
Sample records for spacelab japan slj

  1. STS-47 Mission Specialist (MS) Jemison conducts AFTE in SLJ module on OV-105


    STS-47 Mission Specialist (MS) Mae C. Jemison, wearing autogenic feedback training system 2 suit, conducts the Autogenic Feedback Training Experiment (AFTE) in Spacelab Japan (SLJ) science module aboard Endeavour, Orbiter Vehicle (OV) 105. AFTE's objective is to teach astronauts to use biofeedback rather than drugs to combat nausea and other effects of space motion sickness. Jemison's physical responses are monitored by sensors attached to the suit.

  2. STS-47 Payload Specialist Mohri tosses an apple during SLJ demonstration


    STS-47 Payload Specialist Mamoru Mohri tosses an apple in the weightless environment of the Spacelab Japan (SLJ) science module aboard the Earth-orbitng Endeavour, Orbiter Vehicle (OV) 105. Mohri was handling the space end of a space-to-Earth youth Conference with students in his home country (Japan) in which he gave a brief demonstration on the specifics of his mission as well as general information on space travel and space physics. Mohri conducts his demonstration in front of the NASDA Material Sciences Rack 10. In the background is the SLJ end cone with Detailed Test Objective (DTO), Foot restraint evaluation, base plate, a banner from Auburn University, and portraits of the backup payload specialists. Mohri represents Japan's National Space Development Agency (NASDA).

  3. STS-47 MS Jemison trains in SLJ module at MSFC Payload Crew Training Complex


    STS-47 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist (MS) Mae C. Jemison, wearing Autogenic Feedback Training System 2 suit, works with the Frog Embryology Experiment in a General Purpose Workstation (GPWS) in the Spacelab Japan (SLJ) module mockup at the Payload Crew Training Complex. The experiment will study the effects of weightlessness on the development of frog eggs fertilized in space. The Payload Crew Training Complex is located at the Marshall Space Flight Center (MSFC) in Huntsville, Alabama. View provided with alternate number 92P-139.

  4. Dicty_cDB: SLJ344 [Dicty_cDB

    Full Text Available SL (Link to library) SLJ344 (Link to dictyBase) - - - Contig-U16255-1 SLJ344P (Link... to Original site) SLJ344F 253 SLJ344Z 273 SLJ344P 526 - - Show SLJ344 Library SL (Link to library) Clone ID SLJ344 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16255-1 Original site URL http://dict...Amino Acid sequence GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT tilffniqrlykkkkkkkkkknkp*tklkin*kk Frame B: GTSGGTPGSCDKVNCPNGYICTIVNQLAVCVSPSSSSSSSSSTTGSHTTTGGSTTGSHTT

  5. Happy Days: "SLJ's" Job Satisfaction Survey

    Kenney, Brian


    "School Library Journal's" ("SLJ's") Job Satisfaction Survey, conducted online in spring 2008, asked school and public librarians about their salaries, pay raises, and opportunities for advancement; level of job satisfaction; major causes of dissatisfaction; on-the-job challenges; and how well they were prepared for their positions, among other…

  6. Spacelab Science Results Study

    Naumann, R. J.; Lundquist, C. A.; Tandberg-Hanssen, E.; Horwitz, J. L.; Germany, G. A.; Cruise, J. F.; Lewis, M. L.; Murphy, K. L.


    Beginning with OSTA-1 in November 1981 and ending with Neurolab in March 1998, a total of 36 Shuttle missions carried various Spacelab components such as the Spacelab module, pallet, instrument pointing system, or mission peculiar experiment support structure. The experiments carried out during these flights included astrophysics, solar physics, plasma physics, atmospheric science, Earth observations, and a wide range of microgravity experiments in life sciences, biotechnology, materials science, and fluid physics which includes combustion and critical point phenomena. In all, some 764 experiments were conducted by investigators from the U.S., Europe, and Japan. The purpose of this Spacelab Science Results Study is to document the contributions made in each of the major research areas by giving a brief synopsis of the more significant experiments and an extensive list of the publications that were produced. We have also endeavored to show how these results impacted the existing body of knowledge, where they have spawned new fields, and if appropriate, where the knowledge they produced has been applied.

  7. SLJ's 2011 Technology Survey: Things Are Changing. Fast

    Kenney, Brian


    Despite the funding challenges nearly all school libraries face, many media specialists are optimistic about the role of technology in the school library, according to "School Library Journal's" ("SLJ") 2011 Technology Survey. But in spite of the general optimism, others point to some significant obstacles: technological innovations are often…

  8. Spacelab Life Sciences-1

    Dalton, Bonnie P.; Jahns, Gary; Meylor, John; Hawes, Nikki; Fast, Tom N.; Zarow, Greg


    This report provides an historical overview of the Spacelab Life Sciences-1 (SLS-1) mission along with the resultant biomaintenance data and investigators' findings. Only the nonhuman elements, developed by Ames Research Center (ARC) researchers, are addressed herein. The STS-40 flight of SLS-1, in June 1991, was the first spacelab flown after 'return to orbit', it was also the first spacelab mission specifically designated as a Life Sciences Spacelab. The experiments performed provided baseline data for both hardware and rodents used in succeeding missions.

  9. Spacelab Life Sciences Research Panel

    Sulzman, Frank; Young, Laurence R.; Seddon, Rhea; Ross, Muriel; Baldwin, Kenneth; Frey, Mary Anne; Hughes, Rod


    This document describes some of the life sciences research that was conducted on Spacelab missions. Dr. Larry Young, Director of the National Space Biomedical Research Institute, provides an overview of the Life Sciences Spacelabs.

  10. The App Squad: SLJ's Advisors Weigh in on Kids' Book Apps

    Ishizuka, Kathy


    In this article, "School Library Journal's" ("SLJ") advisors talk about book apps for kids. They discuss what they like, what one should look for in discerning the best for kids and teens, and where this all might be headed.

  11. Spacelab 3 mission

    Dalton, Bonnie P.


    Spacelab-3 (SL-3) was the first microgravity mission of extended duration involving crew interaction with animal experiments. This interaction involved sharing the Spacelab environmental system, changing animal food, and changing animal waste trays by the crew. Extensive microbial testing was conducted on the animal specimens and crew and on their ground and flight facilities during all phases of the mission to determine the potential for cross contamination. Macroparticulate sampling was attempted but was unsuccessful due to the unforseen particulate contamination occurring during the flight. Particulate debris of varying size (250 micron to several inches) and composition was recovered post flight from the Spacelab floor, end cones, overhead areas, avionics fan filter, cabin fan filters, tunnel adaptor, and from the crew module. These data are discussed along with solutions, which were implemented, for particulate and microbial containment for future flight facilities.

  12. Spacelab shaping space operations planning

    Steven, F. R.; Reinhold, C.


    An up-to-date picture is presented of the organizational structure, the key management personnel, and management relationships of the Spacelab program. Attention is also given to Spacelab's development status and plans for its operations. A number of charts are provided to illustrate the organizational relations. It is pointed out that the parties involved in Spacelab activities must yet resolve questions about ownership of transportation-system elements, payloads, ground support facilities, and data obtained from space missions.

  13. SLJ Presents the Best Adult Books for High School Students 2008

    Goldsmith, Francisca


    This article lists 30 titles, published between September 2007 and November 2008 (with reviews published in 2008), which the "School Library Journal's" ("SLJ's") Adult Books for High School Students Committee decided to recognize as the best for high school readers. The list includes realistic and historical novels as well as some genre-blending…

  14. Japan

    Hansen, Annette Skovsted


    I 1500- og 1600-tallet dannedes tidligt moderne stater i Europa, men samtidig eksisterede der ligeså avancerede statsdannelser uden for Europa, bl.a. i Kina, Indien og Japan. I det følgende ser vi nærmere på dannelsen af den moderne stat i Japan. Hvorfor blev Japan aldrig en europæisk koloni......? Hvordan havde japanske magthavere igennem 300 år forberedt Japan og de mennesker, der boede på de japanske øer, til at kunne udvikle en nation, der skulle blive den stærkeste og rigeste i Asien i mere end 100 år? Hvem bestemte i Japan? Kejseren eller shogunen?...

  15. Japan

    Matsui, T.


    A report is given on the basic research and development in food irradiation in Japan. Two new irradiation facilities are extensively described. Basic research is performed in radiation chemistry of fruits, potatoes, fish products, meat products and model systems. Microbiological research is concerned with Clostridium botulinum and radicidation and radurization studies, as well as effects of combination treatment on Micrococcus radiodurans. Radiation treatment of grain, frutis, vegetables, potatoes, fish, meat and meat products and other commodities is performed. Wholesomeness studies are dealing with the nutritional value and animal feeding studies are carried out with irradiated potatoes, onions, rice, wheat, and sausages. Two short chapters are concerned with legislation and marketing. (MG) [de

  16. Japan

    Huttner, Kevin; Suzuki, Tatsujiro


    The Japanese nuclear power programme began with reactors imported from the United States. A natural uranium heavy water reactor using domestic materials was started in 1958. Subsequent progress was with light water reactors imported from the United States. Domestic reactor development was of a fast breeder reactor and an advanced thermal reactor. By March 1986 there were 32 commercial power plants in operation which produced approximately 23% of the electricity consumed in Japan. Ten more are under construction and six more are planned. Their location and comparative generating cost are tabulated. Energy demand and targets for nuclear power generation are discussed. The FBR advanced thermal reactor and high temperature reactor programmes are summarized. The Japanese nuclear fuel cycle - uranium prospecting, enrichment, reprocessing, the development of mixed oxide fuels, thermal recycling and radioactive waste management is also discussed. (U.K.)

  17. SLJ's Spending Survey: As the Economy Limps along and Federal Dollars Dwindle, School Librarians Are Turning into Resourceful Survivors

    Farmer, Lesley


    This article presents the results of the latest "SLJ" survey of school expenditures and collections for 2009-2010. The survey reveals that librarians have used a variety of coping techniques to weather this economic storm, whether it is servicing more than one school, using additional volunteers, taking on more tasks, or seeking outside funding.…

  18. A review of Spacelab mission management approach

    Craft, H. G., Jr.


    The Spacelab development program is a joint undertaking of the NASA and ESA. The paper addresses the initial concept of Spacelab payload mission management, the lessons learned, and modifications made as a result of the actual implementation of Spacelab Mission 1. The discussion covers mission management responsibilities, program control, science management, payload definition and interfaces, integrated payload mission planning, integration requirements, payload specialist training, payload and launch site integration, payload flight/mission operations, and postmission activities. After 3.5 years the outlined overall mission manager approach has proven to be most successful. The approach does allow the mission manager to maintain the lowest overall mission cost.

  19. More Life-Science Experiments For Spacelab

    Savage, P. D., Jr.; Dalton, B.; Hogan, R.; Leon, H.


    Report describes experiments done as part of Spacelab Life Sciences 2 mission (SLS-2). Research planned on cardiovascular, vestibular, metabolic, and thermal responses of animals in weightlessness. Expected to shed light on effects of prolonged weightlessness on humans.

  20. Spacelab ready for transport to Washington, DC


    Spacelab is wrapped and ready for transport to the National Air and Space Museum in Washington, DC. Spacelab was designed by the European Space Agency (ESA) for the Space Shuttle program and first flew on STS-9 in November 1983. Its final flight was the STS-90 Neurolab mission in April 1998. A sister module will travel home and be placed on display in Europe. The Spacelab concept of modular experiment racks in a pressurized shirt-sleeve environment made it highly user-friendly and accessible. Numerous experiments conceived by hundreds of scientists on the ground were conducted by flight crews in orbit. Spacelab modules served as on-orbit homes for everything from squirrel monkeys to plant seeds. They supported astronomical as well as Earth observations, for servicing the Hubble Space Telescope and for research preparatory to the International Space Station. One of the greatest benefits afforded by the Spacelab missions was the opportunity to fly a mission more than once, with the second or third flight building on the experiences and data gathered from its predecessors.

  1. Animal studies on Spacelab-3

    Schatte, C.; Grindeland, R.; Callahan, P.; Berry, W.; Funk, G.; Lencki, W.


    The flight of two squirrel monkeys and 24 rats on Spacelab-3 was the first mission to provide hands-on maintenance on animals in a laboratory environment. With few exceptions, the animals grew and behaved normally, were free of chronic stress, and differed from ground controls only for gravity dependent parameters. One of the monkeys exhibited symptoms of space sickness similar to those observed in humans, which suggests squirrel monkeys may be good models for studying the space adaptation syndrome. Among the wide variety of parameters measured in the rats, most notable was the dramatic loss of muscle mass and increased fragility of long bones. Other interesting rat findings were those of suppressed interferom production by spleen cells, defective release of growth hormone by somatrophs, possible dissociation of circadian pacemakers, changes in hepatic lipid and carbohydrate metabolism, and hypersensitivity of marrow cells to erythropoietin. These results portend a strong role for animals in identifying and elucidating the physiological and anatomical responses of mammals to microgravity.

  2. The Spacelab IPS Star Simulator

    Wessling, Francis C., III

    The cost of doing business in space is very high. If errors occur while in orbit the costs grow and desired scientific data may be corrupted or even lost. The Spacelab Instrument Pointing System (IPS) Star Simulator is a unique test bed that allows star trackers to interface with simulated stars in a laboratory before going into orbit. This hardware-in-the loop testing of equipment on earth increases the probability of success while in space. The IPS Star Simulator provides three fields of view 2.55 x 2.55 degrees each for input into star trackers. The fields of view are produced on three separate monitors. Each monitor has 4096 x 4096 addressable points and can display 50 stars (pixels) maximum at a given time. The pixel refresh rate is 1000 Hz. The spectral output is approximately 550 nm. The available relative visual magnitude range is 2 to 8 visual magnitudes. The star size is less than 100 arc seconds. The minimum star movement is less than 5 arc seconds and the relative position accuracy is approximately 40 arc seconds. The purpose of this paper is to describe the LPS Star Simulator design and to provide an operational scenario so others may gain from the approach and possible use of the system.

  3. The first Spacelab payload - A joint NASA/ESA venture

    Kennedy, R.; Pace, R.; Collet, J.; Sanfourche, J. P.


    Planning for the 1980 qualification flight of Spacelab, which will involve a long module and one pallet, is discussed. The mission will employ two payload specialists, one sponsored by NASA and the other by ESA. Management of the Spacelab mission functions, including definition and execution of the on-board experiments, development of the experimental hardware and training of the payload specialists, is considered; studies proposed in the areas of atmospheric physics, space plasma physics, solar physics, earth observations, astronomy, astrophysics, life sciences and material sciences are reviewed. Analyses of the Spacelab environment and the Spacelab-to-orbiter and Spacelab-to-experiment interactions are also planned.

  4. Spacelab Users Guide: A Short Introduction to Spacelab and Its Use


    Spacelab is an orbital facility that provides a pressurized, 'shirt-sleeve' laboratory (the module) and an unpressurized platform (the pallet), together with certain standard services. It is a reusable system, which is transported to and from orbit in the cargo bay of the space shuttle orbiter and remains there throughout the flight. Spacelab extends the shuttle capability, and the Orbiter/Spacelab combination can be regarded as a short-stay space station which can remain in orbit for up to 30 days (the nominal mission duration is 7 days). In orbit, the experiments carried by Spacelab are operated by a team of up to four payload specialists who normally work in the laboratory, but spend their off-duty time in the orbiter cabin. The purpose of Spacelab is to provide a ready access to space for a broad spectrum of experimenters in many fields and from many nations. Low-cost techniques are envisaged for experiment development, integration and operation. The aim of this document is to provide a brief summary of Spacelab design characteristics and its use potential for experimenters wishing to take advantage of the unique opportunities offered for space experimentation.

  5. Spacelab Mission Implementation Cost Assessment (SMICA)

    Guynes, B. V.


    A total savings of approximately 20 percent is attainable if: (1) mission management and ground processing schedules are compressed; (2) the equipping, staffing, and operating of the Payload Operations Control Center is revised, and (3) methods of working with experiment developers are changed. The development of a new mission implementation technique, which includes mission definition, experiment development, and mission integration/operations, is examined. The Payload Operations Control Center is to relocate and utilize new computer equipment to produce cost savings. Methods of reducing costs by minimizing the Spacelab and payload processing time during pre- and post-mission operation at KSC are analyzed. The changes required to reduce costs in the analytical integration process are studied. The influence of time, requirements accountability, and risk on costs is discussed. Recommendation for cost reductions developed by the Spacelab Mission Implementation Cost Assessment study are listed.

  6. STS-47 MS Davis trains at Payload Crew Training Complex at Marshall SFC


    STS-47 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist (MS) N. Jan Davis, wearing the Autogenic Feedback Training System 2 suit and lightweight headset, reviews a Payload Systems Handbook in the Spacelab Japan (SLJ) mockup during training at the Payload Crew Training Complex at Marshall Space Flight Center (MSFC) in Huntsville, Alabama. View provided with alternate number 92P-137.

  7. Spacelab-3 (STS-51B) Onboard Photograph


    The primary purpose of the Spacelab-3 mission was to conduct materials science experiments in a stable low-gravity environment. In addition, the crew performed research in life sciences, fluid mechanics, atmospheric science, and astronomy. Spacelab-3 was equipped with several new minilabs, special facilities that would be used repeatedly on future flights. Two elaborate crystal growth furnaces, a life support and housing facility for small animals, and two types of apparatus for the study of fluids were evaluated on their inaugural flight. In this photograph, astronaut Don Lind observes the mercuric iodide growth experiment through a microscope at the vapor crystal growth furnace. The goals of this investigation were to grow near-perfect single crystals of mercuric iodide and to gain improved understanding of crystal growth by a vapor process. Mercuric iodide crystals have practical use as sensitive x-ray and gamma-ray detectors, and in portable detector devices for nuclear power plant monitoring, natural resource prospecting, biomedical applications in diagnosis and therapy, and in astronomical instruments. Managed by the Marshall Space Flight Center, Spacelab-3 (STS-51B) was launched aboard the Space Shuttle Orbiter Challenger on April 29, 1985.

  8. NASA Ames Summer High School Apprenticeship Research Program


    microorganisms, or by producing mutant bacteria and new breeds, interfering with the original destiny of Jovian evolution. And how would we know, many years...Spacelab mission, Spacelab Japan (SL-J), frog embryos will be fertilized in space in the frog embryology unit (FEU--fig. 3). Knowledge of embryology to animal embryos that develop quickly, which is necessary in a seven-to-ten-day shuttle flight. The rapid dovelopment of frog embryos makes

  9. Spacelab life sciences 2 post mission report

    Buckey, Jay C.


    Jay C. Buckey, M.D., Assistant Professor of Medicine at The University of Texas Southwestern Medical Center at Dallas served as an alternate payload specialist astronaut for the Spacelab Life Sciences 2 Space Shuttle Mission from January 1992 through December 1993. This report summarizes his opinions on the mission and offers suggestions in the areas of selection, training, simulations, baseline data collection and mission operations. The report recognizes the contributions of the commander, payload commander and mission management team to the success of the mission. Dr. Buckey's main accomplishments during the mission are listed.

  10. Holography on the Spacelab 3 mission

    Owen, Robert B.; Kroes, R. L.


    Spacelab 3's Fluid Experiment System, in which triglycine sulfate crystals were produced by a low temperature solution-growth technique, employs holography as its primary data-gathering system. This use of holography allows optical techniques which would be difficult to apply in orbit to be used after the holographic data is returned to ground laboratories, using an analysis of the reconstructed holographic image. The system used allows both single- and double-exposure holograms to be obtained in two separate orthogonal configurations.

  11. Spacelab Life Science-1 Mission Onboard Photograph


    Spacelab Life Science -1 (SLS-1) was the first Spacelab mission dedicated solely to life sciences. The main purpose of the SLS-1 mission was to study the mechanisms, magnitudes, and time courses of certain physiological changes that occur during space flight, to investigate the consequences of the body's adaptation to microgravity and readjustment to Earth's gravity, and bring the benefits back home to Earth. The mission was designed to explore the responses of the heart, lungs, blood vessels, kidneys, and hormone-secreting glands to microgravity and related body fluid shifts; examine the causes of space motion sickness; and study changes in the muscles, bones, and cells. This photograph shows astronaut Rhea Seddon conducting an inflight study of the Cardiovascular Deconditioning experiment by breathing into the cardiovascular rebreathing unit. This experiment focused on the deconditioning of the heart and lungs and changes in cardiopulmonary function that occur upon return to Earth. By using noninvasive techniques of prolonged expiration and rebreathing, investigators can determine the amount of blood pumped out of the heart (cardiac output), the ease with which blood flows through all the vessels (total peripheral resistance), oxygen used and carbon dioxide released by the body, and lung function and volume changes. SLS-1 was launched aboard the Space Shuttle Orbiter Columbia (STS-40) on June 5, 1995.

  12. Spacelab experiment computer study. Volume 1: Executive summary (presentation)

    Lewis, J. L.; Hodges, B. C.; Christy, J. O.


    A quantitative cost for various Spacelab flight hardware configurations is provided along with varied software development options. A cost analysis of Spacelab computer hardware and software is presented. The cost study is discussed based on utilization of a central experiment computer with optional auxillary equipment. Groundrules and assumptions used in deriving the costing methods for all options in the Spacelab experiment study are presented. The groundrules and assumptions, are analysed and the options along with their cost considerations, are discussed. It is concluded that Spacelab program cost for software development and maintenance is independent of experimental hardware and software options, that distributed standard computer concept simplifies software integration without a significant increase in cost, and that decisions on flight computer hardware configurations should not be made until payload selection for a given mission and a detailed analysis of the mission requirements are completed.

