusion in astronomy PhD programs. Building on the Nashville Recommendations from the Inclusive Astronomy 2015 meeting, the task force is developing a set of specific recommendations with the aim of endorsement by the AAS, in parallel with a campaign to get them adopted by astronomy departments. Finally, the task force will suggest and push adoption of a set of permanent measurements to be collected by the AAS to track progress on these goals. There is a separate special session at this meeting intended to report on the task force’s progress and to solicit community input on its draft recommendations to date.This presentation will give a brief overview of the task force's charge and activities and their plans to turn their final report into a White Paper for the Decadal Survey.

Electrochemical profiling of multi-clad aluminium sheets used in automotive heat exchangers

DEFF Research Database (Denmark)

Bordo, Kirill; C. Gudla, Visweswara; Peguet, Lionel

2018-01-01

A combination of glow discharge optical emission spectroscopy sputtering and local electrochemical measurements was used to determine electrochemical changes upon brazing in a multi-layered Aluminium sheet (AA4343/AA3xxx/AA4343) with an additional low-Cu (AA3xxx) interlayer. Ecorr values from pot...

Studies of the AA2519 Alloy Hot Rolling Process and Cladding with EN AW-1050A Alloy

Directory of Open Access Journals (Sweden)

Płonka B.

2016-03-01

Full Text Available The objective of the study was to determine the feasibility of plastic forming by hot rolling of the AA2519 aluminium alloy sheets and cladding these sheets with a layer of the EN AW-1050A alloy. Numerous hot-rolling tests were carried out on the slab ingots to define the parameters of the AA2519 alloy rolling process. It has been established that rolling of the AA2519 alloy should be carried out in the temperature range of 400-440°C. Depending on the required final thickness of the sheet metal, appropriate thickness of the EN AW-1050A alloy sheet, used as a cladding layer, was selected. As a next step, structure and mechanical properties of the resulting AA2519 alloy sheets clad with EN AW-1050A alloy was examined. The thickness of the coating layer was established at 0,3÷0,5mm. Studies covered alloy grain size and the core alloy-cladding material bond strength.

Role of N-Arachidonoyl-Serotonin (AA-5-HT in Sleep-Wake Cycle Architecture, Sleep Homeostasis, and Neurotransmitters Regulation

Directory of Open Access Journals (Sweden)

Eric Murillo-Rodríguez

2017-05-01

Full Text Available The endocannabinoid system comprises several molecular entities such as endogenous ligands [anandamide (AEA and 2-arachidonoylglycerol (2-AG], receptors (CB1 and CB2, enzymes such as [fatty acid amide hydrolase (FAHH and monoacylglycerol lipase (MAGL], as well as the anandamide membrane transporter. Although the role of this complex neurobiological system in the sleep–wake cycle modulation has been studied, the contribution of the blocker of FAAH/transient receptor potential cation channel subfamily V member 1 (TRPV1, N-arachidonoyl-serotonin (AA-5-HT in sleep has not been investigated. Thus, in the present study, varying doses of AA-5-HT (5, 10, or 20 mg/Kg, i.p. injected at the beginning of the lights-on period of rats, caused no statistical changes in sleep patterns. However, similar pharmacological treatment given to animals at the beginning of the dark period decreased wakefulness (W and increased slow wave sleep (SWS as well as rapid eye movement sleep (REMS. Power spectra analysis of states of vigilance showed that injection of AA-5-HT during the lights-off period diminished alpha spectrum across alertness in a dose-dependent fashion. In opposition, delta power spectra was enhanced as well as theta spectrum, during SWS and REMS, respectively. Moreover, the highest dose of AA-5-HT decreased wake-related contents of neurotransmitters such as dopamine (DA, norepinephrine (NE, epinephrine (EP, serotonin (5-HT whereas the levels of adenosine (AD were enhanced. In addition, the sleep-inducing properties of AA-5-HT were confirmed since this compound blocked the increase in W caused by stimulants such as cannabidiol (CBD or modafinil (MOD during the lights-on period. Additionally, administration of AA-5-HT also prevented the enhancement in contents of DA, NE, EP, 5-HT and AD after CBD of MOD injection. Lastly, the role of AA-5-HT in sleep homeostasis was tested in animals that received either CBD or MOD after total sleep deprivation (TSD. The

Three body abrasion of laser surface alloyed aluminium AA1200

CSIR Research Space (South Africa)

Mabhali, Luyolo AB

2012-06-01

Full Text Available Laser surface alloying of aluminium AA1200 was performed with a 4 kW Nd:YAG laser to improve the abrasion wear resistance. Aluminium surfaces reinforced with metal matrix composites and intermetallic phases were achieved. The phases present depended...