  13. Spacelab operations planning. [ground handling, launch, flight and experiments

    Lee, T. J.


    The paper reviews NASA planning in the fields of ground, launch and flight operations and experiment integration to effectively operate Spacelab. Payload mission planning is discussed taking consideration of orbital analysis and the mission of a multiuser payload which may be either single or multidiscipline. Payload analytical integration - as active process of analyses to ensure that the experiment payload is compatible to the mission objectives and profile ground and flight operations and that the resource demands upon Spacelab can be satisfied - is considered. Software integration is touched upon and the major integration levels in ground operational processing of Spacelab and its experimental payloads are examined. Flight operations, encompassing the operation of the Space Transportation System and the payload, are discussed as are the initial Spacelab missions. Charts and diagrams are presented illustrating the various planning areas.

  14. Protection Spacelab from Meteoroid and Orbital Debris

    Zheng, Shigui; Yan, Jun; Han, Zengyao


    As the first long-term on-orbit spacelab of China, TianGong-1 will stay aloft for 2 years. Its failure risk subjected to Meteoroid and Orbital Debris(M/OD) is hundreds of times higher than the risk of Shenzhou-5, Shenzhou-6 or Shenzhou-7, so the special M/OD protection designs have been applied. In order to reduce the penetration risk of radiator tube, the design of radiator has been modified by placing the tube at the side of radiator plate, and the new design does not affect the thermal control system without adding the mass. Secondly, Whipple structure is adopted in the two sides and front of spacecraft against M/OD impact.

  15. Evaluation of biological models using Spacelab

    Tollinger, D.; Williams, B. A.


    Biological models of hypogravity effects are described, including the cardiovascular-fluid shift, musculoskeletal, embryological and space sickness models. These models predict such effects as loss of extracellular fluid and electrolytes, decrease in red blood cell mass, and the loss of muscle and bone mass in weight-bearing portions of the body. Experimentation in Spacelab by the use of implanted electromagnetic flow probes, by fertilizing frog eggs in hypogravity and fixing the eggs at various stages of early development and by assessing the role of the vestibulocular reflex arc in space sickness is suggested. It is concluded that the use of small animals eliminates the uncertainties caused by corrective or preventive measures employed with human subjects.

  16. Spacelab - Ten years of international cooperation

    Bignier, M.; Harrington, J. C.; Sander, M. J.


    The history, current status, and future plans of the Spacelab program are reviewed, with a focus on the cooperative relationship between ESA and NASA. The initial decision to undertake the program and the three agreements signed to begin its implementation are examined, and the division of responsibilities and financial contributions is discussed insofar as it affected the management structure. Consideration is given to the major facilities, the 50-mission operational cycle, communications, the currently scheduled activities (through 1985), the prospective later uses, and the ten dedicated discipline laboratories. The importance of continuous mutual support during the planning and development phases is stressed. The program so far is considered a success, in terms of the goals set by the participants and in terms of the resolution of the problems inherent in international technological endeavors.

  17. Approach to Spacelab Payload mission management

    Craft, H. G.; Lester, R. C.


    The nucleus of the approach to Spacelab Payload mission management is the establishment of a single point of authority for the entire payload on a given mission. This single point mission manager will serve as a 'broker' between the individual experiments and the STS, negotiating agreements by two-part interaction. The payload mission manager, along with a small support team, will represent the users in negotiating use of STS accommodations. He will provide the support needed by each individual experimenter to meet the scientific, technological, and applications objectives of the mission with minimum cost and maximum efficiency. The investigator will assume complete responsibility for his experiment hardware definition and development and will take an active role in the integration and operation of his experiment.

  18. Tiangong-1, the First Manned Spacelab of China

    Coue, P.

    This paper presents an overview of Tiangong-1, the first Chinese space station officially dubbed Spacelab by Beijing authorities. Tiangong programme also demonstrates the actual progress level of China in the field of manned space activities. This new spacecraft will allow China to practice many tasks, to help prepare for the next step: the permanently occupied space station. Open sources have been only used to write this paper. For example, Chinese media revealed numerous information describing the Spacelab during the first docking operation between Tiangong-1 and Shenzhou-8. All aspects of this programme will be listed comprising the old stories and the new one: major technical characteristics, accommodation, mission, future prospects, etc.

  19. The astronomy spacelab payloads study: executive volume. Interim report


    The progress of the Astronomy Spacelab Payloads Project at the Goddard Space Flight Center is reported. Astronomical research in space, using the Spacelab in conjunction with the Space Shuttle, is described. The various fields of solar astronomy or solar physics, ultraviolet and optical astronomy, and high energy astrophysics are among the topics discussed. These fields include scientific studies of the Sun and its dynamical processes, of the stars in wavelength regions not accessible to ground based observations, and the exciting new fields of X-ray, gamma ray, and particle astronomy

  20. A coded mask telescope for the Spacelab 2 mission

    Willmore, A.P.; Skinner, G.K.; Eyles, C.J.; Ramsey, B.


    A dual coded mask telescope for the Spacelab 2 mission is now in the final stages of preparation at Birmingham University. It is due for launch in late 1984/early 1985 and will be by far the largest and most sophisticated such instrument to be flown in this time-frame. The design and capabilities of the telescope will be described. (orig.)

  1. International aerospace engineering: NASA shuttle and European Spacelab

    Bilstein, R. E.


    NASA negotiations and contractual arrangements involving European space research organizations' participation in manned space operations and efforts in building Spacelab for the U.S. Reusable Space Shuttle are discussed. Some of the diplomatic and technical collaboration involved in the international effort is reviewed.

  2. Dedicated data recording video system for Spacelab experiments

    Fukuda, Toshiyuki; Tanaka, Shoji; Fujiwara, Shinji; Onozuka, Kuniharu


    A feasibility study of video tape recorder (VTR) modification to add the capability of data recording etc. was conducted. This system is an on-broad system to support Spacelab experiments as a dedicated video system and a dedicated data recording system to operate independently of the normal operation of the Orbiter, Spacelab and the other experiments. It continuously records the video image signals with the acquired data, status and operator's voice at the same time on one cassette video tape. Such things, the crews' actions, animals' behavior, microscopic views and melting materials in furnace, etc. are recorded. So, it is expected that experimenters can make a very easy and convenient analysis of the synchronized video, voice and data signals in their post flight analysis.

  3. Space platforms - A cost effective evolution of Spacelab operation

    Stofan, A. J.


    The capabilities added to the Shuttle/Spacelab configuration by the addition of the Power Extension Package (PEP), the Power System (PS), and the Science and Applications Space Platforms (SASP) are reviewed with an emphasis on SASP. SASP are intended for placement in orbit by the Shuttle to test new instruments and systems, for clustering of instrumentation, and for servicing, refurbishment, repair, or augmentation by the Shuttle. The PEP permits extended stays in orbit (30 days), and the PS is an orbital solar array and energy storage system acting as a free flying spacecraft. The Shuttle can deliver payloads to the PS or attach to it for extension of the Spacelab operations. Applications of SASP for long term space-based biological experiments are outlined, and the fact that SASP do not increase the required Shuttle in-orbit time is stressed.

  4. Japan 2003

    Ørstrup, Finn Rude; Hvass, Sven


    Kompendium udarbejdet til en studierejse til Japan  2003 Kunstakademiets Arkitektskole, Studieafdeling 10......Kompendium udarbejdet til en studierejse til Japan  2003 Kunstakademiets Arkitektskole, Studieafdeling 10...

  5. Design features of selected mechanisms developed for use in Spacelab. [mechanical ground support equipment and environmental control

    Inden, W.


    Selected mechanisms developed for the Spacelab program are discussed. These include: (1) the roller rail used to install/remove the Spacelab floor loaded with racks carrying experiments; (2) the foot restraint; and (3) the lithium hydroxide used for decontamination.

  6. European X-ray spectroscopy and polarimetry payload for Spacelab

    Andresen, R D; Whitcomb, G [European Space Research and Technology Centre, Noordwijk (Netherlands); Brinkman, A C [Space Research Laboratory, Utrecht, The Netherlands; Beuermann, K [Max-Planck-Institut fuer Physik und Astrophysik, Garching/Muenchen (Germany, F.R.). Inst. fuer Extraterrestrische Physik; Culhane, J L [University Coll., London (UK). Mullard Space Science Lab.; Griffiths, R [Leicester Univ. (UK); Manno, V [ESA Headquarters, Paris, France; Rocchia, R [CEA Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France)


    A group of instruments for X-ray spectroscopy and polarimetry studies of a number of cosmic X-ray sources is being designed for possible use on Spacelab. Large area Bragg spectrometers and polarimeters for photon energies above 2 keV are described. For the energy range below 2 keV, both dispersive and non-dispersive spectrometers are employed at the common focus of a nested array of paraboloids. Following a brief outline of the scientific background to the mission, the properties of the individual instruments are discussed.

  7. Improved waste water vapor compression distillation technology. [for Spacelab

    Johnson, K. L.; Nuccio, P. P.; Reveley, W. F.


    The vapor compression distillation process is a method of recovering potable water from crewman urine in a manned spacecraft or space station. A description is presented of the research and development approach to the solution of the various problems encountered with previous vapor compression distillation units. The design solutions considered are incorporated in the preliminary design of a vapor compression distillation subsystem. The new design concepts are available for integration in the next generation of support systems and, particularly, the regenerative life support evaluation intended for project Spacelab.

  8. Preliminary results of the Spacelab 2 superfluid helium experiment

    Mason, P.V.; Collins, D.J.; Elleman, D.D.; Jackson, H.W.; Wang, T.


    An experiment to investigate the properties of superfluid helium in a microgravity environment flew on the Shuttle on the Spacelab 2 mission in July and August of 1985. This paper summarizes the flight experiment and describes some preliminary results. The experiment comprised an investigation of long-wavelength third-sound waves in micron-thick films, a study of the motions of superfluid helium under milli-g and micro-g accelerations, and measurements of the fluctuations in temperature associated with the small motions of the bulk helium. An additional objective was to qualify and characterize a reflyable, space-compatible cryostat

  9. Hematology and biochemical findings of Spacelab 1 flight

    Leach, Carolyn S.; Chen, J. P.; Crosby, W.; Johnson, P. C.; Lange, R. D.; Larkin, E.; Tavassoli, M.


    The changes in erythropoiesis in astronauts caused by weightlessness was experimentally studied during the Spacelab 1 flight. Immediately after landing showed a mean decrease of 9,3 percent in the four astronauts. Neither hyperoxia nor an increase in blood phosphate caused the decrease. Red cell survival time and iron incorporation postflight were not significantly different from their preflight levels. Serum haptoglobin did not decrease, indicating that intravascular hemolysis was not a major cause of red cell mass change. An increase in serum ferritin after the second day of flight may have been caused by red cell breakdown early in flight. The space flight-induced decrease in red cell mass may result from a failure of erythropoesis to replace cells destroyed by the spleen soon after weightlessness is attained.

  10. Hematological measurements in rats flown on Spacelab shuttle SL-3

    Lange, R.D.; Andrews, R.B.; Gibson, L.A.; Congdon, C.C.; Wright, P.; Dunn, C.D.R.; Jones, J.B.


    Previous studies have shown that a decrease in red cell mass occurs in astronauts, and some studies indicate a leukocytosis occurs. A life science module housing young and mature rats was flown on shuttle mission Spacelab 3 (SL-3), and the results of hematology studies of flight and control rats are presented. Statistically significant increases in the hematocrit, red blood cell counts, and hemoglobin determinations, together with a mild neutrophilia and lymphopenia, were found in flight animals. No significant changes were found in bone marrow and spleen cell differentials or erythropoietin determinations. Clonal assays demonstrated an increased erythroid colony formation of flight animal bone marrow cells at erythropoietin doses of 0.02 and 1.0 U/ml but not 0.20 U/ml. These results agree with some but vary from other previously published studies. Erythropoietin assays performed by radioimmunoassay and clonal studies were performed for the first time

  11. Animal experimentation in Spacelab - Present and future U.S. plans

    Berry, W. E.; Dant, C. C.


    Current development of life-sciences hardware and experiments for the fourth Spacelab mission in the Life Sciences Flight Experiments Program at NASA Ames is reviewed. The research-animal holding facility, the general-purpose work station, and the life sciences laboratory equipment are characterized, and the 14 Ames projects accepted for the mission are listed and discussed. Several hardware systems and experimental procedures will be verified on the Spacelab-3 mission scheduled for late 1984.

  12. Definition of Life Sciences laboratories for shuttle/Spacelab. Volume 1: Executive summary


    Research requirements and the laboratories needed to support a Life Sciences research program during the shuttle/Spacelab era were investigated. A common operational research equipment inventory was developed to support a comprehensive but flexible Life Sciences program. Candidate laboratories and operational schedules were defined and evaluated in terms of accomodation with the Spacelab and overall program planning. Results provide a firm foundation for the initiation of a life science program for the shuttle era.

  13. Networking Japan

    Hansen, Annette Skovsted

    Human Resource Development was the first and remains an important pillar in Japanese foreign aid. I will argue that Japan has access to a global network of alumni who will co-define Japanese foreign aid in the future, because Japan has encouraged alumni societies and networking since 1965. A total...... of more than a million people in more than 100 countries have attended courses in Japan funded fully or partly by Japanese ODA since the inception of the technical assistance programs in 1954 through the Colombo Plan and since 1959 through the Association of Overseas Technical Scholarships (AOTS from 2009...... HIDA). Many of these alumni have and will in the future exchange ideas and keep contact not only to Japan, but also to fellow alumni around the globe and, thereby, practice south-south exchanges, which are made possible and traceable by their established alumni network and the World Network of Friends...

  14. Research on lettuce growth technology onboard Chinese Tiangong II Spacelab

    Shen, Yunze; Guo, Shuangsheng; Zhao, Pisheng; Wang, Longji; Wang, Xiaoxia; Li, Jian; Bian, Qiang


    Lettuce was grown in a space vegetable cultivation facility onboard the Tiangong Ⅱ Spacelab during October 18 to November 15, 2016, in order to testify the key cultivating technology in CELSS under spaceflight microgravity condition. Potable water was used for irrigation of rooting substrate and the SRF (slowly released fertilizer) offered mineral nutrition for plant growth. Water content and electric conductivity in rooting substrate were measured based on FDR(frequency domain reflectometry) principle applied first in spaceflight. Lettuce germinated with comparative growth vigor as the ground control, showing that the plants appeared to be not stressed by the spaceflight environment. Under microgravity, lettuce grew taller and showed deeper green color than the ground control. In addition, the phototropism of the on-orbit plants was more remarkable. The nearly 30-d spaceflight test verified the seed fixation technology and water& nutrition management technology, which manifests the feasibility of FDR being used for measuring moisture content and electric conductivity in rooting zone under microgravity. Furthermore, the edibility of the space-grown vegetable was proved, providing theoretical support for astronaut to consume the space vegetable in future manned spaceflight.

  15. Mental Workload and Performance Experiment (MWPE) Team in the Spacelab Payload Operations Control


    The primary payload for Space Shuttle Mission STS-42, launched January 22, 1992, was the International Microgravity Laboratory-1 (IML-1), a pressurized manned Spacelab module. The goal of IML-1 was to explore in depth the complex effects of weightlessness of living organisms and materials processing. Around-the-clock research was performed on the human nervous system's adaptation to low gravity and effects of microgravity on other life forms such as shrimp eggs, lentil seedlings, fruit fly eggs, and bacteria. Materials processing experiments were also conducted, including crystal growth from a variety of substances such as enzymes, mercury iodide, and a virus. The Huntsville Operations Support Center (HOSC) Spacelab Payload Operations Control Center (SL POCC) at the Marshall Space Flight Center (MSFC) was the air/ground communication channel used between the astronauts and ground control teams during the Spacelab missions. Featured is the Mental Workload and Performance Experiment (MWPE) team in the SL POCC) during STS-42, IML-1 mission.

  16. Gravity Plant Physiology Facility (GPPF) Team in the Spacelab Payload Operations Control Center (SL


    The primary payload for Space Shuttle Mission STS-42, launched January 22, 1992, was the International Microgravity Laboratory-1 (IML-1), a pressurized manned Spacelab module. The goal of IML-1 was to explore in depth the complex effects of weightlessness of living organisms and materials processing. Around-the-clock research was performed on the human nervous system's adaptation to low gravity and effects of microgravity on other life forms such as shrimp eggs, lentil seedlings, fruit fly eggs, and bacteria. Materials processing experiments were also conducted, including crystal growth from a variety of substances such as enzymes, mercury iodide, and a virus. The Huntsville Operations Support Center (HOSC) Spacelab Payload Operations Control Center (SL POCC) at the Marshall Space Flight Center (MSFC) was the air/ground communication channel used between the astronauts and ground control teams during the Spacelab missions. Featured is the Gravity Plant Physiology Facility (GPPF) team in the SL POCC during the IML-1 mission.

  17. Critical Point Facility (CPE) Group in the Spacelab Payload Operations Control Center (SL POCC)


    The primary payload for Space Shuttle Mission STS-42, launched January 22, 1992, was the International Microgravity Laboratory-1 (IML-1), a pressurized manned Spacelab module. The goal of IML-1 was to explore in depth the complex effects of weightlessness of living organisms and materials processing. Around-the-clock research was performed on the human nervous system's adaptation to low gravity and effects of microgravity on other life forms such as shrimp eggs, lentil seedlings, fruit fly eggs, and bacteria. Materials processing experiments were also conducted, including crystal growth from a variety of substances such as enzymes, mercury iodide, and a virus. The Huntsville Operations Support Center (HOSC) Spacelab Payload Operations Control Center (SL POCC) at the Marshall Space Flight Center (MSFC) was the air/ground communication channel used between the astronauts and ground control teams during the Spacelab missions. Featured is the Critical Point Facility (CPE) group in the SL POCC during STS-42, IML-1 mission.

  18. Mechanical and thermal design of an experiment aboard the space shuttle: the Spacelab spectrometer

    Besson, J.


    The spectrometer designed by ONERA and IASB (Belgium Space Aeronomy Institute) to measure atmospheric trace constituents was flown aboard Spacelab 1 during the 9 th mission of the American Space Shuttle from November 28 to December 8, 1983. After a brief summary of the history of the project related to Spacelab, the mechanical and thermal design of the spectrometer is described. Some methods, calculations and characteristic tests are detailed as examples. The behaviour of the experiment during the mission and the results of the post-flight tests are shortly analyzed in order to prepare the qualification for a reflight [fr

  19. STS-40 Spacelab Life Science 1 (SLS-1) module in OV-102's payload bay (PLB)


    STS-40 Spacelab Life Science 1 (SLS-1) module is documented in the payload bay (PLB) of Columbia, Orbiter Vehicle (OV) 102. Included in the view are: the spacelab (SL) transfer tunnel joggle section and support struts; SLS-1 module forward end cone with the European Space Agency (ESA) SL insignia, SLS-1 payload insignia, and the upper feed through plate (center); the orbiter maneuvering system (OMS) pods; and the vertical stabilizer with the Detailed Test Objective (DTO) 901 Shuttle Infrared Leeside Temperature Sensing (SILTS) at the top 24 inches. The vertical stabilizer points to the Earth's limb and the cloud-covered surface of the Earth below.

  20. The design and development of an oil-free compressor for Spacelab Refrigerator/Freezer

    Hye, A.


    Design features and test results of an oil-free compressor developed for Spacelab Mission-4 Refrigerator/Freezer are detailed. The compressor has four identical pistons activated by a common eccentric shaft, operated by a brushless dc motor at 1300 rpm. The stroke of each piston is 0.28 cm, with the piston ends connected to the shaft by means of sealed needle bearings, eliminating the ned for oil. The mass flow rates produced by the compressor are by over 100 percent higher compared to the original Amfridge unit. Test results show that the compressor can meet the Spacelab refrigerator/freezer requirements.

  1. The gravitational plant physiology facility-Description of equipment developed for biological research in spacelab

    Heathcote, D. G.; Chapman, D. K.; Brown, A. H.; Lewis, R. F.


    In January 1992, the NASA Suttle mission STS 42 carried a facility designed to perform experiments on plant gravi- and photo-tropic responses. This equipment, the Gravitational Plant Physiology Facility (GPPF) was made up of a number of interconnected units mounted within a Spacelab double rack. The details of these units and the plant growth containers designed for use in GPPF are described. The equipment functioned well during the mission and returned a substantial body of time-lapse video data on plant responses to tropistic stimuli under conditions of orbital microgravity. GPPF is maintained by NASA Ames Research Center, and is flight qualifiable for future spacelab missions.

  2. The Spacelab-Mir-1 "Greenhouse-2" experiment

    Bingham, G. E.; Salisbury, F. B.; Campbell, W. F.; Carman, J. G.; Bubenheim, D. L.; Yendler, B.; Sytchev, V. N.; Levinskikh, M. A.; Podolsky, I. G.


    The Spacelab-Mir-1 (SLM-1) mission is the first docking of the Space Shuttle Atlantis (STS-71) with the Orbital Station Mir in June 1995. The SLM-1 "Greenhouse-2" experiment will utilize the Russian-Bulgarian-developed plant growth unit (Svet). "Greenhouse-2" will include two plantings (1) designed to test the capability of Svet to grow a crop of Superdwarf wheat from seed to seed, and (2) to provide green plant material for post-flight analysis. Protocols, procedures, and equipment for the experiment have been developed by the US-Russian science team. "Greenhouse-2" will also provide the first orbital test of a new Svet Instrumentation System (SIS) developed by Utah State University to provide near real time data on plant environmental parameters and gas-exchange rates. SIS supplements the Svet control and monitoring system with additional sensors for substrate moisture, air temperature, IR leaf temperature, light, oxygen, pressure, humidity, and carbon-dioxide. SIS provides the capability to monitor canopy transpiration and net assimilation of the plants growing in each vegetation unit (root zone) by enclosing the canopy in separate, retractable, ventilated leaf chambers. Six times during the seed-to-seed experiment, plant samples will be collected, leaf area measured, and plant parts fixed and/or dried for ground analysis. A second planting initiated 30 days before the arrival of a U.S. Shuttle [originally planned to be STS-71] is designed to provide green material at the vegetative development stage for ground analysis. [As this paper is being edited, the experiment has been delayed until after the arrival of STS-71.].

  3. Plasma diagnostics package. Volume 2: Spacelab 2 section, part A

    Pickett, Jolene S. (Compiler); Frank, L. A. (Compiler); Kurth, W. S. (Compiler)


    This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, l985, through June 30, l988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). The scientific analyses during the performance period consisted of follow-up studies of shuttle orbiter environment and orbiter/ionosphere interactions and various plasma particle and wave studies which dealt with data taken when the PDP was on the Remote Manipulator System (RMS) arm and when the PDP was in free flight. Of particular interest during the RMS operations and free flight were the orbiter wake studies and joint studies of beam/plasma interactions with the SL-2 Fast Pulse Electron Generator (FPEG) of the Vehicle Charging and Potential Investigation (VCAP). Internal reports, published papers and presentations which involve PDP/SL-2 data are listed in Sections 3 and 4. A PDP/SL-2 scientific results meeting was held at the University of Iowa on June 10, l986. This meeting was attended by most of the PDP and VCAP investigators and provided a forum for discussing and comparing the various results, particularly with regard to the PDP free flight.

  4. Japan 2014

    Selmer, Finn


    In March 2014 a group of teachers and students from the Royal Danish Academy of Fine Arts Schools of Architecture, Design and Conservation, School of Architecture, Study Dept. 3 went on a study trip to Japan. This publication collects observations and reflections that the participants of the trip...

  5. Spacelab Level 4 Programmatic Implementation Assessment Study. Volume 2: Ground Processing requirements


    Alternate ground processing options are summarized, including installation and test requirements for payloads, space processing, combined astronomy, and life sciences. The level 4 integration resource requirements are also reviewed for: personnel, temporary relocation, transportation, ground support equipment, and Spacelab flight hardware.

  6. Contemporary achievements in astronautics: Salyut-7, the Vega Project and Spacelab

    Kubasov, V. N.; Balebanov, V. M.; Goldovskiy, D. Y.


    The latest achievements in Soviet aeronautics are described; the new stage in the space program to study Venus using Soviet automated space probes, and the next space mission by cosmonauts to the Salyut-7 station. Information is also presented on the flight of the Spacelab orbiting laboratory created by Western European specialists.

  7. For Earth into space: The German Spacelab Mission D-2

    Sahm, P. R.; Keller, M. H.; Schiewe, B.

    The Spacelab Mission D-2 successfully lifted off from Kennedy Space Center on April 26, 1993. With 88 experiments on board covering eleven different research disciplines it was a very ambitious mission. Besides materials and life science subjects, the mission also encompassed astronomy, earth observation, radiation physics and biology, telecommunication, automation and robotics. Notable results were obtained in almost all cases. To give some examples of the scientific output, building upon results obtained in previous missions (FSLP, D1) diffusion in melts was broadly represented delivering most precise data on the atomic mobility within various liquids, and crystal growth experiments (the largest gallium arsenide crystal grown by the floating zone technique, so far obtained anywhere, was one of the results), biological cell growth experiments were continued (for example, beer yeast cultures, continuing their growth on earth, delivered a qualitatively superior brewery result), the human physiology miniclinic configuration ANTHRORACK gave novel insights concerning cardiovascular, pulmonary, and renal (fluid volume determining) factors. Astronomical experiments yielded insights into our own galaxy within the ultra violet spectrum, earth observation experiments delivered the most precise resolution data superimposed by thematic mapping of many areas of the Earth, and the robotics experiment brought a remarkable feature in that a flying object was caught by the space robot, which was only achieved through several innovative advances during the time of experiment preparation. The eight years of preparation were also beneficial in another sense. Several discoveries have been made, and various technology transfers into ground-based processes were verified. To name the outstanding ones, in the materials science a novel bearing materials production process was developped, a patent granted for an improved high temperature heating chamber; with life sciences a new hormone

  8. The design, fabrication and installation of cable routing mockups in support of Spacelab 2


    From flight and mockup drawings of Spacelab 2 (SL 2) experiments and hardware, shop ready mockup drawings were produced. Floor panels were the first items considered for fabrication. Cold plate and orthogrid mockups were designed and fabricated. Experiment and other hardware mockups were fabricated of aluminum or plywood, depending on size and configuration. Eighty-three cable routing bracket mockups were fabricated of aluminum and delivered for painting.

  9. Wind Energy Japan

    Komatsubara, Kazuyo [Embassy of the Kingdom of the Netherlands, Tokyo (Japan)


    An overview is given of wind energy in Japan: Background; Wind Energy in Japan; Japanese Wind Energy Industry; Government Supports; Useful Links; Major Japanese Companies; Profiles of Major Japanese Companies; Major Wind Energy Projects in Japan.

  10. Competition in Japan

    Michael E. Porter; Mariko Sakakibara


    This article examines competition in Japan and its link to postwar economic prosperity. While Japan's industrial structure and competition policy seem to indicate that competition in Japan has been less intense, the empirical evidence does not support this conclusion. The sectors in which competition was restricted prove to be those where Japan was not internationally successful. In the internationally successful sectors, internal competition in Japan was invariably fierce. While the level of...

  11. Life sciences payload definition and integration study. Volume 1: Executive summary. [carry-on laboratory for Spacelab


    The definition and integration tasks involved in the development of design concepts for a carry-on laboratory (COL), to be compatible with Spacelab operations, were divided into the following study areas: (1) identification of research and equipment requirements of the COL; (2) development of a number of conceptual layouts for COL based on the defined research of final conceptual designs; and (4) development of COL planning information for definition of COL/Spacelab interface data, cost data, and program cost schedules, including design drawings of a selected COL to permit fabrication of a functional breadboard.

  12. Scientific management and implementation of the geophysical fluid flow cell for Spacelab missions

    Hart, J.; Toomre, J.


    Scientific support for the spherical convection experiment to be flown on Spacelab 3 was developed. This experiment takes advantage of the zero gravity environment of the orbiting space laboratory to conduct fundamental fluid flow studies concerned with thermally driven motions inside a rotating spherical shell with radial gravity. Such a system is a laboratory analog of large scale atmospheric and solar circulations. The radial body force necessary to model gravity correctly is obtained by using dielectric polarization forces in a radially varying electric field to produce radial accelerations proportional to temperature. This experiment will answer fundamental questions concerned with establishing the preferred modes of large scale motion in planetary and stellar atmospheres.

  13. Research and technology, 1993. Salute to Skylab and Spacelab: Two decades of discovery


    A summary description of Skylab and Spacelab is presented. The section on Advanced Studies includes projects in space science, space systems, commercial use of space, and transportation systems. Within the Research Programs area, programs are listed under earth systems science, space physics, astrophysics, and microgravity science and applications. Technology Programs include avionics, materials and manufacturing processes, mission operations, propellant and fluid management, structures and dynamics, and systems analysis and integration. Technology transfer opportunities and success are briefly described. A glossary of abbreviations and acronyms is appended as is a list of contract personnel within the program areas.

  14. AMPS sciences objectives and philosophy. [Atmospheric, Magnetospheric and Plasmas-in-Space project on Spacelab

    Schmerling, E. R.


    The Space Shuttle will open a new era in the exploration of earth's near-space environment, where the weight and power capabilities of Spacelab and the ability to use man in real time add important new features. The Atmospheric, Magnetospheric, and Plasmas-in-Space project (AMPS) is conceived of as a facility where flexible core instruments can be flown repeatedly to perform different observations and experiments. The twin thrusts of remote sensing of the atmosphere below 120 km and active experiments on the space plasma are the major themes. They have broader implications in increasing our understanding of plasma physics and of energy conversion processes elsewhere in the universe.

  15. Correlation lifetimes of quiet and magnetic granulation from the SOUP instrument on Spacelab 2

    Title, A.; Tarbell, T.; Topka, K.; Acton, L.; Duncan, D.; Ferguson, S.; Finch, M.; Frank, Z.; Kelly, G.; Lindgren, R.; Morrill, M.; Pope, T.; Reeves, R.; Rehse, R.; Shine, R.; Simon, G.; Harvey, J.; Leibacher, J.; Livingston, W.; November, L.; Zirker, J.

    The time sequences of diffraction limited granulation images obtained by the Solar Optical Universal Polarimeter on Spacelab 2 are presented. The uncorrection autocorrelation limetime in magnetic regions is dominated by the 5-min oscillation. The removal of this oscillation causes the autocorrelation lifetime to increase by more than a factor of 2. The results suggest that a significant fraction of granule lifetimes are terminated by nearby explosions. Horizontal displacements and transverse velocities in the intensity field are measured. Lower limits to the lifetime in the quiet and magnetic sun are set at 440 s and 950 s, respectively.

  16. Life science payloads planning study. [for space shuttle orbiters and spacelab

    Nelson, W. G.; Wells, G. W.


    Preferred approaches and procedures were defined for integrating the space shuttle life sciences payload from experiment solicitation through final data dissemination at mission completion. The payloads operations plan was refined and expended to include current information. The NASA-JSC facility accommodations were assessed, and modifications recommended to improve payload processing capability. Standard format worksheets were developed to permit rapid location of experiment requirements and a Spacelab mission handbook was developed to assist potential life sciences investigators at academic, industrial, health research, and NASA centers. Practical, cost effective methods were determined for accommodating various categories of live specimens during all mission phases.

  17. Nuclear energy in Japan

    Guillemard, B.


    After having described the nuclear partners in Japan, the author analyzes the main aspects of Japan's nuclear energy: nuclear power plants construction program; developping of light water reactors; fuel cycle politics [fr

  18. Final definition and preliminary design study for the initial atmospheric cloud physics laboratory, a spacelab mission payload


    The Atmospheric Cloud Physics Laboratory (ACPL) task flow is shown. Current progress is identified. The requirements generated in task 1 have been used to formulate an initial ACPL baseline design concept. ACPL design/functional features are illustrated. A timetable is presented of the routines for ACPL integration with the spacelab system.

  19. Changes in pituitary growth hormone cells prepared from rats flown on Spacelab 3

    Grindeland, R.; Hymer, W. C.; Farrington, M.; Fast, T.; Hayes, C.; Motter, K.; Patil, L.; Vasques, M.


    The effect of exposure to microgravity on pituitary gland was investigated by examining cells isolated from anterior pituitaries of rats flown on the 7-day Spacelab 3 mission and, subsequently, cultured for 6 days. Compared with ground controls, flight cells contained more intracellular growth hormone (GH); however, the flight cells released less GH over the 6-day culture period and after implantation into hypophysectomized rats than did the control cells. Compared with control rats, glands from large rats (400 g) contained more somatotrophs (44 percent compared with 37 percent in control rats); small rats (200 g) showed no difference. No major differences were found in the somatotroph ultrastructure (by TEM) or in the pattern of the immunoactive GH variants. However, high-performance liquid chromatography fractionation of culture media indicated that flight cells released much less of a biologically active high-molecular weight GH variant, suggesting that space flight may lead to secretory dysfunction.

  20. Image motion compensation on the Spacelab 2 Solar Optical Universal Polarimeter /SL2 SOUP/

    Tarbell, T. D.; Duncan, D. W.; Finch, M. L.; Spence, G.


    The SOUP experiment on Spacelab 2 includes a 30 cm visible light telescope and focal plane package mounted on the Instrument Pointing System (IPS). Scientific goals of the experiment dictate pointing stability requirements of less than 0.05 arcsecond jitter over periods of 5-20 seconds. Quantitative derivations of these requirements from two different aspects are presented: (1) avoidance of motion blurring of diffraction-limited images; (2) precise coalignment of consecutive frames to allow measurement of small image differences. To achieve this stability, a fine guider system capable of removing residual jitter of the IPS and image motions generated on the IPS cruciform instrument support structure has been constructed. This system uses solar limb detectors in the prime focal plane to derive an error signal. Image motion due to pointing errors is compensated by the agile secondary mirror mounted on piezoelectric transducers, controlled by a closed-loop servo system.

  1. Plasma diagnostics package. Volume 2: Spacelab 2 section. Part B: Thesis projects. Final science report

    Pickett, J.S.; Frank, L.A.; Kurth, W.S.


    This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B

  2. Plasma diagnostics package. Volume 2: Spacelab 2 section. Part B: Thesis projects

    Pickett, Jolene S. (Compiler); Frank, L. A. (Compiler); Kurth, W. S. (Compiler)


    This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B.

  3. Low power CAMAC and NIM modular systems for spaceflight use on Shuttle and Spacelab missions

    Trainor, J.H.; Kaminski, T.J.; Ehrmann, C.H.


    The advent of the Shuttle launch vehicle and Spacelab have resulted in adequate weight and volume such that experiment electronics can be implemented at relatively low cost using spaceflight versions of CAMAC and NIM modules. Studies of 10 modules by manufacturers have shown that power reduction overall by a factor of approximately 3 can be accomplished. This is adequate both from the point of view of consumption and temperature rise in vacuum. Our studies have shown that a stock of approximately 45 module types is required and a listing is given. The changes required in these modules in order to produce spaceflight versions are described. And finally, the further studies, prototyping and testing leading to eventual flight qualification are described.

  4. Man in space - A time for perspective. [crew performance on Space Shuttle-Spacelab program

    Winter, D. L.


    Factors affecting crew performances in long-term space flights are examined with emphasis on the Space Shuttle-Spacelab program. Biomedical investigations carried out during four Skylab missions indicate that initially rapid changes in certain physiological parameters, notably in cardiovascular response and red-blood-cell levels, lead to an adapted condition. Calcium loss remains a potential problem. Space Shuttle environmental control and life-support systems are described together with technology facilitating performance of mission objectives in a weightless environment. It is concluded that crew requirements are within the physical and psychological capability of astronauts, but the extent to which nonastronaut personnel will be able to participate without extensive training and pre-conditioning remains to be determined.

  5. Importance of temperature control for HEFLEX, a biological experiment for Spacelab 1. [plant gravitational physiology study

    Chapman, D. K.; Brown, A. H.


    The importance of temperature control to HEFLEX, a Spacelab experiment designed to measure kinetic properties of Helianthis nutation in a low-g environment, is discussed. It is argued that the development of the HEFLEX experiment has been severely hampered by the inadequate control of ambient air temperature provided by the spacecraft module design. A worst case calculation shows that delivery of only 69% of the maximum yield of useful data from the HEFLEX system is guaranteed; significant data losses from inadequate temperature control are expected. The magnitude of the expected data losses indicates that the cost reductions associated with imprecise temperature controls may prove to be a false economy in the long term.

  6. Interim Report of the Astronomy Spacelab Payloads Study. Volume 2; Ultraviolet and Optical Astronomy


    The Space Shuttle will comprise NASA's primary transportation system into near-earth orbit during the 1980s. The Shuttle will provide the astronomical community with a major new capability to send a wide variety of instrumentation into orbit, to utilize it there under manned or automatic control for periods from seven to thirty days, and to return it to the ground. To this end the European Space Research Organization (ESRO) is developing Spacelab, an array of interchangeable components -pressurized manned modules, unpressurized pallets and related support systems - to be mounted in the Shuttle payload bay. Spacelab will offer important opportunities to carry out astronomical research with instruments optimized for specific objectives. With a high flight frequency and with the ability to modify or interchange telescopes and instruments between flights, one will not need to make rigid long-term commitments to specific and compromised telescope/instrument/ detector combinations as is the case for automated satellites. Observational techniques demanding the physical return of data and equipment - in particular the use of photographic film, instruments requiring tight calibration controls, cryogens, high-risk detectors and degradeable optical coatings -will open research areas not readily addressed by automated satellites. Although Shuttle flight duration will be limited to periods from seven to thirty days, substantial data can be obtained with a single instrument on short missions, if targets are carefully selected and prioritized, and a large number of instruments can be accommodated on a single flight. Important astronomical data are regularly obtained on sounding rocket flights of five minutes duration. Spacelab will provide far longer observing periods for large and small telescopes, with resources greatly exceeding those of sounding rockets, while retaining much of the sounding rocket philosophy in terms of instrument flexibility, simplicity, reliability

  7. Man/terminal interaction evaluation of computer operating system command and control service concepts. [in Spacelab

    Dodson, D. W.; Shields, N. L., Jr.


    The Experiment Computer Operating System (ECOS) of the Spacelab will allow the onboard Payload Specialist to command experiment devices and display information relative to the performance of experiments. Three candidate ECOS command and control service concepts were reviewed and laboratory data on operator performance was taken for each concept. The command and control service concepts evaluated included a dedicated operator's menu display from which all command inputs were issued, a dedicated command key concept with which command inputs could be issued from any display, and a multi-display concept in which command inputs were issued from several dedicated function displays. Advantages and disadvantages are discussed in terms of training, operational errors, task performance time, and subjective comments of system operators.

  8. Liquid natural gas. Japan

    Van Kooij, E.


    An overview is given of the technical know-how and expertise in Japan with respect to the supply, transport, storage and use of LNG. First the overall energy supply in Japan is outlined. Next, the reasons for the use of LNG as an energy source in Japan are discussed. As an example of a typical LNG-installation in Japan the construction of the Himeji Terminal of Osaka Gas Company is described. Finally, attention is paid to the world's largest and modern below-surface LNG-tanks (capacity of 200,000 m 3 ), installed at the Negishi Terminal of Tokyo Gas Company

  9. IRBA SERIES : Accounting In Japan

    Arai, Kiyomitsu


    Preface / Legal and Conceptual Framework of Accounting in Japan / Setting Accounting Standards in Japan - The American Influence and The Present Status / Accounting Education and Profession in Japan / The International Harmonization of Accounting Standards / The Accounting Standard Setting in Japan and Its Responses to International Accounting Standards / Selected Bibliography for Accounting in Japan

  10. An interactive computer approach to performing resource analysis for a multi-resource/multi-project problem. [Spacelab inventory procurement planning

    Schlagheck, R. A.


    New planning techniques and supporting computer tools are needed for the optimization of resources and costs for space transportation and payload systems. Heavy emphasis on cost effective utilization of resources has caused NASA program planners to look at the impact of various independent variables that affect procurement buying. A description is presented of a category of resource planning which deals with Spacelab inventory procurement analysis. Spacelab is a joint payload project between NASA and the European Space Agency and will be flown aboard the Space Shuttle starting in 1980. In order to respond rapidly to the various procurement planning exercises, a system was built that could perform resource analysis in a quick and efficient manner. This system is known as the Interactive Resource Utilization Program (IRUP). Attention is given to aspects of problem definition, an IRUP system description, questions of data base entry, the approach used for project scheduling, and problems of resource allocation.

  11. Japan and LPG



    About 20 million metric tonnes of Liquefied Petroleum Gases (LPG) are consumed each year in Japan, of which 14,5 million metric tonnes are imported from Saudi Arabia and United Arab Emirates. This paper presents LPG industry in Japan and gives informations on the present status: supply and demand, imports, market, distribution

  12. A critical review of the life sciences project management at Ames Research Center for the Spacelab Mission development test 3

    Helmreich, R. L.; Wilhelm, J. M.; Tanner, T. A.; Sieber, J. E.; Burgenbauch, S. F.


    A management study was initiated by ARC (Ames Research Center) to specify Spacelab Mission Development Test 3 activities and problems. This report documents the problems encountered and provides conclusions and recommendations to project management for current and future ARC life sciences projects. An executive summary of the conclusions and recommendations is provided. The report also addresses broader issues relevant to the conduct of future scientific missions under the constraints imposed by the space environment.

  13. Microelectronics in Japan

    Boulton, William R.


    The purpose of this JTEC study is to evaluate Japan's electronic manufacturing and packaging capabilities within the context of global economic competition. To carry out this study, the JTEC panel evaluated the framework of the Japanese consumer electronics industry and various technological and organizational factors that are likely to determine who will win and lose in the marketplace. This study begins with a brief overview of the electronics industry, especially as it operates in Japan today. Succeeding chapters examine the electronics infrastructure in Japan and take an in-depth look at the central issues of product development in order to identify those parameters that will determine future directions for electronic packaging technologies.

  14. Kirishima, Japan Images

    National Oceanic and Atmospheric Administration, Department of Commerce — The shield volcano consists of more than 20 eruptive centers over a 20 x 30 km area that also includes Japan's first national park. Sixty-nine eruptions have been...

  15. Spacelab 1 hematology experiment (INS103): Influence of space flight on erythrokinetics in man

    Leach, C. S.; Chen, J. P.; Crosby, W.; Dunn, C. D. R.; Johnson, P. C.; Lange, R. D.; Larkin, E.; Tavassoli, M.


    An experiment conducted on the 10-day Spacelab 1 mission aboard the ninth Space Shuttle flight in November to December 1983 was designed to measure factors involved in the control of erythrocyte turnover that might be altered during weightlessness. Blood samples were collected before, during, and after the flight. Immediately after landing, red cell mass showed a mean decrease of 9.3 percent in the four astronauts. Neither hyperoxia nor an increase in blood phosphate was a cause of the decrease. Red cell survival time and iron incorporation postflight were not significantly different from their preflight levels. Serum haptoglobin did not decrease, indicating that intravascular hemolysis was not a major cause of red cell mass change. An increase in serum ferritin after the second day of flight may have been caused by red cell breakdown early in flight. Erythropoietin levels decreased during and after flight, but preflight levels were high and the decrease was not significant. The space flight-induced decrease in red cell mass may result from a failure of erythropoiesis to replace cells destroyed by the spleen soon after weightlessness is attained.