Molecular spectroscopy in biodiagnostics (from Hippocrates to Herschel and beyond)

Science.gov (United States)

Mantsch, Henry; Jackson, Michael

1995-03-01

After two decades of intense research on the spectroscopic properties of biological molecules in isolated systems, infrared spectroscopy is now being applied to the study of human tissues. Extending this approach, it is possible to use the sensitivity of infrared spectroscopy to probe the biochemical events underlying transformation from normal to a diseased state within tissues, and so develop novel diagnostic methods. We highlight some of the areas of research within our group aimed at developing clinically useful methodologies based upon infrared spectroscopy.

Encapsulated oligodendrocyte precursor cell fate is dependent on PDGF-AA release kinetics in a 3D microparticle-hydrogel drug delivery system.

Science.gov (United States)

Pinezich, Meghan R; Russell, Lauren N; Murphy, Nicholas P; Lampe, Kyle J

2018-04-16

Biomaterial drug delivery systems (DDS) can be used to regulate growth factor release and combat the limited intrinsic regeneration capabilities of central nervous system (CNS) tissue following injury and disease. Of particular interest are systems that aid in oligodendrocyte regeneration, as oligodendrocytes generate myelin which surrounds neuronal axons and helps transmit signals throughout the CNS. Oligodendrocyte precursor cells (OPCs) are found in small numbers in the adult CNS, but are unable to effectively differentiate following CNS injury. Delivery of signaling molecules can initiate a favorable OPC response, such as proliferation or differentiation. Here, we investigate the delivery of one such molecule, platelet derived growth factor-AA (PDGF-AA), from poly(lactic-co-glycolic) acid microparticles to OPCs in a 3D polyethylene glycol-based hydrogel. The goal of this DDS was to better understand the relationship between PDGF-AA release kinetics and OPC fate. The system approximates native brain tissue stiffness, while incorporating PDGF-AA under seven different delivery scenarios. Within this DDS, supply of PDGF-AA followed by PDGF-AA withdrawal caused OPCs to upregulate gene expression of myelin basic protein (MBP) by factors of 1.6-9.2, whereas continuous supply of PDGF-AA caused OPCs to remain proliferative. At the protein expression level, we observed an upregulation in O1, a marker for mature oligodendrocytes. Together, these results show that burst release followed by withdrawal of PDGF-AA from a hydrogel DDS stimulates survival, proliferation, and differentiation of OPCs in vitro. Our results could inform the development of improved neural regeneration strategies that incorporate delivery of PDGF-AA to the injured CNS. © 2018 Wiley Periodicals, Inc. J Biomed Mater Res Part A, 2018. © 2018 Wiley Periodicals, Inc.

Hard X-ray photoemission spectroscopy

International Nuclear Information System (INIS)

Kobayashi, Keisuke

2009-01-01

Except in the very early stage of the development of X-ray photoemission spectroscopy (XPS) by Kai Siegbahn and his coworkers, the excitation sources for XPS studies have predominantly been the Al Kα and Mg Kα emission lines. The advent of synchrotron radiation sources opened up the possibility of tuning the excitation photon energy with much higher throughputs for photoemission spectroscopy, however the excitation energy range was limited to the vacuum ultra violet and soft X-ray regions. Over the past 5-6 years, bulk-sensitive hard X-ray photoemission spectroscopy using high-brilliance high-flux X-rays from third generation synchrotron radiation facilities has been developed. This article reviews the history of HXPES covering the period from Kai Siegbahn and his coworkers' pioneering works to the present, and describes the fundamental aspects, instrumentation, applications to solid state physics, applied physics, materials science, and industrial applications of HXPES. Finally, several challenging new developments which have been conducted at SPring-8 by collaborations among several groups are introduced.

Larvicidal activity of Bacillus thuringiensis var. israelensis Cry11Aa toxin against Haemonchus contortus.

Science.gov (United States)

DE Lara, Ana Paula DE Souza Stori; Lorenzon, Lucas Bigolin; Vianna, Ana Muñoz; Santos, Francisco Denis Souza; Pinto, Luciano Silva; Aires Berne, Maria Elisabeth; Leite, Fábio Pereira Leivas

2016-10-01

Effective control of gastrointestinal parasites is necessary in sheep production. The development of anthelmintics resistance is causing the available chemically based anthelmintics to become less effective. Biological control strategies present an alternative to this problem. In the current study, we tested the larvicidal effects of Bacillus thuringiensis var. israelensis Cry11Aa toxin against Haemonchus contortus larvae. Bacterial suspensions [2 × 108 colony-forming units (CFU) g-1 of the feces] of B. thuringiensis var. israelensis and recombinant Escherichia coli expressing Cry11Aa toxin were added to naturally H. contortus egg-contaminated feces. The larvae were quantified, and significant reductions of 62 and 81% (P var. israelensis and recombinant E. coli expressing Cry11Aa toxin were then orally administered to lambs naturally infected with H. contortus. Twelve hours after administration, feces were collected and submitted to coprocultures. Significant larvae reductions (P var. israelensis is a promising new class of biological anthelmintics for treating sheep against H. contortus.