  16. Gaseous environment of the Shuttle early in the Spacelab 2 mission

    Pickett, Jolene S.; Murphy, Gerald B.; Kurth, William S.


    A cold-cathode ionization gage was flown on Space Shuttle flight STS-5IF as part of the Spacelab 2 payload. Neutral pressure data that were taken in the payload bay during the first few hours on orbit are presented. These data show that when the payload bay is oriented such that the atmospheric gases are ramming into it, the pressure rises to a peak of 4 x 10 to the -6th Torr. Pressure is also slightly higher during the sunlit portion of each orbit. Outgassing of the payload bay causes the pressure to be elevated to a few times 10 to the -6th Torr early in the mission. In addition, several effects on pressure have been identified that are due to chemical releases. Substantial increases (50-150 percent) are seen during another experiment's gas purge. Orbiter chemical-release effects include: pressure increases of 200 percent up to 7 x 10 to the -6th Torr due to Orbital Maneuvering System burns, minor perturbations in pressure due to vernier thruster firings and little or no increase in pressure due to water dumps. In the case of vernier thruster firings, effects are seen only from down-firing thrusters in the back of the Orbiter, which are probably due to reflection of thruster gases off Orbiter surfaces.

  17. Salivary gland ultrastructure and cyclic AMP-dependent reactions in Spacelab 3 rats

    Mednieks, M.I.; Hand, A.R.


    Environmental stimuli influencing catecholamine levels induce changes in cyclic AMP-dependent reactions and cell morphology in the rat parotid. Responses of salivary glands to spaceflight were determined by measurement of cyclic AMP-mediated reactions in fresh-frozen salivary glands and by microscopic evaluation of ultrastructure in fixed parotid glands. Decreased cell-free protein phosphorylation, determined by autoradiography, occurred in parotid glands in three of five flight animals. Protein kinase activity ratios were decreased in the soluble and increased in the particulate fractions of Spacelab 3 (SL-3) rat sublingual glands, compared with ground controls. Biochemical analyses show that effects of space flight on salivary glands are similar to those induced experimentally by physiological manipulation or alteration of catecholamine levels. Morphological evaluation of three SL-3 rat parotid glands showed increased numbers of lysosomes, autophagic vacuoles containing degenerating secretory product, and accumulation of lipid droplets. Since these animals lost weight, consistent with disruption of food and water consumption, morphological changes may in part be due to decreased masticatory stimulation, as occurs with reduced food intake or a liquid diet. The observed changes may reflect physiological responses of the gastrointestinal and autonomic systems to effects of spaceflight

  18. Communication network for decentralized remote tele-science during the Spacelab mission IML-2

    Christ, Uwe; Schulz, Klaus-Juergen; Incollingo, Marco


    The ESA communication network for decentralized remote telescience during the Spacelab mission IML-2, called Interconnection Ground Subnetwork (IGS), provided data, voice conferencing, video distribution/conferencing and high rate data services to 5 remote user centers in Europe. The combination of services allowed the experimenters to interact with their experiments as they would normally do from the Payload Operations Control Center (POCC) at MSFC. In addition, to enhance their science results, they were able to make use of reference facilities and computing resources in their home laboratory, which typically are not available in the POCC. Characteristics of the IML-2 communications implementation were the adaptation to the different user needs based on modular service capabilities of IGS and the cost optimization for the connectivity. This was achieved by using a combination of traditional leased lines, satellite based VSAT connectivity and N-ISDN according to the simulation and mission schedule for each remote site. The central management system of IGS allows minimization of staffing and the involvement of communications personnel at the remote sites. The successful operation of IGS for IML-2 as a precursor network for the Columbus Orbital Facility (COF) has proven the concept for communications to support the operation of the COF decentralized scenario.

  19. Statistical properties of solar granulation from the SOUP instrument on Spacelab 2

    Topka, K.; Title, A.; Tarbell, T.; Ferguson, S.; Shine, R.


    The Solar Optical Universal Polarimeter (SOUP) on Spacelab 2 collected movies of solar granulation completely free from atmospheric blurring, and are not degraded by pointint jitter (the pointing stability was 0.003 sec root mean square). The movies illustrate that the solar five minute oscillation has a major role in the appearance of solar granulation and that exploding granules are a common feature of the granule evolution. Using 3-D Fourier filtering techniques the oscillations were removed and it was demonstrated that the autocorrelation lifetime of granulation is a factor of two greater in magnetic field regions than in field-free quiet sun. Horizontal velocities were measured and flow patterns were observed on the scale of meso- and super granulation. In quiet regions the mean flow velocity is 370 m/s while in the magnetic regions it is about 125 m/s. It was also found that the root mean square (RMS) fluctuating horizonal velocity field is substantially greater in quiet sun than in strong magnetic field regions. By superimposing the location of exploding granules on the average flow maps it was found that they appear almost exclusively in the center of mesogranulation size flow cells. Because of the nonuniformity of the distribution of exploding granules, the evolution of the granulation pattern in mesogranule cell centers and boundaries differs fundamentally. It is clear from this study there is neither a typical granule nor a typical granule evolution

  20. Statistical properties of solar granulation from the SOUP instrument on Spacelab 2

    Topka, K.; Title, A.; Tarbell, T.; Ferguson, S.; Shine, R.


    The Solar Optical Universal Polarimeter (SOUP) on Spacelab 2 collected movies of solar granulation completely free from atmospheric blurring, and are not degraded by pointint jitter (the pointing stability was 0.003 sec root mean square). The movies illustrate that the solar five minute oscillation has a major role in the appearance of solar granulation and that exploding granules are a common feature of the granule evolution. Using 3-D Fourier filtering techniques the oscillations were removed and it was demonstrated that the autocorrelation lifetime of granulation is a factor of two greater in magnetic field regions than in field-free quiet sun. Horizontal velocities were measured and flow patterns were observed on the scale of meso- and super granulation. In quiet regions the mean flow velocity is 370 m/s while in the magnetic regions it is about 125 m/s. It was also found that the root mean square (RMS) fluctuating horizonal velocity field is substantially greater in quiet sun than in strong magnetic field regions. By superimposing the location of exploding granules on the average flow maps it was found that they appear almost exclusively in the center of mesogranulation size flow cells. Because of the nonuniformity of the distribution of exploding granules, the evolution of the granulation pattern in mesogranule cell centers and boundaries differs fundamentally. It is clear from this study there is neither a typical granule nor a typical granule evolution.

  1. Mobile Marketing in Japan

    Noah H. N. Lynn; Paul D. Berger


    In this paper we describe the state of mobile marketing in Japan. We consider the various aspects of mobile marketing in Japan and what has led to the overwhelming adoption by Japanese youth, and to a degree Japanese society as a whole, of social media and associated activities. This growth of mobile marketing has dramatic, positive implications for marketing, in general, as well as for the sale of selected product classes. We also consider markers for suggesting what the future of mobile mar...

  2. In Defense of Japan


    potential addition of F-35B STOVL aircraft to their Izumo class helicopter destroyers is a good example. Japan’s conduct during World War II remain locked ...antiwar and antinuclear identity . But after sixty years, Japan’s neighbors still see bayoneted babies. Relations between Japan and its former victims...and the world order Robert Cooper defines Japan as the lone post-modern country surrounded by states firmly locked into an earlier age and that if

  3. Industrial lasers in Japan

    Karube, Norio


    I am to report on some aspects of industrial lasers in Japan. Mostly centering on the market. In Japan, the history of laser developnent is rather profound. And long. Ever since the first invention of the laser in this country in 1960. This is partly because of the fact that in Japan the spectroscopic studies of the ruby was very popular in the late 1950's. Ever since niost of the work has been done in the research laboratories of the industry, not in the universities or not in the governmental laboratories. And since that time our first activity was mainly centering on the basic research, but after that time we have the evolution of the technology. One of the features in Japan is that the activity of developement and research of laser technology from the very basic phase up to the present commercialization has been done by the same group of people, including ine. We had a national project which ended about six years ago which was sponsored by MITI. MITI is Ministry of International Trade and Industry in Japan. And because of this national project, the effect of this project had a very enlightening effect in Japan. And after that our Japanese laser market became very flourishing.

  4. Japan steel mill perspective

    Murase, K. [Kobe Steel Ltd., Tokyo (Japan)


    The international and Japan's steel industry, the coking coal market, and Japan's expectations from Canada's coal industry are discussed. Japan's steel mills are operating at full capacity. Crude steel production for the first half of 2004 was 55.8 million tons. The steel mills are profitable, but costs are high, and there are difficulties with procuring raw materials. Japan is trying to enhance the quality of coke, in order to achieve higher productivity in the production of pig iron. Economic growth is rising disproportionately in the BRICs (Brazil, Russia, India, and China), with a large increase in coking coal demand from China. On the supply side, there are several projects underway in Australia and Canada to increase production. These include new developments by Elk Valley Coal Corporation, Grande Cache Coal, Western Canadian Coal, and Northern Energy and Mining in Canada. The Elga Mine in the far eastern part of Russia is under development. But the market is expected to remain tight for some time. Japan envisions Canadian coal producers will provide a stable coal supply, expansion of production and infrastructure capabilities, and stabilization of price. 16 slides/overheads are included.

  5. Development of user guidelines for ECAS display design. Volume 2: Tasks 9 and 10. [educating the public to the benefits of spacelab and the space transportation system

    Bathurst, D. B.


    Lay-oriented speakers aids, articles, a booklet, and a press kit were developed to inform the press and the general public with background information on the space transportation system, Spacelab, and Spacelab 1 experiments. Educational materials relating to solar-terrestrial physics and its potential benefits to mankind were also written. A basic network for distributing audiovisual and printed materials to regional secondary schools and universities was developed. Suggested scripts to be used with visual aids describing materials science and technology and astronomy and solar physics are presented.

  6. Monitoring Of The Middle Atmosphere: Grille Spectrometer Experiment Results On Board SPACELAB 1 And Scientific Program Of ATLAS 1 Mission

    Papineau, N.; Camy-Peyret, C.; Ackerman, Marcel E.


    Measurements of atmospheric trace gases have been performed during the first Spacelab mission on board the Space Shuttle. The principle of the observations is infrared absorption spectroscopy using the solar occultation technique. Infrared absorption spectra of NO, CO, CO2, NO2, N20, CH4 and H2O have been recorded using the Grille spectrometer developped by ONERA and IASB. From the observed spectra, vertical profiles for these molecules have been derived. The present paper summarizes the main results and compares them with computed vertical profiles from a zonally averaged model of the middle atmosphere. The scientific objectives of the second mission, Atlas 1, planned for 1990 are also presented.

  7. Critical review of Ames Life Science participation in Spacelab Mission Development Test 3: The SMD 3 management study

    Helmreich, R.; Wilhelm, J.; Tanner, T. A.; Sieber, J. E.; Burgenbauch, S.


    A management study was conducted to specify activities and problems encountered during the development of procedures for documentation and crew training on experiments, as well as during the design, integration, and delivery of a life sciences experiment payload to Johnson Space Center for a 7 day simulation of a Spacelab mission. Conclusions and recommendations to project management for current and future Ames' life sciences projects are included. Broader issues relevant to the conduct of future scientific missions under the constraints imposed by the environment of space are also addressed.

  8. A Decade of Life Sciences Experiment Unique Equipment Development for Spacelab and Space Station, 1990-1999

    Savage, Paul D.; Connolly, J. P.; Navarro, B. J.


    Ames Research Center's Life Sciences Division has developed and flown an extensive array of spaceflight experiment unique equipment (EUE) during the last decade of the twentieth century. Over this ten year span, the EUE developed at ARC supported a vital gravitational biology flight research program executed on several different platforms, including the Space Shuttle, Spacelab, and Space Station Mir. This paper highlights some of the key EUE elements developed at ARC and flown during the period 1990-1999. Resulting lessons learned will be presented that can be applied to the development of similar equipment for the International Space Station.

  9. Japan's nuclear juggernaut

    Richner, S.


    A summary of nuclear energy in Japan is presented. Nuclear energy provides 17% of Japan's electricity but could provide much more. 25 more reactors (to add to the existing 27) are planned by 1995. The cooperation between Japanese government and industry and the economic assistance in building new plants means that these are not likely to be cancelled. Public acceptance of new plants has often been obtained by large cash employment inducements. Now, however, there is growing disillusionment when short-term well paid employment building the reactors is followed by unemployment when the reactor is in operation. Also there is a growing opposition to the storage of the nuclear waste. To maintain the growth of its nuclear industry Japan needs to export to provide a steady flow of big orders. (U.K.)

  10. Japan's advanced medicine.

    Sho, Ri; Narimatsu, Hiroto; Murakami, Masayasu


    Like health care systems in other developed countries, Japan's health care system faces significant challenges due to aging of the population and economic stagnation. Advanced medicine (Senshin Iryou) is a unique system of medical care in Japan offering highly technology-driven medical care that is not covered by public health insurance. Advanced medicine has recently developed and expanded as part of health care reform. Will it work? To answer this question, we briefly trace the historical development of advanced medicine and describe the characteristics and current state of advanced medical care in Japan. We then offer our opinions on the future of advanced medicine with careful consideration of its pros and cons. We believe that developing advanced medicine is an attempt to bring health care reform in line rather than the goal of health care reform.

  11. The internationalization of Japan

    Kuroki, T.E.


    There are growing tensions and frictions between the U.S. and Japan. Among them are science and technology issues that relate to the development of superconductor technology, as well as economic, trade and agricultural issues. The structure of this friction is very complex. There are many interconnected issues that cannot be resolved one by one. This article focuses on the relationship between the U.S. and Japan. Some of the complexities behind the issues are discussed by defining different notions of internationalization and by presenting the positive and negative aspects of the Japanese approach that affects the future cooperation and competition between our nations in the area of superconductivity

  12. Divorce in contemporary Japan.

    Fukurai, H; Alston, J


    Data from the 1985-86 Japanese census are analysed to explore the determinants of the divorce rates in Japan's forty-seven prefectures, using two theoretical models: (a) the social integration model, which is shown to have a greater utility in predicting Japanese divorce levels than (b), the human capital model. Female emigration patterns play a significant role in affecting the divorce rate. Population increase and net household income are also important predictors of the Japanese divorce rate and urbanization has a great influence in modern Japan. Demographic and aggregate variables such as migration, urbanization, and socioeconomic factors are useful when organized under a social integration model.

  13. Liquid hydrogen in Japan

    Yasumi, S. [Iwatani Corp., Osaka (Japan). Dept. of Overseas Business Development


    Japan's Iwatani Corporation has focused its attention on hydrogen as the ultimate energy source in future. Unlike the United States, hydrogen use and delivery in liquid form is extremely limited in the European Union and in Japan. Iwatani Corporation broke through industry stereotypes by creating and building Hydro Edge Co. Ltd., Japan's largest liquid hydrogen plant. It was established in 2006 as a joint venture between Iwatani and Kansai Electric Power Group in Osaka. Hydro Edge is Japan's first combined liquid hydrogen and ASU plant, and is fully operational. Liquid oxygen, liquid nitrogen and liquid argon are separated from air using the cryogenic energy of liquefied natural gas fuel that is used for power generation. Liquid hydrogen is produced efficiently and simultaneously using liquid nitrogen. Approximately 12 times as much hydrogen in liquid form can be transported and supplied as pressurized hydrogen gas. This technology is a significant step forward in the dissemination and expansion of hydrogen in a hydrogen-based economy.

  14. Language Testing in Japan.

    Brown, James Dean, Ed.; Yamashita, Sayoko Okada, Ed.

    Papers on second language testing in Japan include: "Differences Between Norm-Referenced and Criterion-Referenced Tests" (James Dean Brown); "Criterion-Referenced Test Construction and Evaluation" (Dale T. Griffe); "Behavioral Learning Objectives as an Evaluation Tool" (Judith A. Johnson); "Developing Norm-…

  15. Dutch surgery in Japan

    van Gulik, Thomas M.; Nimura, Yuji


    An isolation policy was adopted in feudal Japan from 1639 to 1853 owing to the fear of foreign influence. During those 200 years of isolation, all foreigners were withheld from the country with the exception of the Dutch, who were permitted to establish a trading post on a small island in the Bay of

  16. Globalization in Japan

    Roesgaard, Marie Højlund


    Abstract for Nichibunken Copenhagen Symposium August 2012 Globalization in Japan – the case of moral education. 日本とグローバル化 - 道徳教育の件 Marie H. Roesgaard, Department of Cross-Cultural and Regional Studies, University of Copenhagen. This paper attempts to trace the history of global influence on Japan......Abstract for Nichibunken Copenhagen Symposium August 2012 Globalization in Japan – the case of moral education. 日本とグローバル化 - 道徳教育の件 Marie H. Roesgaard, Department of Cross-Cultural and Regional Studies, University of Copenhagen. This paper attempts to trace the history of global influence...... adjusting to those of the global currents that cannot be ignored. Further, I would suggest that global, or at least Western, influence is not a new thing in regard to moral education in Japan. The paper will provide an historical overview of the development of moral education since Meiji times and focus...

  17. China, South Korea, Japan



    Intended for Canadian readers, this popular account was suggested by the Sixth Pacific Basin Nuclear Conference. Economic, political, geographic, sociological and historical aspects of the nuclear programmes of China, South Korea and Japan are discussed. The importance of past, present and future Canadian nuclear trade with the area is indicated

  18. Japan's electronic packaging technologies

    Tummala, Rao R.; Pecht, Michael


    The JTEC panel found Japan to have significant leadership over the United States in the strategic area of electronic packaging. Many technologies and products once considered the 'heart and soul' of U.S. industry have been lost over the past decades to Japan and other Asian countries. The loss of consumer electronics technologies and products is the most notable of these losses, because electronics is the United States' largest employment sector and is critical for growth businesses in consumer products, computers, automobiles, aerospace, and telecommunications. In the past there was a distinction between consumer and industrial product technologies. While Japan concentrated on the consumer market, the United States dominated the industrial sector. No such distinction is anticipated in the future; the consumer-oriented technologies Japan has dominated are expected to characterize both domains. The future of U.S. competitiveness will, therefore, depend on the ability of the United States to rebuild its technological capabilities in the area of portable electronic packaging.

  19. Japan's plutonium economy

    Hecht, M.M.


    Japan's plutonium economy is based on the most efficient use of nuclear energy, as envisioned under the Atoms for Peace program of the 1950s and 1960s. The nuclear pioneers assumed that all nations would want to take full advantage of atomic energy, recycling waste into new fuel to derive as much energy as possible from this resource

  20. Nuclear power development in Japan

    Sugawara, A.


    Energy situation in Japan and Japan's strategy for stable supply of energy are discussed. Benefits of nuclear power in comparison with other energy sources is considered. History of nuclear power development in Japan, modern status and future trends are described. 6 figs

  1. Phase B: Final definition and preliminary design study for the initial Atmospheric Cloud Physics Laboratory (ACPL): A spacelab mission payload. Final review (DR-MA-03)

    Clausen, O. W.


    Systems design for an initial atmospheric cloud physics laboratory to study microphysical processes in zero gravity is presented. Included are descriptions of the fluid, thermal, mechanical, control and data, and electrical distribution interfaces with Spacelab. Schedule and cost analysis are discussed.

  2. The Evolution of Spacelab Ultraviolet Astronomy Missions from OSS-3 through -7 to Astro-1

    Gull, Theodore


    In the 1960s and 1970s, NASA was building towards a robust program in space astronomy. An evolutionary step from ground-based astronomy to space astronomy was human operation of space telescopes as astronomy in general evolved from astronomers directly at the telescope to application of computers and long distance communications to control to operate remote telescopes. Today ground-based telescopes and space observatories from cubesats to the Hubble Space Telescope and soon the James Webb Space Telescope are routinely operated remotely.In response to the Spacelab Announcement of Opportunity in the early 1980s, three ultraviolet experiments – the Hopkins Ultraviolet Telescope, the Ultraviolet Imaging Telescope and the Wisconsin Ultraviolet PhotoPolarimetry Experiment -- all instruments derived from multiple sounding rocket flights--were selected to fly as an integrated payload attached to a space shuttle. The justification for professional astronomers, both as Mission Specialists from the astronaut cadre and Payload Specialists from the instrument teams, was built to ensure key technical skills both of the science and the instruments. Bundled together as OSS-3 through -7 flights focused on Comet Halley, the experiments went through many changes and delays as a pathfinder for an anticipated series of attached astronomy payloads.By 1986, the five-flight mission had evolved into two missions, Astro-1 dedicated primarily to observe Halley’s Comet in early March 1986 and Astro-2 to fly about one year later. Due to the Challenger disaster 35 days before scheduled launch of Astro-1, the mission went through an initial cancellation and then re-scheduling once the instrument complement of Astro-1 was expanded to include Broad Band X-ray Telescope with emphasis on studying SN1987A. Ultimately Astro-1 flew in December 1990 partnered with an X-ray experiment focused on SN1987A.The nine-day mission was mostly successful despite multiple technical issues overcome by the NASA

  3. [Gambling disorder in Japan].

    Tanabe, Hitoshi


    Gambling disorder is a psychiatric disorder characterized by persistent and recurrent problematic gambling behavior, associated with impaired functioning, reduced quality of life, and frequent divorce and bankruptcy. Gambling disorder is reclassified in the category Substance-Related and Addictive Disorders in the DSM-5 because its clinical features closely resemble those of substance use disorders, and gambling activates the reward system in brain in much the same way drugs do. Prevalence of gambling disorder in Japan is high rate because of slot machines and pachinko game are very popular in Japan. The author recommend group psychotherapy and self-help group (Gamblers Anonymous), because group dynamics make them accept their wrongdoings related to gambling and believe that they can enjoy their lives without gambling.

  4. Future accelerators in Japan

    Toge, Nobu


    This paper presents a brief report on the present status of future accelerator projects at the National Laboratory for High Energy Physics (KEK), Japan. The KEK laboratory has been successfully operating the TRISTAN accelerator complex since 1986. It consists of a 2.5 GeV electron/positron linac, an 8 GeV Accumulation Ring (AR) and a 29 GeV Main Ring (MR). Concurrently with this operation, in response to recommendations by the Japanese High Energy Physics Committee, survey studies have been continued on new accelerator facilities at KEK. They have two major future projects, namely, the asymmetric e + e - B-factory based on TRISTAN (TRISTAN-II) and the Japan Linear Collider (JLC). The purpose of this paper is to outline those research activities and to present an update on their status

  5. Safeguards activities in Japan

    Osabe, Takeshi


    Current Japanese State System for Accountancy and Control (SSAC) has been developing and fully satisfies requirements of both IAEA Safeguards and bilateral partners. However, the public attention on the national and international safeguards activities were increased and the safeguards authorities were required to promote the objective assessment of safeguards implementation to avoid mistrust in safeguards activities which directly influence the public acceptance of nuclear energy in itself. Additionally, since Japan has promoted to complete nuclear fuel cycle including spent fuel reprocessing, enrichment and mixed oxide fuel fabrication this would require further assurance of Japanese non-proliferation commitment. Japan supports the introduction of strengthened safeguards. In this context it is particularly important to strengthen the relationship between national and the IAEA safeguards to contribute actively to the IAEA safeguards in development and utilization of new technologies towards more effective and efficient IAEA safeguards

  6. Japan Accelerator Conference



    At the international level, the high energy accelerator scene evolves rapidly and the International Conference on High Energy Accelerators is where its strong pulse can best be felt. This year, the Conference was held for the first time in Japan, with the 14th meeting in the series having been hosted in August by the Japanese KEK National Laboratory for High Energy Physics, Tsukuba. The venue was a recognition of the premier accelerator physics and technology status achieved by this diligent nation

  7. Japan Accelerator Conference



    At the international level, the high energy accelerator scene evolves rapidly and the International Conference on High Energy Accelerators is where its strong pulse can best be felt. This year, the Conference was held for the first time in Japan, with the 14th meeting in the series having been hosted in August by the Japanese KEK National Laboratory for High Energy Physics, Tsukuba. The venue was a recognition of the premier accelerator physics and technology status achieved by this diligent nation.

  8. Nuclear situation in Japan


    This analysis takes stock on the nuclear situation in Japan. It discusses the ambitious equipment program in collaboration with the France, the destabilization of the japanese nuclear industry following the accidents and the energy policy evolutions. It presents the projects of the japanese nuclear industry: the Monju reactor restart, the Pluthermal project, the reprocessing power plant of Rokkasho Mura, the new reactors, the russian weapons dismantling, the ITER site selection and the buy out of Westinghouse by Toshiba. (A.L.B.)

  9. Japan's fuel recycling policy



    The Atomic Energy Commission (AEC) has formulated Japanese nuclear fuel recycling plan for the next 20 years, based on the idea that the supply and demand of plutonium should be balanced mainly through the utilization of plutonium for LWRs. The plan was approved by AEC, and is to be incorporated in the 'Long term program for development and utilization of nuclear energy' up for revision next year. The report on 'Nuclear fuel recycling in Japan' by the committee is characterized by Japanese nuclear fuel recycling plan and the supply-demand situation for plutonium, the principle of the possession of plutonium not more than the demand in conformity with nuclear nonproliferation attitude, and the establishment of a domestic fabrication system of uranium-plutonium mixed oxide fuel. The total plutonium supply up to 2010 is estimated to be about 85 t, on the other hand, the demand will be 80-90 t. The treatment of plutonium is the key to the recycling and utilization of nuclear fuel. By around 2000, the private sector will commercialize the fabrication of the MOX fuel for LWRs at the annual rate of about 100 t. Commitment to nuclear nonproliferation, future nuclear fuel recycling program in Japan, MOX fuel fabrication system in Japan and so on are reported. (K.I.)

  10. Psychology in Japan.

    Imada, Hiroshi; Tanaka-Matsumi, Junko


    The purpose of this article is to provide information about Japan and its psychology in advance of the 31st International Congress of Psychology (ICP), to be held in Yokohama, Japan, in 2016. The article begins with the introduction of the Japanese Psychological Association (JPA), the hosting organization of the ICP 2016, and the Japanese Union of Psychological Associations consisting of 51 associations/societies, of which the JPA is a member. This is followed by a brief description of a history of psychology of Japan, with emphasis on the variation in our approach to psychology in three different periods, that is, the pre- and post-Pacific War periods, and the post-1960 period. Next, the international contributions of Japanese psychology/psychologists are discussed from the point of view of their visibility. Education and training in psychology in Japanese universities is discussed with a final positive remark about the long-awaited enactment of the Accredited Psychologist Law in September, 2015. © 2016 International Union of Psychological Science.

  11. Use of a FORTH-based PROLOG for real-time expert systems. 1: Spacelab life sciences experiment application

    Paloski, William H.; Odette, Louis L.; Krever, Alfred J.; West, Allison K.


    A real-time expert system is being developed to serve as the astronaut interface for a series of Spacelab vestibular experiments. This expert system is written in a version of Prolog that is itself written in Forth. The Prolog contains a predicate that can be used to execute Forth definitions; thus, the Forth becomes an embedded real-time operating system within the Prolog programming environment. The expert system consists of a data base containing detailed operational instructions for each experiment, a rule base containing Prolog clauses used to determine the next step in an experiment sequence, and a procedure base containing Prolog goals formed from real-time routines coded in Forth. In this paper, we demonstrate and describe the techniques and considerations used to develop this real-time expert system, and we conclude that Forth-based Prolog provides a viable implementation vehicle for this and similar applications.

  12. Effects of rectilinear acceleration, caloric and optokinetic stimulation of human subjects in the Spacelab D-1 mission

    Wetzig, J.; von Baumgarten, R.

    A set of vestibular experiments was performed during the course of the German Spacelab D-1 mission from 30 October to 6 November 1985 by a consortium of experimenters from various european countries. Similar to the Spacelab SL-1 mission all of the scientific crew members were theoretically and practically trained for the experiments. Baseline measurements for all tests were collected 113, 86, 44, 30 and 18 days prior to the mission and compared with data taken inflight, on the landing day and the consecutive 7 to 14 days. The hardware comprised mainly a motordriven accelerating platform, the SPACE SLED, and the vestibular helmet, a multi-purpose instrument in support of a variety of vestibular experiments including air-calorisation of the ears, optokinetic stimulation pattern presentation and optical and nystagmographic recording of eye movements. Measurements of the threshold for the perception of detection of whole body movement did not reveal any dramatic changes in the 2 measured axes inflight when compared to preflight values. Early postflight values show a significantly elevated threshold for all axes in 3 out of 4 subjects. The caloric nystagmus, already found during the SL-1 mission, was confirmed on all three tested subjects during the D-1 mission. It's amplitude and in some instances it's direction were influenced by horizontal acceleration on the SLED. The amplitude of optokinetic nystagmus increased when subjects were allowed to free-float over that seen when subjects were fixed. Stimulation of the neck receptors by roll movements of the body against the fixated head resulted in illusory object motion to the contralateral side. Torsional movements of the eyes during such neck receptor stimulation was present inflight and postflight, while it had not been observed preflight. Most results point to a reduction of otolithic effects in favour of visual and proprioceptive influences for spatial orientation.

  13. The graying of Japan.

    Martin, L G


    Japan's rapidly aging population has become a top policy issue, especially as the increasing costs of pensions and medical care are debated. With the highest life expectancy on earth, the Japanese potentially face long periods of retirement, as well as the possibility of long periods of disability. Although family support of the elderly is thought to have been strong traditionally, the recent decline in co-residence with children is 1 indication that the way support is given may be changing. This issue is of particular concern to the government, which wants to avoid any greater responsibility for the elderly than is necessary given the dramatic population aging yet to come. The government is also encouraging employers to provide more employment opportunities for the elderly at the same time that it is trying to raise the eligibility age for the receipt of public pensions. There is resistance on the part of employers, however, because wages and retirement allowances in Japan are positively related to length of employment. Furthermore, it is not clear whether elderly Japanese of the future will be as willing to work, if they learn to enjoy increased leisure early in their careers. Nevertheless, it is unlikely that population aging will lead to Japan's economic decline. Although the savings rate may decline somewhat, restructuring of the economy and continued overseas investment should keep the economy growing in the long run. Important in both the care of the frail elderly and the continued growth of the economy will be the roles played by middle-aged Japanese women.

  14. Skiing research in Japan.

    Watanabe, K


    Skiing and skiing techniques were introduced by the Austrians to Japanese soldiers in 1911. After that, skiing spread beyond the original purpose and recently produced the ski sciences. From a sports biomechanical aspect, the development of the study of ski jumping, alpine skiing, and the basic movement in skiing is introduced in this paper. One of the characteristic points of these studies in Japan was that the ski sciences were supported not only by biomechanists and physiologists, but also basically by physicists and engineers. The fundamental research and studies from divergent fields are supporting each other and being integrated into ski science.

  15. Nuclear services for Japan

    Anderson, B.


    The UK Atomic Energy Authority (UKAEA) became AEA Technology in April 1990. The commercial interests are focussed through 4 business units: AEA Reactor Services, with whom several contracts have been won from Japanese customers for high resolution Field Emission Gun Scanning Transmission Electron Microscopy (FEGSTEM); AEA Fuel Services, a contract is being negotiated with an existing Japanese customer; AEA Decommissioning and Radwaste, with whom further development of an alternative approach to evaporation of liquid waste effluent for specific application in Japan is in progress; AEA Fusion. 1 fig

  16. Nyheder i Japan

    Sejrup, Jens


    Kan man stole på, hvad folk siger, når man ikke ved, hvem de er? Forholdet mellem kildeanonymitet og troværdighed er forskelligt i mediesystemer rundt om i verden. Troværdighed er ingen universel størrelse, men en retorisk effekt der opstår på baggrund af faktorer som er kulturelt og systemisk in...... indlejret. I Japan har seriøse nyhedsmedier et specielt forhold til udsagn fra anonyme kilder, og udstrakt brug af uidentificerede informanter står ikke i modsætning til journalistisk kvalitet og pålidelighed....

  17. Japan country report

    Morisaki, Rieko [Energy Communication Planning, 3-9-16 Aobadai, 818-0137 Dazaifu (Japan)


    1. Nuclear 2007 highlights: - A magnitude 6.8 earthquake occurred in Niigata on July 16 2007. Owing to this earthquake, 3 units operating and 1 unit during start-up were shutdown automatically at TEPCO's Kashiwazaki-Kariwa NPS. Now, all 7 units of the NPS are in an outage for investigation. This influenced the capacity factor of Japanese NPPs in FY 2007, which stood at just 60.7%. - Debate on global warming is more and more active in Japan, as it is the host country of the G8 Hokkaido Toyako Summit in July. The Japan Atomic Energy Commission released 'White Paper on Nuclear Energy 2007' in March 2008. In the paper, they first expressed the view that the expansion of the peaceful use of nuclear energy is indispensable. 2. Nuclear overview: a. Energy policy: Electricity share: 25.4% of nuclear. The energy policy of Japan aims at nuclear power generation being maintained at the current level (30 to 40% of the total electricity generation) or increasing even after 2030, for stable energy supply and as a countermeasure against global warming. - Nuclear Fuel Cycle: The active tests at the JNFL reprocessing plant in Rokkasho-mura are in the final phase for commercial operation in 2008. By FY 2010 Plutonium utilization in LWRs in 16 to 18 NPP units. Around FY 2010 Installment of new centrifuges at the uranium enrichment plant at Rokkasho-mura. In FY 2012 Start of commercial operation of MOX fuel fabrication plant. Fast-breeder reactor cycle: Operation of the prototype reactor 'MONJU' has been suspended since a secondary sodium leak in 1995. JAEA (Japan Atomic Energy Agency) completed full-scale remodeling work and is implementing various tests to confirm the capabilities and soundness of MONJU. They aim to start its operation within FY 2008. Around 2025 Building a demonstration FBR. Before 2050 Development of a commercial FBR. - Electricity production (Operating): BWR: 32 units (including 4 units of APWR), PWR: 23 units. - Electricity production

  18. Positioning Indian Emigration to Japan

    D'Costa, Anthony


    as other IT-strong developing countries, are to supply technical talent, whose availability in Japan is constrained by the secular demographic crisis and changing educational and occupational preferences. The challenges for India are the institutional barriers, in particular, Japanese business practices...... that act as significant barriers to the entry of foreign skilled professionals. The paper brings out the source and pattern of foreign professionals and students in Japan as a proxy for talent. Though India’s presence in Japan is currently limited, its share of technical professionals to the total number....... For Japan, it means access to technical professionals and managed interfacing with the global economy....

  19. Legalized abortion in Japan.

    Hart, T M


    The enactment of the Eugenic Protection Act in Japan was followed by many changes. The population explosion was stemmed, the birth rate was halved, and while the marriage rate remained steady the divorce rate declined. The annual total of abortions increased until 1955 and then slowly declined. The highest incidence of abortions in families is in the 30 to 34 age group when there are four children in the family. As elsewhere abortion in advanced stages of pregnancy is associated with high morbidity and mortality. There is little consensus as to the number of criminal abortions. Reasons for criminal abortions can be found in the legal restrictions concerning abortion: Licensing of the abortionist, certification of hospitals, taxation of operations and the requirement that abortion be reported. Other factors are price competition and the patient's desire for secrecy. Contraception is relatively ineffective as a birth control method in Japan. Oral contraceptives are not yet government approved. In 1958 alone 1.1 per cent of married women were sterilized and the incidence of sterilization was increasing.

  20. Food irradiation in Japan

    Ito, Hitoshi


    The basic research on food irradiation in Japan was begun around 1955 by universities and national laboratories. In 1967, food irradiation was designated to the specific general research on atomic energy, and the national project on large scale was continued until 1983. As the result, the treatment of germination prevention for potatoes was approved by the Ministry of Health and Welfare in 1972. The Co-60 gamma ray irradiation facility of Shihoro Agricultural Cooperative is famous as the facility that succeeded in the practical use of food irradiation for the first time in the world. But the practical use of food irradiation stagnates and the research activities were reduced in Japan due to the circumstances thereafter. The effect of radiation to foods and living things is explained. The features of the radiation treatment of foods are small temperature rise, large transmissivity, no residue, the small loss of nutrition and large quantity, continuous treatment. The safety of irradiated foods is explained. The subjects for hereafter are discussed. (K.I.)

  1. Food Irradiation in Japan

    Kawabata, T.


    Since 1967 research activities on food irradiation in Japan have been carried out under the National Food Irradiation Programme by the Japanese Atomic Energy Commission. The programme has been concentrated on the technological and economical feasibility and wholesomeness testings of seven irradiated food items of economic importance to the country, i.e. potatoes, onions, wheat, rice, 'kamaboko' (fish-paste products), 'Vienna' sausages and mandarin oranges. By now most studies, including wholesomeness testings of these irradiated food items, have been completed. In Japan, all foods or food additives for sale are regulated by the Food Sanitation Law enforced in 1947. Based on studies made by the national programme, irradiated potatoes were given 'unconditional acceptance' for human consumption in 1972. At present, irradiated potatoes are the only food item which has so far been approved by the Minister of Health and Welfare. Unless the Minister of Health and Welfare has declared that items are not harmful to human health on obtaining comments from the Food Sanitation Investigation Council, no irradiated food can be processed or sold. In addition, the import of irradiated foodstuffs other than potatoes from foreign countries is prohibited by law.

  2. Barbarian medicine in feudal Japan.

    Fodstad, Harald; Hariz, Marwan I; Hirabayashi, Hidehiro; Ohye, Chihiro


    THE FIRST EUROPEANS to discover Japan were Portuguese traders who arrived in 1542. Fifteen years later, the Portuguese Jesuit priest and surgeon Luis De Almeida (1525-1583) founded the first Western hospital in Japan, for the care of lepers, syphilitics, and orphans. Because the hospital had a negative influence on the spread of Christianity, the Jesuits closed it in 1586. During the Tokugawa Shogunate (1600-1868), when Japan was secluded from the rest of the world, the only foreign physicians allowed to enter Japan were those employed by the Dutch factory at Dejima in Nagasaki. Only four of those physicians left behind seeds for the foundation of Western medicine in Japan, namely Caspar Schambergen, who founded a Japanese school of surgery in 1650; Engelbert Kämpfer, who visited Japan in 1691 to 1692; Carl Peter Thunberg, who botanically explored Japan in 1775 to 1776; and Philipp Franz Balthasar von Siebold, who practiced medicine in Nagasaki in 1823 to 1829 and 1859 to 1861. On the whole, Western medicine and surgery never established a real foothold in Japan until the fall of the shogunate and the restoration of the emperor in 1868.

  3. Recent developments: Japan and Australia



    Recent developments in the nuclear industry in Japan and Australia are briefly reviewed. Topics discussed include: the world energy situation; and nuclear power generation trends and completion the nuclear fuel cycle in Japan. Recent events that suggest possible policy changes in Australia are briefly discussed

  4. Generic antibiotics in Japan.

    Fujimura, Shigeru; Watanabe, Akira


    Generic drugs have been used extensively in many developed countries, although their use in Japan has been limited. Generic drugs reduce drug expenses and thereby national medical expenditure. Because generic drugs provide advantages for both public administration and consumers, it is expected that they will be more widely used in the future. However, the diffusion rate of generic drugs in Japan is quite low compared with that of other developed countries. An investigation on generic drugs conducted by the Ministry of Health, Labour and Welfare in Japan revealed that 17.2 % of doctors and 37.2 % of patients had not used generic drugs. The major reasons for this low use rate included distrust of off-patent products and lower drug price margin compared with the brand name drug. The generic drugs available in the market include external drugs such as wet packs, antihypertensive agents, analgesics, anticancer drugs, and antibiotics. Among them, antibiotics are frequently used in cases of acute infectious diseases. When the treatment of these infections is delayed, the infection might be aggravated rapidly. The pharmacokinetics-pharmacodynamics (PK-PD) theory has been adopted in recent chemotherapy, and in many cases, the most appropriate dosage and administration of antibiotics are determined for individual patients considering renal function; high-dosage antibiotics are used preferably for a short duration. Therefore, a highly detailed antimicrobial agent is necessary. However, some of the generic antibiotics have less antibacterial potency or solubility than the brand name products. We showed that the potency of the generic products of vancomycin and teicoplanin is lower than that of the branded drugs by 14.6 % and 17.3 %, respectively. Furthermore, we confirmed that a generic meropenem drug for injection required about 82 s to solubilize in saline, whereas the brand product required only about 21 s. It was thought that the cause may be the difference in size of bulk

  5. Spent fuel management in Japan

    Shirahashi, K.; Maeda, M.; Nakai, T.


    Japan has scarce energy resources and depends on foreign resources for 84% of its energy needs. Therefore, Japan has made efforts to utilize nuclear power as a key energy source since mid-1950's. Today, the nuclear energy produced from 49 nuclear power plants is responsible for about 31% of Japan's total electricity supply. The cumulative amount of spent fuel generated as of March 1995 was about 11,600 Mg U. Japan's policy of spent fuel management is to reprocess spent nuclear fuel and recycle recovered plutonium and uranium as nuclear fuel. The Tokai reprocessing plant continues stable operation keeping the annual treatment capacity or around 90 Mg U. A commercial reprocessing plant is under construction at Rokkasho, northern part of Japan. Although FBR is the principal reactor to use plutonium, LWR will be a major power source for some time and recycling of the fuel in LWRs will be prompted. (author). 3 figs

  6. 21 CFR 186.1555 - Japan wax.


    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Japan wax. 186.1555 Section 186.1555 Food and Drugs... Substances Affirmed as GRAS § 186.1555 Japan wax. (a) Japan wax (CAS Reg. No. 8001-39-6), also known as Japan... fruits of the oriental sumac, Rhus succedanea (Japan, Taiwan, and Indo-China), R. vernicifera (Japan...

  7. Japan and the global environment

    Miller, A.S.; Moore, C.


    In many areas, the word most often used to describe Japanese policy is open-quotes enigma.close quotes In some ways, Japan's record on environmental policy also has elements of mystery and contradiction. On the one hand, Japan's history and culture often are associated with a reverence for nature. Indeed, Japan does lead the world in certain environmental areas, such as reduction of conventional air pollutants and compensation of air pollution victims. On the other hand, Japan has been widely criticized for its poor record in preserving its domestic environment, contribution to tropical deforestation, and unwillingness to protect endangered species. Today, the international community clamors for Japan to take its share of responsibility, as an economic superpower, for the global environment. To secure its place in world affairs, Japan slowly has begun to respond to this pressure on issues ranging from ivory importation to reduction of CFC emissions. There is some hope that the government's particular willingness to address global warming may be a sign of significant changes to come in Japanese environmental policy. However, international pressure remains on the many environmental issues Japan has yet to resolve, including tropical deforestation and financing of Third World development projects that harm the environment. Japan's environmental policy is most effective when government and industry cooperate to find technical solutions to environmental problems. Although in recent years Japan's energy consumption has risen sharply, the Japanese have developed numerous technologies to reduce pollution and increase economic growth by improving energy efficiency. It is in these technologies that Japan has made the greatest strides and has the most to offer the global environment

  8. Moral Education in Japan

    Roesgaard, Marie Højlund

    ‘religion’ is not a subject in schools. So, how do the Japanese go about the business of teaching values and morality? Using the Japanese example, this volume looks at moral education from the basic point of view of universal and common human values, with due attention given to culture-specific traits...... in the legal frame work (the Fundamental Law on Education was revised in 2006) and the ministerial guidelines and policies (new curriculum guidelines have been issued after the law change, and new proposals for strengthening the position of moral education come on a regular basis) have reflected the increased......What is a ‘good’ person and how do we educate ‘good’ persons? This question of morality is central to any society and its government and educational system including the Japanese. In many societies it has been customary to teach about morality from a religious standpoint, but not so in Japan, where...