Muon level crossing resonance spectroscopy applied to free-radical formation

International Nuclear Information System (INIS)

Venkateswaran, K.; Barnabas, M.V.; Walker, D.C.

1989-01-01

Muon Level Crossing Resonance Spectroscopy has been used to explore two aspects of muonium chemistry: unique free radicals and muonated radical yields. (1) A variety of new free-radicals have been seen by LCR. For instance, in thioacetamide the only radical produced from muonium is the S sm-bullet radical formed when Mu adds to the C of the C=S bond. In allylbenzene a whole range of radicals form with substantial yields (two side-chain and three ring additions); whereas in styrene, 85% of the radicals have Mu bonded to the end C of the side-chain and there is no meta-adduct at all. (2) Absolute yields of the radicals formed by interaction of muonium atoms in water with acrylamide as a solute (and with benzene in n-hexane) have shown that all muons not directly incorporated into diamagnetic molecules (such as MuH) appear as muonated free radicals. i.e. the missing fraction is found

NMR spectroscopy

International Nuclear Information System (INIS)

Gruenert, J.

1989-01-01

The book reviews the applications of NMR-spectroscopy in medicine and biology. The first chapter of about 40 pages summarizes the history of development and explains the chemical and physical fundamentals of this new and non-invasive method in an easily comprehensible manner. The other chapters summarize diagnostic results obtained with this method in organs and tissues, so that the reader will find a systematic overview of the available findings obtained in the various organ systems. It must be noted, however, that ongoing research work and new insight quite naturally will necessitate corrections to be done, as is the case here with some biochemical interpretations which would need adjustment to latest research results. NMR-spectroscopy is able to measure very fine energy differences on the molecular level, and thus offers insight into metabolic processes, with the advantage that there is no need of applying ionizing radiation in order to qualitatively or quantitatively analyse the metabolic processes in the various organ systems. (orig./DG) With 40 figs., 4 tabs [de

The influence of strain on annealing behaviour of heavily rolled aluminium AA1050

DEFF Research Database (Denmark)

Mishin, Oleg; Juul Jensen, Dorte; Hansen, Niels

2012-01-01

Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened microstru......Deformation structures and annealing behaviour have been analysed in the centre layer of two AA1050 samples cold-rolled to von Mises strains of 3.6 and 6.4. During annealing at 270-300°C structural coarsening and discontinuous recrystallization occurred in both samples. In the coarsened...

The effect of tensioning and sectioning on residual stresses in aluminium AA7749 friction stir welds

International Nuclear Information System (INIS)

Altenkirch, J.; Steuwer, A.; Peel, M.; Richards, D.G.; Withers, P.J.

2008-01-01

Using synchrotron X-ray diffraction the residual stress distribution has been measured in a series of AA7449-W51 aluminium friction stir welds that had been tensioned to different loads during welding. By modifying the stress accumulation path, the application of a tensioning stress has reduced the tensile magnitude of the final residual weld stresses. In the present case the residual stresses were minimised when the applied load is ∼35% of the room temperature yield stress of the parent material. Subsequent sectioning of the weld into shorter test lengths, as might be necessary for weld testing, resulted in a progressive and significant relaxation of the residual stress field. The effect of tensioning on the weld component distortion also has been investigated

AAS and spectrophotometric determination of propranolol HCl and metoprolol tartrate.

Science.gov (United States)

El-Ries, M A; Abou Attia, F M; Ibrahim, S A

2000-12-15

Two simple and accurate spectrophotometric methods are described for the determination of propranolol hydrochloride (I) and metoprolol tartrate (II). The methods are based on the reaction of each drug as a secondary amine: (a) with carbon disulphide, the formed complex extracted into iso-butyl methyl ketone (IBMK) after chelation with Cu(II) ions at pH 7.5, followed by measuring the absorbance at 435.4 nm or indirectly for the drug by flame atomic absorption spectrophotometry (AAS). The calibration graph is linear up to 40 and 60 microg ml(-1) with apparent molar absorptivities of 6.89 x 10(3) and 1.08 x 104 l mol(-1) cm(-1) and correlation coefficients of 0.9994 and 0.9995 for propranolol and metoprolol, respectively; (b) with pi-acceptors, tetracyanoethylene (TCNE), or chloranilic acid (CLA) to give highly coloured complex species. The coloured products are quantitated spectrophotometrically at 415 or 510 nm for the two drugs with TCNE and CLA, respectively, and obey Beer's Law with RSD less than 2.0. The methods were applied to the determination of these drugs in pharmaceutical preparation without interferences.