  9. Will Japan Rearm.


    Faculty Accepte d th is _________ day of~~~U)~4 l977~c~y.11 -~~~~~~~~~~~~D i rector , Master of Militar y Art Science . The opinions and...j~ s’ri : ‘~~~~ ~ IC . _ __~~~~~~ i 1~~~~~n Unhi ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 150 _ _ _ _ _ _ _ _ _ _ L~ MASTER OF MILITARY ART ... SCIENCE THESIS APPROVAL PAGE Name of Candidate Joseph Bertrand Berger, Jr. Major, Air Defense Artillery T it le of Thes i s W i l l Japan Rearm

  10. Typhoon Chataan off Japan


    Slowly winding its way down, Typhoon Chataan had dropped to tropical storm status by Thursday, July 11, 2002, when this image from the Moderate Resolution Imaging Spectroradiometer (MODIS) was captured. In the image, the storm is located off the east coast of central Japan in the Pacific Ocean. The storm is much less organized than it was in the previous day's image. Through a gap in the clouds to the southwest of the storm's eye, Tokyo can be seen as a grayish cluster of pixels surrounding a small bay or inlet that protrudes into the island of Honshu. Credit: Image courtesy Jesse Allen, NASA Earth Observatory; data provided by the MODIS Land Rapid Response Team

  11. Dosimetry studies in Japan

    Maruyama, T.; Kumamoto, Y.; Hashizume, T.


    In 1967 the National Institute of Radiological Sciences in Chiba estimated the radiation doses in air from the atomic bombing of Hiroshima and Nagasaki by using some building materials exposed to the nuclear explosions in both cities. These estimated doses were in good agreement with the doses estimated on the basis of the Ichiban project by the research group at Oak Ridge National Laboratory which were the basis for the Atomic Bomb Casualty Commission's tentative 1965 radiation dose (T65D). Recently the radiation doses in Hiroshima and Nagasaki have been reevaluated by Lawrence Livermore National Laboratory and Oak Ridge National Laboratory. In Japan a new research group was started last August, with the intention of making new estimates of doses from the atomic bombs in cooperation with US research groups

  12. Radiation processing in Japan

    Makuuchi, Keizo


    Economic scale of radiation application in the field of industry, agriculture and medicine in Japan in 1997 was investigated to compare its economic impacts with that of nuclear energy industry. Total production value of radiation application accounted for 54% of nuclear industry including nuclear energy industry and radiation applications in three fields above. Industrial radiation applications were further divided into five groups, namely nondestructive test, RI instruments, radiation facilities, radiation processing and ion beam processing. More than 70% of the total production value was brought about by ion beam processing for use with IC and semiconductors. Future economic prospect of radiation processing of polymers, for example cross-linking, EB curing, graft polymerization and degradation, is reviewed. Particular attention was paid to radiation vulcanization of natural rubber latex and also to degradation of natural polymers. (S. Ohno)

  13. Radiation processing in Japan

    Makuuchi, Keizo [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment


    Economic scale of radiation application in the field of industry, agriculture and medicine in Japan in 1997 was investigated to compare its economic impacts with that of nuclear energy industry. Total production value of radiation application accounted for 54% of nuclear industry including nuclear energy industry and radiation applications in three fields above. Industrial radiation applications were further divided into five groups, namely nondestructive test, RI instruments, radiation facilities, radiation processing and ion beam processing. More than 70% of the total production value was brought about by ion beam processing for use with IC and semiconductors. Future economic prospect of radiation processing of polymers, for example cross-linking, EB curing, graft polymerization and degradation, is reviewed. Particular attention was paid to radiation vulcanization of natural rubber latex and also to degradation of natural polymers. (S. Ohno)

  14. SCWR Concepts in Japan



    Two SCWR concepts are being developed in Japan, one corresponding to the thermal spectrum reactor and the other to the fast spectrum reactor. Yamada et al. described the thermal-spectrum reactor concept referred to as the Japan SCWR (or JSCWR). This concept was developed under the financial support of the Ministry of Economy, Trade and Industry (METI). The basic philosophy of the JSCWR development is to utilize proven light water reactor and supercritical fossil-fired power plant technologies as much as possible to minimize the R&D cost, time and risks. Therefore, the JSCWR is designed as a thermal neutron spectrum reactor using light water as moderator and reactor coolant. The JSCWR plant consists of a pressure-vessel type, once-through reactor and a direct Rankine cycle system. Reactor coolant fed through inlet nozzles is heated up in the core and flows through outlet nozzles with no recirculation in the vessel. Other options to the JSCWR core design are being investigated at the University of Tokyo. The electric output of the JSCWR is assumed to range from 600 MWe to 1700 MWe class to fulfill user’s requirements as much as possible. In this section, the reference value is selected to 1725 MWe, which corresponds to a reactor thermal output of 4039 MWth. Nakatsuka et al. described the core design for the fast-spectrum reactor, which is based on a similar plant system compared to that of the thermal-spectrum reactor. The fast-spectrum reactor, however, would produce higher power rating than the thermal-spectrum one of the same reactor pressure-vessel size. Since the fast-spectrum reactor does not require the moderator, its unit capital cost would be lower than the thermal-spectrum reactor.

  15. The Cogema group in Japan


    The partnership between the Cogema group and Japan in the domain of fuel cycle started about 20 years ago and the 10 Japanese nuclear operators are all clients of the Cogema group. The 1997 turnover realized with Japan reached 3.6 billions of francs (11% of the total turnover of the group). This short paper presents briefly the nuclear program of Japan (nuclear park, spent fuels reprocessing-recycling strategy) and the contracts between Cogema and the Japanese nuclear operators (natural uranium, uranium conversion and enrichment, spent fuel reprocessing, plutonium recycle and MOX fuel production markets). (J.S.)

  16. Whistleblowing in Japan.

    Davis, Anne J; Konishi, Emiko


    This article, written from research data, focuses on the possible meaning of the data rather than on detailed statistical reporting. It defines whistleblowing as an act of the international nursing ethical ideal of advocacy, and places it in the larger context of professional responsibility. The experiences, actions, and ethical positions of 24 Japanese nurses regarding whistleblowing or reporting a colleague for wrongdoing provide the data. Of these respondents, similar in age, educational level and clinical experience, 10 had previously reported another nurse and 12 had reported a physician for a wrongful act. These data raise questions about overt actions to expose a colleague in a culture that values group loyalty and saving face. Additional research is needed for an in-depth understanding of whistleblowing, patient advocacy and professional responsibility across cultures, especially those that value group loyalty, saving face and similar concepts to the Japanese Ishin Denshin, where the value is on implicit understanding requiring indirect communication. Usually, being direct and openly discussing sensitive topics is not valued in Japan because such behavior disrupts the most fundamental value, harmony (wa).

  17. Outage planning in Japan

    Nedderman, John.


    Nuclear plant operators in Japan are constrained to keep refuelling and maintenance outages to a minimum by the regulation limiting operating cycles to no longer than 13 months. Outage planning by two contrasting operators is described. Hokkaido Electric, which operates only one plant, Tomari, with two PWRs, plans to reduce outage time from the present 65 days in two stages. Detailed review of previous outage schedules has shown that a reduction to 59 days should be achievable by careful planning without any fundamental changes. The second reduction to 49 days will require such measures as relaxing water purity standards, rescheduling fuel unloading and loading shifts and speeding up eddy current testing of primary equipment by using steam generator nozzle dams. Kansai Electric, operating 11 PWRs at three plants, has scope for reducing outages at all of its units using a range of measures. Steam generator replacement in the seven oldest reactors, completed in July 1997, is by far the most significant of these and is expected to save 64 days repair time in a previous average outage time of 131 days. (UK)

  18. Radioactivity survey data in Japan


    Strontium-90 and cesium-137 in Japan were determined in rain and dry fallout, airborne dust, service water, total diet, rice, milk, vegetables, sea fish, shellfish, and seaweeds. The results were shown in tables. (J.P.N.)

  19. Nuclear power development in Japan

    Sugawara, A.


    The energy situation in Japan is briefly outlined. Vulnerability in energy structure of the country is shown by a comparison of primary energy supply patterns of Japan and Western countries. Japan's energy policy consists in reducing dependence on oil, promoting efficient use of energy and increasing use of non-fossil fuels. Nuclear power is a core of alternative energy for petroleum because of stable supply of nuclear fuel, low detrimental emissions and less dependence on the fuel. A short historical review of nuclear power development in Japan is presented. Some future issues as development of entire nuclear fuel cycle, social acceptance, reactor safety and nuclear power economics are also discussed. 6 figs. (R.T.)

  20. The Gamma-Ray Burst Polarimeter - POLAR onboard the China’s Spacelab “Tiangong-2”



    POLAR is a novel compact space-borne Compton polarimeter conceived for a precise measurement of hard X-ray/Gamma-ray polarization and optimized for the detection of the prompt emission of Gamma-Ray Bursts (GRB) in the energy range 50 - 500 keV. The future detailed measurement of the polarization of GRB will lead to a better understanding of its radiation region geometry and emission mechanisms. Thanks to its remarkable properties on large effective area, field of view (4.14 sr or 1/3 of the visible sky) and obvious modulation factor, POLAR will be able to reach a minimum detectable polarization (1-σ level) of about 3% for several GRB measurements per year. POLAR consists of 25 detector modular units (DMU). Each DMU is composed of 64 low-Z plastic scintillator bars, read out by a flat-panel multi-anode photomultipliers and ASIC front-end electronics. The incoming photons undergo Compton scattering in the bars and produce a modulation pattern. Simulations and hard X-ray synchrotron radiation experiments have shown that the polarization degree and angle can be retrieved from this pattern with the accuracy necessary for pinning down the GRB mechanisms. A full flight model of POLAR has been constructed, in view of a flight on the Chinese spacelab TG-2 expected in 2016. The design of POLAR, Monte-Carlo simulation analysis as well as the performance test results will be all addressed in details in this talk.

  1. Japan Sports Arbitration Agency (JSAA

    Ekaterina P. Rusakova


    Full Text Available In this article author analyzes the activities of Japan Sports Arbitration Agency. Author considers the goals, objectives and procedure for dealing with disputes relating to the use of performance-enhancing drugs by athletes. Author study the regulation of Japan Sports Arbitration Agency, to resolve disputes relating to the use of doping, as well as the procedure for application and acceptance of its agency, the choice of arbitrators, counterclaim, protection of evidence.

  2. The photovoltaic energy in Japan

    Georgel, O.


    Today the Japan is the leader of the photovoltaic energy. The first reason of this success is an action of the government integrating subventions for the installation of photovoltaic systems and a support of the scientific research. To explain this success, the author presents the energy situation in Japan, details the national programs, the industrial sector (market, silicon needs, recycling, manufacturers, building industry) and presents the main actors. (A.L.B.)

  3. Japan's approach to monetary policy

    Giovanni P. Olivei


    The goal of monetary policy as conducted by the Bank of Japan is to contribute to the sound development of the national economy through the pursuit of price stability. The objective of price stability, however, is not precisely defined as it has been for other central banks. Following the implementation of the new Bank of Japan Law in 1998, the monetary policy framework is characterized by central bank independence, the primacy of the price stability objective, instrument independence, and po...

  4. Nuclear power in Japan

    Kishida, J.


    The Japanese movement against nuclear energy reached a climax in its upsurge in 1988 two years after the Chernobyl accident. At the outset of that year, this trend was triggered by the government acknowledgement that the Tokyo market was open to foods contaminated by the fallout from Chernobyl. Anti-nuclear activists played an agitating role and many housewives were persuaded to join them. Among many public opinion surveys conducted at that time by newspapers and broadcasting networks, I would like to give you some figures of results from the poll carried out by NHK: Sixty percent of respondents said that nuclear power 'should be promoted', either 'vigorously' 7 or 'carefully' 53%). Sixty-six percent doubted the 'safety of nuclear power', describing it as either 'very dangerous' 20%) or 'rather dangerous' (46%). Only 27% said it was 'safe'. In other words, those who acknowledged the need for nuclear power were almost equal in number with those who found it dangerous. What should these figures be taken to mean? I would take note of the fact that nearly two-thirds of valid responses were in favor of nuclear power even at the time when public opinion reacted most strongly to the impact of the Chernobyl accident. This apparently indicates that the majority of the Japanese people are of the opinion that they would 'promote nuclear power though it is dangerous' or that they would 'promote it, but with the understanding that it is dangerous'. But the anti-nuclear movement is continuing. It remains a headache for both the government and the electric utilities. But we can regard the anti-nuclear movement in Japan as not so serious as that faced by other industrial nations

  5. Nuclear power in Japan

    Kishida, J [Japan Research Institute, Ltd., Tokyo (Japan)


    The Japanese movement against nuclear energy reached a climax in its upsurge in 1988 two years after the Chernobyl accident. At the outset of that year, this trend was triggered by the government acknowledgement that the Tokyo market was open to foods contaminated by the fallout from Chernobyl. Anti-nuclear activists played an agitating role and many housewives were persuaded to join them. Among many public opinion surveys conducted at that time by newspapers and broadcasting networks, I would like to give you some figures of results from the poll carried out by NHK: Sixty percent of respondents said that nuclear power 'should be promoted', either 'vigorously' 7 or 'carefully' 53%). Sixty-six percent doubted the 'safety of nuclear power', describing it as either 'very dangerous' 20%) or 'rather dangerous' (46%). Only 27% said it was 'safe'. In other words, those who acknowledged the need for nuclear power were almost equal in number with those who found it dangerous. What should these figures be taken to mean? I would take note of the fact that nearly two-thirds of valid responses were in favor of nuclear power even at the time when public opinion reacted most strongly to the impact of the Chernobyl accident. This apparently indicates that the majority of the Japanese people are of the opinion that they would 'promote nuclear power though it is dangerous' or that they would 'promote it, but with the understanding that it is dangerous'. But the anti-nuclear movement is continuing. It remains a headache for both the government and the electric utilities. But we can regard the anti-nuclear movement in Japan as not so serious as that faced by other industrial nations.

  6. Japan`s civil use of foreign military plutonium

    Suzuki, A. [Tokyo Univ. (Japan). Dept. of Quantum Engineering and Systems Sciences


    This paper is intended to propose one of the MOX options of international cooperation for safer and more secured management of excess military plutonium. The proposal was made with special reference to the Japanese public`s view. Owing to the domestic plutonium shortage anticipated soon after the 200 in Japan, some specific reactors will be available to get rid of foreign excess weapon plutonium. According to the Japan AEC`s new long-term programme, the shortage will be approximately 0.5 tonne of plutonium per annum, which is a sort of the least amount that Japan can buy from a certain external source. With international requests for a more positive Japanese contribution, however, the amount of Japanese purchase would be increased. It follows from the preliminary estimate shown in this paper that roughly 2 tonnes of plutonium can be burned annually in the reactors without any major modifications concerning safe reactor operation. (author) 10 refs.

  7. Radar Image, Hokkaido, Japan


    The southeast part of the island of Hokkaido, Japan, is an area dominated by volcanoes and volcanic caldera. The active Usu Volcano is at the lower right edge of the circular Lake Toya-Ko and near the center of the image. The prominent cone above and to the left of the lake is Yotei Volcano with its summit crater. The city of Sapporo lies at the base of the mountains at the top of the image and the town of Yoichi -- the hometown of SRTM astronaut Mamoru Mohri -- is at the upper left edge. The bay of Uchiura-Wan takes up the lower center of the image. In this image, color represents elevation, from blue at the lowest elevations to white at the highest. The radar image has been overlaid to provide more details of the terrain. Due to a processing problem, an island in the center of this crater lake is missing and will be properly placed when further SRTM swaths are processed. The horizontal banding in this image is a processing artifact that will be removed when the navigation information collected by SRTM is fully calibrated. This image was acquired by the Shuttle Radar Topography Mission (SRTM) aboard the Space Shuttle Endeavour, launched on February 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter-long (200-foot) mast, installed additional C-band and X-band antennas, and improved tracking and navigation devices. The mission is a cooperative project between the National Aeronautics and Space Administration (NASA), the National Imagery and Mapping Agency (NIMA) of the U.S. Department of Defense (DoD), and the German and Italian space agencies. It is managed by NASA's Jet Propulsion Laboratory, Pasadena, CA, for NASA's Earth Science Enterprise, Washington, DC. Size: 100 by 150 kilometers (62

  8. Urgent Safety Measures in Japan after Great East Japan Earthquake

    Taniura, W.; Otani, H.


    Due to tsunami triggered by the Great East Japan Earthquake on March 11, 2011, the operating and refueling reactor facilities at Fukushima Dai-ichi and Dai-ni Nuclear Power Plants of Tokyo Electric Power Co. caused a nuclear hazard. Japanese electric power companies voluntarily began to compile various urgent measures against tsunami within the week the hazard was caused. As for the urgent safety measures of each licensee, it is clarified that effective measures have been appropriately implemented as a result of the inspection of the national government, the verification based on the guideline of the Japan Society of Maintenology and the stress test. (author)

  9. The educational system in Japan

    Spearman, M. L.


    The rapid economic growth of Japan since World War II has resulted in Japan becoming a reference point for developing nations and the West. This remarkable growth results from a combination of factors, one of which has been unyielding attention to education in order to cultivate the human talent necessary to provide the productivity for economic growth. The Japanese education system emphasizes quality of instruction and rewards hard work. Some of the principles of the system are outlined together with a summary of the content of the curriculum, the quantity and quality of instruction, and the influence of culture and environment.

  10. Datafile: [nuclear power in] Japan



    Japan is third after the USA and France in terms of the Western World's installed nuclear capacity, but it has by far the largest forward programme. Great effort is also being put into the fuel cycle and advanced reactors. There is close co-operation between the government, utilities and manufacturers, but Japan has not sought to export reactors. The government has responded to the growing public opposition to nuclear power with a massive increase in its budget for public relations. Details of the nuclear power programme are given. (author)

  11. Local Government System in Japan

    Vladimir V. Redko


    Full Text Available The article is devoted to the issues of the activities of the local government of Japan. Particular attention is drawn to the legal framework and the material basis for the functioning of local self-government bodies. The system of local self-government is considered as a special form of self-government with a specific functional and meaning; system of municipal management and delegation of authority, as well as features of interaction between civil and imperious levels. The allocation of the city with a special status, as well as the financial structure of the local government of Japan, is considered in detail.

  12. JPRS Report, East Asia, Japan


    May 87) 17 Amada Technical Center 17 Punch-press Production in France, by Andreas Gandow 17 Study on Dynamics of Foreign Exchange Rates (Kenichi...468 20 ECONOMIC STUDY ON DYNAMICS OF FOREIGN EXCHANGE RATES Tokyo THE JAPAN TIMES in English 29 Jul 87 pp 7-9 (Article by Kenichi Ohmae] [Text

  13. Organic photovoltaic energy in Japan


    Japan finances research programs on photovoltaic conversion since 1974. Research in this domain is one of the 11 priorities of NEDO, the agency of means of the ministry of economy, trade and industry of Japan. The search for an abatement of production costs and of an increase of cells efficiency is mentioned in NEDO's programs as soon as the beginning of the 1990's. A road map has been defined which foresees photovoltaic energy production costs equivalent to the ones of thermal conversion by 2030, i.e. 7 yen/kWh (4.4 cents of euro/kWh). The use of new materials in dye-sensitized solar cells (DSSC) or organic solar cells, and of new structures (multi-junctions) is explored to reach this objective. The organic photovoltaic technology is more particularly considered for small generation units in mobile or domestic technologies. Japan is particularly in advance in the improvement of DSSC cells efficiency, in particular in the domain of the research on solid electrolytes. Europe seems more in advance in the domain of the new generation of organic solar cells. Therefore, a complementarity may be found between Japan and French teams in the domain of organic solar cells improvement through collaboration programs. (J.S.)

  14. Entrepreneurship and unemployment in Japan

    van Stel, A.; Thurik, R.; Verheul, I.; Baljeu, L.


    We examine the relationship between entrepreneurship (as measured by fluctuations in the business ownership rate) and unemployment in Japan for the period between 1972 and 2002. We find that, although Japan’s unemployment rate has been influenced by specific exogenous shocks, the effects of

  15. Superconducting magnet development in Japan

    Yasukochi, K.


    The present state of R and D works on the superconducting magnet and its applications in Japan are presented. On electrical rotating machines, 30 MVA superconducting synchronous rotary condenser (Mitsubishi and Fuji) and 50 MVA generator are under construction. Two ways of ship propulsion by superconducting magnets are developing. A superconducting magnetically levitated and linear motor propelled train ''MAGLEV'' was developed by the Japan National Railways (JNR). The superconducting magnet development for fusion is the most active field in Japan. The Cluster Test program has been demonstrated on a 10 T Nb 3 Sn coil and the first coil of Large Coil Task in IEA collaboration has been constructed and the domestic test was completed in JAERI. These works are for the development of toroidal coils of the next generation tokamak machine. R and D works on superconducting ohmic heating coil are in progress in JAERI and ETL. The latter group has constructed 3.8 MJ pulsed coil. A high ramp rate of changing field in pulsed magnet, 200 T/s, has been tested successfully. High Energy Physics Laboratory (KEK) are conducting active works. The superconducting μ meson channel and π meson channel have been constructed and are operating successfully. KEK has also a project of big accelerator named ''TRISTAN'', which is similar to ISABELLE project of BNL. Superconducting synchrotron magnets are developed for this project. The development of superconducting three thin wall solenoid has been started. One of them, CDF, is progressing under USA-Japan collaboration

  16. Radioactivity survey data in Japan


    Strontium-90 and cesium-137 in Japan were determined in rain and dry fallout, airborne dust, service water, freshwater, soils, total diet, milk, vegetables, tea, sea fish, freshwater fish, shellfish, and seaweeds. The results were shown in tables. (J.P.N.)

  17. Geothermal country update of Japan

    Higo, M.


    This paper reports on the status of geothermal energy in Japan. Topics covered include: present and planned production of electricity, present utilization of geothermal energy for direct heat, information about geothermal localities, and wells drilled for electrical utilization of geothermal resources to January 1, 1990

  18. JPRS Report, Science & Technology, Japan


    Sought ( Nobuaki Teraoka; PUROMETEUSU, Nov 87) 62 IPCR Molecular Laser Uranium Enrichment Method Discussed (GENSHIRYOKU IINKAI GEPPO, Nov 87... Kobayashi ) Investigation of Tokyo University character of winter (Professor Tatsuo thunder on Japan Kawamura, Sea side by new Assistant...PUROMETEUSU in Japanese Nov 87 pp 78-81 [Article by Nobuaki Teraoka, Technology Development Division, Atomic Energy Bureau, Science and Technology Agency

  19. [Marriage and divorce in Japan].

    Haderka, J


    Marriage patterns in Japan are analyzed using data from secondary sources. The author notes that although legislation affecting marriage and the family is derived from European models, traditional Japanese attitudes concerning the subservient role of women have a significant impact. The problems faced by women experiencing divorce are noted. (SUMMARY IN ENG AND RUS)

  20. U.S. Forces Japan

    Okinawa Fri, 25 May 2018 02:07:00 GMT Scuba Savior: 3d MLG Marine saves life in Okinawa Fri, 25 May 2018 by @USForcesJapan Facebook Facebook Followers, We hope you've brushed up on your USFJ knowledge over the weekend, b... Followers, We hope you've brushed up on your USFJ knowledge over the weekend

  1. July 1993 Hokkaido, Japan Images

    National Oceanic and Atmospheric Administration, Department of Commerce — On July 12, 1993, a magnitude 7.6 Ms (7.7 Mw) (HRV) earthquake at 13:17 UT in the Sea of Japan near Hokkaido caused a back-arc tsunami that caused damage in all of...

  2. Japan's new basic energy plan

    Duffield, John S.; Woodall, Brian


    In June 2010, the Japanese cabinet adopted a new Basic Energy Plan (BEP). This was the third such plan that the government has approved since the passage of the Basic Act on Energy Policy in 2002, and it represents the most significant statement of Japanese energy policy in more than four years, since the publication of the New National Energy Strategy (NNES) in 2006. Perhaps more than its predecessors, moreover, the new plan establishes a number of ambitious targets as well as more detailed measures for achieving those targets. Among the targets are a doubling of Japan's 'energy independence ratio,' a doubling of the percentage of electricity generated by renewable sources and nuclear power, and a 30 percent reduction in energy-related CO 2 emissions, all by 2030. This paper explains the origins of the 2010 BEP and why it was adopted. It then describes the content of the plan and how it differs from the NNES. A third section analyzes the appropriateness of the new goals and targets contained in the BEP and their feasibility, finding that achievement of many of the targets was likely to be quite challenging even before the March 2011 earthquake, tsunami, and nuclear crisis. - Highlights: → Origins of Japan's new Basic Energy Plan. → Content of Japan's new Basic Energy Plan. → Feasibility of achieving the targets in Japan's new Basic Energy Plan. → Impact of 2011 earthquake and tsunami on Japanese energy policy.

  3. 75 FR 38119 - Polychloroprene Rubber From Japan


    ... Rubber From Japan AGENCY: United States International Trade Commission. ACTION: Institution of a five-year review concerning the antidumping duty finding on polychloroprene rubber from Japan. SUMMARY: The... on polychloroprene rubber from Japan would be likely to lead to continuation or recurrence of...

  4. Legislative Basis of Pedagogical Education in Japan

    Kuchai, Tetiana


    Legal framework policy of Japan in the field of education has been analyzed. The problem of influence of legislative materials on the development of education in Japan, its legislative support has been considered. It has been defined that directive materials affect the development of education system in Japan. Legislation policy of the country is…

  5. Urban and spatial planning in Japan

    Marin Tominaga


    Full Text Available This paper aims to introduce the urban and spatial planning inJapan. According to the national planning system of Japan, chapter 2, the planning system has 3 administrative levels and each territorial region has its own regulation. This paper introduces especially about planning and regulation system in city region in Japan.

  6. Urgent Safety Measures in Japan after Great East Japan Earthquake

    Taniura, Wataru; Otani, Hiroyasu


    Due to tsunami triggered by the Great East Japan Earthquake, the operating and refueling reactor facilities at Fukushima Dai-ichi and Dai-ni Nuclear Power Plants caused a nuclear hazard. Given the fact, Japanese electric power companies voluntarily began to compile various urgent measures against tsunami. And then the Nuclear and Industrial Safety Agency (NISA) ordered the licensees to put into practice the voluntarily compiled urgent safety measures, in order to ensure the effectiveness of the means for recovering cooling functions along with avoiding the release of radioactive substances to the possible minimum, even if a huge tsunami following a severe earthquake hits nuclear power plants. The following describes the state and the effect of the urgent safety measures implemented for 44 reactors (under operation) and 1 reactor (under construction) in Japan and also describes the measures to be implemented by the licensees of reactor operation in the future.

  7. Dicty_cDB: SLJ215 [Dicty_cDB

    Full Text Available .7_1.5_KB Zea mays genomic clone ZMMBMa0453M17, genomic survey sequence. 42 4.5 1 BF012148 |BF012148.1 us38h03.y1 Soares_NMEBA_branch...ial_arch Mus musculus cDNA clone IMAGE:3169397 5' similar to TR:Q9QYU2 Q9QYU2 ELONG

  8. Dicty_cDB: SLJ826 [Dicty_cDB

    Full Text Available 033B22f, mRNA sequence. 50 0.023 1 CB290319 |CB290319.1 UCRCS01_01ag06_g1 Washington Navel orange cold acclimate... mRNA sequence. 50 0.023 1 CB290210 |CB290210.1 UCRCS01_01aa11_g1 Washington Navel orange cold acclimated fl

  9. Dicty_cDB: SLJ310 [Dicty_cDB

    Full Text Available 5' similar to Arabidopsis thaliana sequence At1g48030 lipoamide dehydrogenase precursor see http://mips... At1g48030 lipoamide dehydrogenase precursor see, mRNA sequence.

  10. Dicty_cDB: SLJ818 [Dicty_cDB

    Full Text Available its) Value N AF312775 |AF312775.1 Tetrahymena thermophila macronuclear immobilization antigen LD (SerLD) mRN...Y9928, primer: M13 forward, sequence 1. 30 0.014 4 AF312772 |AF312772.1 Tetrahymena thermophila macronuclear immobilization...r RE70748 full insert cDNA. 42 0.096 2 AF312771 |AF312771.1 Tetrahymena thermophila macronuclear immobilization...mena thermophila macronuclear immobilization antigen LA (SerLA) mRNA, complete cds. 30 0.12 3 AC116673 |AC11

  11. Dicty_cDB: SLJ468 [Dicty_cDB

    Full Text Available ignificant alignments: (bits) Value N AF312775 |AF312775.1 Tetrahymena thermophila macronuclear immobiliza...tion antigen LD (SerLD) mRNA, complete cds. 30 0.46 4 BG632067 |BG632067.1 GH02610.

  12. Dicty_cDB: SLJ419 [Dicty_cDB

    Full Text Available |CB367289.1 E38 early-oocyst library Plasmodium berghei/Anopheles stephensi mixe...7 |CB367287.1 E830 early-oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone ...oocyst library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA library Plasmodium berghei/Anopheles stephensi mixed EST library cDNA clone E3015 similar to Plasm

  13. Japan reforms its nuclear safety



    The Fukushima Daiichi NPP accident deeply questioned the bases of nuclear safety and nuclear safety regulation in Japan. It also resulted in a considerable loss of public confidence in the safety of nuclear power across the world. Although the accident was caused by natural phenomena, institutional and human factors also largely contributed to its devastating consequences, as shown by the Japanese Diet's and Government's investigation reports. 'Both regulators and licensees were held responsible and decided to fully reconsider the existing approaches to nuclear safety. Consequently, the regulatory system underwent extensive reform based on the lessons learned from the accident,' Yoshihiro Nakagome, the President of Japan Nuclear Energy Safety Organisation, an ETSON member TSO, explains. (orig.)

  14. Japan og Singapore i Arktis

    Tonami, Aki; Watters, Stewart


    There is a growing awareness in the Nordic region of Asia’s increased interest in the Arctic region and Arctic affairs, including in relation to Greenland. However, with the possible exception of China, there has been little Western scholarly work to analyze exactly why Asian countries...... are interested in the Arctic. Looking at the Arctic engagement of Japan and Singapore, this paper finds that their interest in the Polar Regions is not necessarily a new phenomenon and that Arctic policy, as with the development of other foreign policy objectives, is a complex mix of national, bureaucratic...... and group interests. For Greenlandic and Danish policymakers, it may be useful to understand the genesis of Japan and Singapore’s Arctic policies and that their interest is complex and multi-faceted....

  15. Another Neolithic in Holocene Japan

    Masaki Nishida


    Full Text Available In the Japanese Islands, small sedentary villages sustained by hunting, gathering, fish- ing and cultivation emerged around 10 000 years ago. This life style of the Jomon people continued for around 7000 years without any drastic changes in material culture, subsistence strategy and vil- lage size until the diffusion of continental civilization into Japan approximately 2500 years ago. This indicates that the incipient sedentary society of the Jomon Period was very stable, a state which is not indicative of civilized society after that time. After the prehistoric situation in Japan, we are able to classify sedentary society into two phases; sedentism with stability and sedentism with instability (civilized society. Therefore it is possible to say that the emergence of sedentism and cultivation are not direct factors which promote the emergence of civilization.

  16. WDC Activities in Japan, 2008

    Takashi Watanabe


    Full Text Available This paper briefly reviews the activities of the International Council for Science (ICSU World Data Centers (WDCs in Japan at a time of great change in the data and information structures of the ICSU ? the creation of the World Data System (WDS in 2009. Seven WDCs are currently operating in Japan: the WDC for Airglow, the WDC for Cosmic Rays, the WDC for Geomagnetism, Kyoto, the WDC for Ionosphere, the WDC for Solar Radio Emission, and the WDC for Space Science Satellites. Although these WDCs are highly active, along-term support system must be established to ensure the stewardship and provision of quality-assessed data and data services to the international science community.

  17. Accelerator business in Japan expanding



    Accelerators have become to be used increasingly in Japan in such fields as medicine, physics research and industry. This has caused stiff competition for market share by the manufacturers of accelerators. Electron beam accelerators for industrial use provide an indispensable means for adding values to products, for example, electric cables with incombustible insulators. Linear accelerators for the nondestructive inspection of nuclear components have been widely installed at equipment manufacturing plants. Active efforts have been exerted to develop small synchrotron radiation accelerators for next generation electronic industry. Cyclotrons for producing short life radioisotopes for medical diagnosis and electron beam accelerators for radiation therapy are also used routinely. The suppliers of accelerators include the companies manufacturing heavy electric machinery, heavy machinery and the engineering division of steelmakers. Accelerator physics is being formed, but universities do not yet offer the course regarding accelerators. Accelerator use in Japan and the trend of accelerator manufacturers are reported. (K.I.)

  18. The japan a nuclear power?

    Cumin, D.; Joubert, J.P.


    This work analyzes the Japan nuclear policy, in the frame of its foreign and safety policy in Pacific Asia, since the end of the cold war, especially the relations with the Usa and China. The Japan is a civil power because it has submitted the military institution to juridical restrictions and because it does not rely on the armed force to promote its national interests. The anti nuclear speech is joined with the acknowledgement of the dissuasion necessity, of the control of industrial processes and energy channels susceptible of military applications. Cultivating the ambiguity, the Japanese government can send a dissuasive message, perfectly legible, kind of communication of latent intimidation constituted by the virtual nuclear power of a state that takes part to the non proliferation treaty. (N.C.)

  19. Use of radioisotopes in Japan

    Foeldiak, G.


    A survey of the following general data on the use of radioisotopes in Japan is given (from the material of the 11th Japan Conference on Radioisotopes): 1. number of the organizations using radioactive isotopes, grouped according to special working fields and instruments; 2. amount of the unsealed sources (Ci) used in the different special working fields in 1971, 4. amount of the sealed sources (Ci) used between 1966 and 1971. 5. number of the institutions using sealed sources, grouped according to special working fields (March, 1972), 6. number of the accelerators applied, grouped according to special working fields (March, 1972), 7. number of the nuclear instruments in the education and research institutes (March, 1972), 8. amount of the collected radioactive waste material between 1960 and 1971 (number of containers). (K.A.)

  20. Japan's Trade Policy with Asia

    Shujiro Urata


    Japan's economic relations with Asian countries have rapidly become increasingly close in recent years, mainly through trade and direct investment. In Asia, Japanese companies have pursued a gfragmentation strategy, h which refers to breaking down production processes and assigning each process, through direct investment, to the country or region suited to implement it most efficiently. As a result, when a certain product is manufactured, its intermediate materials and parts are actively trad...

  1. Supply of radiopharmaceuticals in Japan

    Genka, Tsuguo


    Detailed statistics of the application of radiopharmaceuticals in nuclear medicine in Japan are summarized. They are the amount of supply in terms of monetary value and radioactivity, categorized usages of in vivo and in vitro, number of facilities using the radiopharmaceuticals for the time span of 5 years (1998-2002). Obvious tendency of decrease for in vitro use can be seen while the total amount of radiopharmaceuticals is almost unchanged. (author)

  2. Japan Hadron Facility (JHF) project

    Nagamiya, S.


    The Japan Hadron Facility (JHF) is the next accelerator project proposed at KEK to promote exciting sciences by utilising high-intensity proton beams. The project is characterised by three unique features: hadronic beams of the world's highest intensity; a variety of beams from one accelerator complex; frontier sciences to cover a broad research area including nuclear physics, particle physics, material sciences and life sciences by utilising a common accelerator complex. (author)

  3. Reactor construction programme in Japan



    In September last year, the Japanese Government requested the International Atomic Energy Agency to supply three tons of natural uranium for a research reactor, and the Agency has now arranged for its sale to Japan. The metal will be supplied in ingot form and after fabrication it will be used as fuel in a reactor of the natural uranium, heavy water type. The uranium will be obtained from Canada and sold to Japan by IAEA. The Agency had invited tenders for its supply, and after considering the tenders received, the Agency's Board of Governors decided that the Canadian offer to the Agency of three tons of natural uranium free of charge should be accepted and that the selling price to Japan should be US $35. 50 per kilogramme. The price takes into account Article XIV/E of the Agency's Statute which says that the Agency shall establish a scale of charges (including those for storage and handling) for materials furnished to Member States, and that the scale shall be designed to produce revenues to meet expenses in connexion with materials acquired by the Agency and costs of materials and services provided by it under agreements with one or more members. This is the first operation of its kind to be undertaken by the Agency, and the reactor for which the supply is being made will be the first in Japan to be constructed by Japanese scientists and technicians. IAEA's Board of Governors has given the necessary approval to the reactor project for which the Agency is providing assistance

  4. Romanticising Shinsengumi in Contemporary Japan

    Rosa Lee


    Shinsengumi, a group of young men recruited by the Bakufu to protect Kyoto from radical Imperial House loyalists in the tumultuous Bakumatsu period, is romanticised and idolised in Japan despite its limited place in history. This article attempts to comprehend this phenomenon by locating the closest crystallisation of popularly imagined Shinsengumi in Moeyo ken, a popular historical fiction by Shiba Ryōtarō. Antonio Gramsci explains readers are attracted to popular literature because it refle...

  5. Japan Report - Science and Technology


    Stock of Bacillus Subtilis Bacillus subtilis is a relative of bacillus natto that has been in use in Japan from the ancient times. It is safe and...addition to the advantages of this combination of personal styles, the two had great confidence in each other. Chairman Kaneo is the so-called "fair...sixth year of his presidency. That has been just the right age for a president, and given these advantages Sunagane has a good chance of becoming

  6. Potato irradiation technology in Japan

    Takehisa, M.


    After the National research program on potato irradiation, the public consumption of potatoes irradiated to a maximum of 15 krad was authorized by the Ministry of Welfare. Shihoro Agricultural Cooperative Association, one of the largest potato producers in Japan with an annual production of 200,000 tons, intended an application of the irradiation to their potato storage system. This paper describes the technological background of the potato irradiation facility and operational experience. (author)

  7. Japan: 45 Years of INIS

    Yonezawa, Minoru


    I would like to congratulate INIS on its 45th anniversary. Japan is a founding member of this international cooperation program, and the Japan Atomic Energy Agency (formerly, Japan Atomic Energy Research Institute — JAERI) was appointed as the national center of INIS by the Japanese government. We have contributed to the collection, classification, indexing, abstracting and submission of nuclear literature published in our country, as well as promoted the INIS database within our country. I have been engaged in INIS activities for many years and have a lot of experience with INIS. On the occasion of INIS’ 45th anniversary, I would like to look back on this experience. I started my career at JAERI in 1984. The first regional training seminar for the Far East was held in Tokyo in October 1984. I was assigned to the Library Division of JAERI, but I worked as support staff for the regional training seminar. During the seminar, I had an opportunity to attend the technical tour with the seminar participants to the University of Library and Information Science, research laboratories, etc., in Tsukuba Science City. This was my first involvement with INIS. It was a very impressive and interesting experience

  8. Eosinophilic Chronic Rhinosinusitis in Japan

    Junichi Ishitoya

    Full Text Available ABSTRACT: Chronic rhinosinusitis is a heterogeneous disease. In Europe and the United States, it has recently been divided into two subgroups: chronic rhinosinusitis with nasal polyps (CRSwNP and chronic rhinosinusitis without nasal polyps (CRSsNP. The majority of CRSwNP cases have a strong tendency to recur after surgery and show eosinophil-dominant inflammation. However, this definition has proved difficult to apply in Japan and East Asia, because more than half of the CRSwNP cases do not exhibit eosinophil-dominant inflammation in these areas of the world. In Japan in the 1990s, refractory CRSwNP to the standard treatment was focused on in clinical studies and the term ''eosinophilic chronic rhinosinusitis'' (ECRS was introduced to identify this subgroup of chronic rhinosinusitis in 2001.ECRS is different from non-ECRS in terms of many clinical features: symptom appearance, occurrence site of nasal polyps, CT scan findings, the histology of nasal polyps, blood examination findings, clinical course after surgery, and co-morbid asthma, etc. In this review, we describe these clinical features and mention how to make a clinical diagnosis of ECRS as well as how to treat it. Finally, we discuss the pathophysiology of ECRS. The concept of ECRS in Japan would be applicable for CRSwNP in other countries including Europe and the United States. KEY WORDS: chronic rhinosinusitis, clinical feature, diagnosis, eosinophilic chronic rhinosinusitis, eosinophils

  9. Life sciences payload definition and integration study. Volume 2: Requirements, design, and planning studies for the carry-on laboratories. [for Spacelab


    The task phase concerned with the requirements, design, and planning studies for the carry-on laboratory (COL) began with a definition of biomedical research areas and candidate research equipment, and then went on to develop conceptual layouts for COL which were each evaluated in order to arrive at a final conceptual design. Each step in this design/evaluation process concerned itself with man/systems integration research and hardware, and life support and protective systems research and equipment selection. COL integration studies were also conducted and include attention to electrical power and data management requirements, operational considerations, and shuttle/Spacelab interface specifications. A COL program schedule was compiled, and a cost analysis was finalized which takes into account work breakdown, annual funding, and cost reduction guidelines.

  10. Spacelab Life Sciences flight experiments: an integrated approach to the study of cardiovascular deconditioning and orthostatic hypotension

    Gaffney, F. A.


    The microgravity environment of spaceflight produces rapid cardiovascular changes which are adaptive and appropriate in that setting, but are associated with significant deconditioning and orthostatic hypotension on return to Earth's gravity. The rapidity with which these space flight induced changes appear and disappear provides an ideal model for studying the underlying pathophysiological mechanisms of deconditioning and orthostatic hypotension, regardless of etiology. Since significant deconditioning is seen after flights of very short duration, muscle atrophy due to inactivity plays, at most, a small role. These changes in circulatory control associated with cephalad fluid shifts, rather than inactivity per se, are probably more important factors. In order to test this hypothesis in a systematic way, a multidisciplinary approach which defines and integrates inputs and responses from a wide variety of circulatory sub-systems is required. The cardiovascular experiments selected for Spacelab Life Sciences flights 1 and 2 provide such an approach. Both human and animal models will be utilized. Pre- and post-flight characterization of the payload crew includes determination of maximal exercise capacity (bicycle ergometry), orthostatic tolerance (lower body negative pressure), alpha and beta adrenergic sensitivity (isoproterenol and phenylephrine infusions), baroreflex sensitivity (ECG-gated, stepwise changes in carotid artery transmural pressure with a pneumatic neck collar), and responses to a 24 h period of 5 deg head-down tilt. Measurements of cardiac output (CO2 and C2H2 rebreathing), cardiac chamber dimensions (phased-array 2-dimensional echocardiography), direct central venous pressure, leg volume (Thornton sock), limb blood flow and venous compliance (occlusion plethysmography), blood and plasma volumes, renal plasma flow and glomerular filtration rates, and various hormonal levels including catecholamines and atrial natriuretic factor will also be obtained

  11. Implementation of the Additional Protocol in Japan

    Ogawa, T.


    The Additional Protocol between Japan and the IAEA entered into force in December 1999. To come into force a series of implementation trials of Additional Protocol was carried out at two Japanese representative nuclear research centers, i.e. Tokai Research Establishment of Japan Atomic Energy Research Institute (JAERI) and Oarai Engineering Center of Japan Nuclear Fuel Cycle Development Institute (JNC). These trials were proposed by Japan and were conducted in cooperation with the IAEA Secretariat. In addition, Japan amended 'the Law for the Regulation of Reactors etc.', to collect adequate information to submit to the IAEA, to arrange the surrounding for the complementary access, etc. In addition, Japan Submitted the Initial Declaration of the Additional Protocol within 180 days of the entry into force of the Protocol, in the middle of June, 2000

  12. Understanding Great Earthquakes in Japan's Kanto Region

    Kobayashi, Reiji; Curewitz, Daniel


    Third International Workshop on the Kanto Asperity Project; Chiba, Japan, 16-19 February 2008; The 1703 (Genroku) and 1923 (Taisho) earthquakes in Japan's Kanto region (M 8.2 and M 7.9, respectively) caused severe damage in the Tokyo metropolitan area. These great earthquakes occurred along the Sagami Trough, where the Philippine Sea slab is subducting beneath Japan. Historical records, paleoseismological research, and geophysical/geodetic monitoring in the region indicate that such great earthquakes will repeat in the future.

  13. Institutionalisation of Japan Identity Construction Policy

    Zadvornaya Elena S.


    Full Text Available The article is devoted to the development of the modern politics of identity construction in Japan, which actively refers to the practice of designing self-image in international relations. This trend dates back to the 19th century, when there was the end of Sakoku (Japan’s policy of isolation. It is now possible to talk about the institutionalization of the identity construction policy to organized structures and regulations. Enhanced efforts in the field of Japanese traditional and popular culture, education and creative content has led to a number of institutions appearance (like Japan Foundation Fund, Japan Creative Agency, Japan Culture Fund, Agency for Cultural Affairs, Cool Japan Fund, Japan brand Fund and changing idea about the role of culture in foreign policy realization (it is fixed the documents of the Japanese Ministry of Foreign Affairs, the Ministry of Land, Infrastructure, Transport and Tourism, the Ministry of Education, Culture, Sports, Science and Technology, the Ministry of Economy, Trade and Industry, as well as a number of projects (Cool Japan, Visit Japan, Japan Culture Power, Japan Manga Awards, Kawaii Ambassadors, Cosplay International Fest and etc.. These efforts are aimed at forming Japan identity abroad to solve a number of foreign policy challenges of the future and the development of economic cooperation. The Japanese government nearest plans is to increase funding in order to create a positive image of Japan in the region of East Asia. All of these allows us to speak about the policy of the Japanese construction of identity as an institutionalized process in which there was clearance of organizations and regulatory activities.

  14. Public information activities in Japan

    Ijima, Kazunori


    This is a slide presentation dealing with the public information (PI) activities in Japan. At present in Japan 51 nuclear power plants are in commercial operation contributing with a capacity of about 440 G We, i.e. 1/3 of the total electricity is produced by nuclear power. An investigation conducted by Advisory Committee for Energy resulted in the following guidelines in the advancing the Nuclear Power Policy: - maintain transparency in determining policy and reflect the voice of people, making information available to the public; - promote mutual understanding between areas that produce electricity by nuclear power and those that consume electricity; - cultivate an awareness of energy issues amongst the public to encourage them to take issues regarding Japan's energy policy to heart. Concerning the current PI, the following actions are undertaken at a nationwide scale: - for all people, supplying information by mass media, internet and holding lecture meetings and panel discussions etc; - for women, advertisements in journals; - for youth, educational materials, exhibition of energy etc; - for teachers, seminars; for opinion leaders, sending newsletters on nuclear energy. In areas for planned or constructed nuclear plants the PI actions are addressed to all people, women, fishermen, farmers and opinion leaders. There are given the responses to the following three questions addressed to the public concerning the nuclear power: - do you think whether we need nuclear power plants? - do you think whether nuclear power plants are safe? - what mechanism do you think generates energy during the production of nuclear power. A discussion of the results is presented. As future objectives of PI activities the following are in view: to cultivate reliability, to aware of information about nuclear power, to promote awareness of nuclear power, to promote mutual understanding of nuclear power. In conclusion, the need is stressed to make the PI activities more effective, to find

  15. Children in Japan and multimedia.

    Shimauchi, Y


    Many parents in Japan today are very concerned and have daily problems with their children over the following kind of issues concerning video games, multimedia, and similar devices. 1) Is children's enthusiasm for video games actually harming their growth (physically or mentally)? 2) Is there any way that video games can help children in the future? For example, will playing these games help children learn to use computers or develop their power of thought? 3) Will excessive enthusiasm for TV games undermine our basic lifestyle? Is the time they spend studying at home or playing outside actually decreasing? 4) Will the methods of communication brought about by computers, pagers, and cellular phones weaken human relations among children? 5) Will being immersed in a virtual world created by computers result in a diminished sense of reality? The causes of this uneasiness may be traced to parents' own anxieties and concerns about the exceedingly rapid growth of the "information society" of today, together with the fact that their children are directly caught up in the deluge of this information and multimedia society. The development of media has coincided with the growth of today's adults, but children are immersed in a media-filled environment from the day they are born. In Japan, there are now children who can play video games before even learning to write. No one can predict what kind of adults these children will grow to be in the future, and it is fair to say that the most parents and children in Japan are being tossed about on the waves of this information explosion. At this international symposium, we hope to hear the many views that are held around the world concerning children and multimedia.

  16. Bone marrow transplantation in Japan

    Masaoka, Tohru


    BMT in Japan was started in 1975. From 1981 Japan BMT study group was organized by the grant of ministry of health and welfare Japan. A rapid increase of number of BMT parallel to the improvement of results was observed in the 489 patients by the registry of this group. The major causes of failure of BMT were interstitial pneumonitis (IP), relapse of leukemia, infection, and graft versus host disease (GVHD). The incidence of IP decreased very rapidly by fractionation of total body irradiation and anti-cytomegalovirus (CMV) antibody negative platelet transfusion. Prophylactic administration of anti-CMV immunoglobulin produced also significant reduction of IP. In the double blind controled study oral administration of aciclovir revealed significant reduction of herpes stomatitis, followed by the reduction of other infections including sepsis. For the decontamination of bioclean room we have developed ozone decontamination, which revealed to be very effective for fungus. Colony stimulating factor was found to shorten the period of granulocytopenia. The patients with GVHD showed lower incidence of relapse of leukemia than those without GVHD. In the patients who received BMT during their first remission of ALL. Long survival rate was 63 %, for ANLL in the first remission, 64 % and for CML in the chronic phase, 40 %. Out of the first 20 BMT patients of the center for adult diseases Osaka, only three are living now, while out of the next 25 patients 22 are living disease free. Major items of modification of BMT procedures between those two groups were cyclosporine A, colony stimulating factor, fractionated TBI, CMV-negative platelet donar, BMT in first remission for acute leukemia or chronic phase in CML. BMT seemed to be a very reliable and promising treatment of leukemia with a very high possibility of complete cure. (author)

  17. Japan nuclear ship sea trial

    Yamazaki, Hiroshi; Kitamura, Toshikatus; Mizushima, Toshihiko


    The sea trial of the first Japan nuclear Ship 'MUTSU' was conducted from the end of October to December in 1990. The purpose of the sea trial was to verify the nuclear propulsive performances and maneuverabilities. The present report describes the results of the sea trial. These results are classified into four items: 1. Speed test and engineering performance tests 2. Maneuvering performance tests 3. Vibration tests 4. Other tests. Acceptable performances were demonstrated, as expected in the original design. The experience of the use of the Global Positioning System (GPS), which were newly adopted for the sea trial, is also reported. (author)

  18. Photovoltaic electricity production in Japan

    Destruel, P.


    The author first recalls the early investment of Japan in the solar energy which gave a leadership position to this country. However, it has been recently over-taken by Germany and Spain in terms of installed power. The share of the different technologies for the manufacturing of photovoltaic panels (polycrystalline silicon, mono-crystalline silicon, amorphous silicon, copper-indium-selenium cells) of different sizes, is presented, together with the current measures which are aimed at giving a new boost to this sector. The author tries then to foresee the evolutions of this sector during the next years and in a longer term (market prospective evolutions, factory projects, power station projects)

  19. Japan's technology and manufacturing infrastructure

    Boulton, William R.; Meieran, Eugene S.; Tummala, Rao R.


    The JTEC panel found that, after four decades of development in electronics and manufacturing technologies, Japanese electronics companies are leaders in the development, support, and management of complex, low-cost packaging and assembly technologies used in the production of a broad range of consumer electronics products. The electronics industry's suppliers provide basic materials and equipment required for electronic packaging applications. Panelists concluded that some Japanese firms could be leading U.S. competitors by as much as a decade in these areas. Japan's technology and manufacturing infrastructure is an integral part of its microelectronics industry's success.

  20. Japanese History, Post-Japan

    George Lazopoulos


    Full Text Available Jason Ānanda Josephson, The Invention of Religion in Japan. Chicago, IL: University of Chicago Press, 2012. 408 pp. $90 (cloth, $30 (paper. Hwansoo Ilmee Kim, Empire of the Dharma: Korean and Japanese Buddhism, 1877–1912. Cambridge, MA: Harvard University Asia Center, 2012. 444 pp. $50 (cloth. Jung-Sun N. Han, An Imperial Path to Modernity: Yoshino Sakuzō and a New Liberal Order in East Asia, 1905–1937. Cambridge, MA: Harvard University Asia Center, 2012. 244 pp. $40 (cloth.

  1. Neurosurgeons in Japan Are Exclusively Brain Surgeons.

    Asamoto, Shunji


    In Japan, neurosurgeons have traditionally mainly treated brain diseases, with most cases involving the spine and spinal diseases historically being treated by orthopedists. Nowadays, spinal surgery is 1 of the many subspecialties in the neurosurgical field in Japan. Most patients with neurological deficits or suspected neurological diseases see board-certified neurosurgeons directly in Japan, not through referrals from family physicians or specialists in other fields. Problems originating in the spine and spinal cord have been overlooked or misdiagnosed in these situations. Neurosurgeons in Japan must rethink the educational program to include advanced trauma life support and spinal surgery. Copyright © 2016. Published by Elsevier Inc.

  2. Transformer Efficiency Assessment - Okinawa, Japan

    Thomas L. Baldwin; Robert J. Turk; Kurt S. Myers; Jake P. Gentle; Jason W. Bush


    The US Army Engineering & Support Center, Huntsville (USAESCH), and the US Marine Corps Base (MCB), Okinawa, Japan retained Idaho National Laboratory (INL) to conduct a Transformer Efficiency Assessment of “key” transformers located at multiple military bases in Okinawa, Japan. The purpose of this assessment is to support the Marine Corps Base, Okinawa in evaluating medium voltage distribution transformers for potential efficiency upgrades. The original scope of work included the MCB providing actual transformer nameplate data, manufacturer’s factory test sheets, electrical system data (kWh), demand data (kWd), power factor data, and electricity cost data. Unfortunately, the MCB’s actual data is not available and therefore making it necessary to de-scope the original assessment. Note: Any similar nameplate data, photos of similar transformer nameplates, and basic electrical details from one-line drawings (provided by MCB) are not a replacement for actual load loss test data. It is recommended that load measurements are performed on the high and low sides of transformers to better quantify actual load losses, demand data, and power factor data. We also recommend that actual data, when available, be inserted by MCB Okinawa where assumptions have been made and then the LCC analysis updated. This report covers a generalized assessment of modern U.S. transformers in a three level efficiency category, Low-Level efficiency, Medium-Level efficiency, and High-Level efficiency.

  3. Transformer Efficiency Assessment - Okinawa, Japan

    Thomas L. Baldwin; Robert J. Turk; Kurt S. Myers; Jake P. Gentle; Jason W. Bush


    The US Army Engineering & Support Center, Huntsville (USAESCH), and the US Marine Corps Base (MCB), Okinawa, Japan retained Idaho National Laboratory (INL) to conduct a Transformer Efficiency Assessment of “key” transformers located at multiple military bases in Okinawa, Japan. The purpose of this assessment is to support the Marine Corps Base, Okinawa in evaluating medium voltage distribution transformers for potential efficiency upgrades. The original scope of work included the MCB providing actual transformer nameplate data, manufacturer’s factory test sheets, electrical system data (kWh), demand data (kWd), power factor data, and electricity cost data. Unfortunately, the MCB’s actual data is not available and therefore making it necessary to de-scope the original assessment. Note: Any similar nameplate data, photos of similar transformer nameplates, and basic electrical details from one-line drawings (provided by MCB) are not a replacement for actual load loss test data. It is recommended that load measurements are performed on the high and low sides of transformers to better quantify actual load losses, demand data, and power factor data. We also recommend that actual data, when available, be inserted by MCB Okinawa where assumptions have been made and then the LCC analysis updated. This report covers a generalized assessment of modern U.S. transformers in a three level efficiency category, Low-Level efficiency, Medium-Level efficiency, and High-Level efficiency.

  4. Thorium research activities in Japan

    Sasa, Toshinobu


    The nuclear energy policy in Japan is based on the Uranium-Plutonium fuel cycle with Light Water Reactors (LWR) and Fast Breeder Reactors (FBR). After the accident at Fukushima-Daiichi Nuclear Power Plant, the Japanese government recognizes the importance to ensure the flexibility for future nuclear power generation and then, it was specified in the latest Japanese strategic energy plan. Two research groups related to thorium fuelled nuclear systems and fuel cycle was set up in the Atomic Energy Society of Japan in 2013. One is a 'Research Committee on Nuclear Applications of Molten Salt'. The committee was established to discuss the current molten-salt technology including molten-salt cooled reactor, molten-salt fuelled reactor, accelerator driven system, fusion reactor blankets and dry reprocessing processes. Throughout two years discussion, the committee summarizes a current state of the art and issues of molten-salt application systems. Committee also discussed the handling technologies for molten-salt reactors especially in China and United Kingdom, issues of molten-salt application to fusion reactor, dry reprocessing of spent nuclear fuel, and non-nuclear application of molten-salt. Term of the committee will be extended for further research activities

  5. Laser precision microfabrication in Japan

    Miyamoto, Isamu; Ooie, Toshihiko; Takeno, Shozui


    Electronic devices such as handy phones and micro computers have been rapidly expanding their market recent years due to their enhanced performance, down sizing and cost down. This has been realized by the innovation in the precision micro- fabrication technology of semiconductors and printed wiring circuit boards (PWB) where laser technologies such as lithography, drilling, trimming, welding and soldering play an important role. In phot lithography, for instance, KrF excimer lasers having a resolution of 0.18 micrometers has been used in production instead of mercury lamp. Laser drilling of PWB has been increased up to over 1000 holes per second, and approximately 800 laser drilling systems of PWB are expected to be delivered in the world market this year, and most of these laser processing systems are manufactured in Japan. Trend of laser micro-fabrication in Japanese industry is described along with recent topics of R&D, government supported project and future tasks of industrial laser precision micro-fabrication on the basis of the survey conducted by Japan laser Processing Society.

  6. Food irradiation development in Japan

    Kawabata, T.


    In Japan, the first food irradiation research was carried out on the preservation of fish and fishery products. In 1966, the Atomic Energy Commission of the Japanese Government (JAEC) decided to promote the National Project on Food Irradiation and, in 1967, the Steering Committee on food irradiation research in the Atomic Energy Bureau, Science and Technology Agency, selected the following food items as of economic importance to the country, i.e., potatoes, onions, rice, wheat, ''Vienna'' sausage, ''kamaboko'' (fish meat jelly products) and mandarin oranges. The National Project is expected to finish at the end of the 1981 fiscal year. Based on the studies by the National Project, irradiated potatoes were given ''unconditional acceptance'' for human consumption in 1972. Already in 1973, a commercial potato irradiator was built at Shihoro, Hokkaido. In 1980, the Steering Committee submitted a final report on the effectiveness and wholesomeness studies on irradiated onions to the JAEC. This paper gives a brief explanation of the legal aspects of food irradiation in Japan, and the present status of wholesomeness studies on the seven items of irradiated foods. In addition, topics concerning food irradiation research on ''kamaboko'', especially on the effectiveness and a new detecting method for the irradiation treatment of these products, are outlined. (author)

  7. Medical facility statistics in Japan.

    Hamajima, Nobuyuki; Sugimoto, Takuya; Hasebe, Ryo; Myat Cho, Su; Khaing, Moe; Kariya, Tetsuyoshi; Mon Saw, Yu; Yamamoto, Eiko


    Medical facility statistics provide essential information to policymakers, administrators, academics, and practitioners in the field of health services. In Japan, the Health Statistics Office of the Director-General for Statistics and Information Policy at the Ministry of Health, Labour and Welfare is generating these statistics. Although the statistics are widely available in both Japanese and English, the methodology described in the technical reports are primarily in Japanese, and are not fully described in English. This article aimed to describe these processes for readers in the English-speaking world. The Health Statistics Office routinely conduct two surveys called the Hospital Report and the Survey of Medical Institutions. The subjects of the former are all the hospitals and clinics with long-term care beds in Japan. It comprises a Patient Questionnaire focusing on the numbers of inpatients, admissions, discharges, and outpatients in one month, and an Employee Questionnaire, which asks about the number of employees as of October 1. The Survey of Medical Institutions consists of the Dynamic Survey, which focuses on the opening and closing of facilities every month, and the Static Survey, which focuses on staff, facilities, and services as of October 1, as well as the number of inpatients as of September 30 and the total number of outpatients during September. All hospitals, clinics, and dental clinics are requested to submit the Static Survey questionnaire every three years. These surveys are useful tools for collecting essential information, as well as providing occasions to implicitly inform facilities of the movements of government policy.

  8. The electronuclear program of Japan

    Mori, Kazuhisa


    Japan, depending on imports for 80% of its energy supply, introduced a nuclear power program, which now comprises 14 reactors in operation (8,000 MW., that is 8% of its electricity production), and 15 reactors (14,000MW) under construction or being investigated. The objective for 1985 is from 26,000 to 33,000 MW. Japanese industry committed the error of placing too much confidence in its American licensers and not undertaking enough of its own research. This resulted in having a too small number of nuclear stations available, approximately 50%. Japan secured its uranium supply (Niger), its enrichment facilities (U.S.A. and Eurodif), while studying the centrifugation process, and facilities for reprocessing irradiated fuels (France and U.K.) while, at the same time, seeking national independence regarding its entire fuel cycle. The siting of nuclear power stations comes up against local opposition, which is being overcome by a taxation on electricity used to subsidize local collectivities favorable to the construction of a power station, whether hydro-electric, thermal or nuclear [fr

  9. Nuclear power development in Japan

    Mishiro, M.


    This article describes the advantages of nuclear energy for Japan. In 1997 the composition of the total primary energy supply (TPES) was oil 52.7%, coal 16.5%, nuclear 16.1% and natural gas 10.7%. Nuclear power has a significant role to play in contributing to 3 national interests: i) energy security, ii) economic growth and iii) environmental protection. Energy security is assured because a stable supply of uranium fuel can be reasonably expected in spite of dependence on import from abroad. Economic growth implies the reduction of energy costs. As nuclear power is capital intensive, the power generation cost is less affected by the fuel cost, therefore nuclear power can realize low cost by favoring high capacity utilization factor. Fossil fuels have substantial impacts on environment such as global warming and acid rain by releasing massive quantities of CO 2 , so nuclear power is a major option for meeting the Kyoto limitations. In Japan, in 2010 nuclear power is expected to reach 17% of TPES and 45% of electricity generated. (A.C.)

  10. Fusion tritium program in Japan

    Okamoto, M.; Yoshida, H.; Naruse, Y.


    Nuclear Fusion Council, Atomic Energy Commission of Japan, has started to review the nuclear fusion R and D plan for the next stage, post JT-60. The council launched a subcommittee on fundamental issues in the nuclear fusion development in 1985, for review of the basic strategy of a development plan. The subcommittee presented an interim report in Feb. 1986 after 6 months discussion and the report was approved by the Nuclear Fusion Council. Two major R and D programs described in the interim report are the development of a Tokamak type large facility and the comprehensive development of the fusion reactor technology. The latter means to promote the reactor technologies which will be essential in the future to construct not only a D/T burning but also a DEMO reactor. The Nuclear Fusion Development Program in Japan is shown. The interim report recommended to organize two subcommittees to establish an integrated national R and D plan; one was for the design of the next step large facility and the other was for the R and program of the fusion technology. The subcommittee for the latter consisted of 7 working groups; one of them was organized for the tritium technology

  11. Development of clean coal technologies in Japan

    Sato, M. [Electric Power Research Industry, Yokosuka (Japan). Central Research Inst.


    In Japan, we have to import almost of primary energy resources from all over the world. We depend on foreign countries for 96% of our primary energy supply. Following the two oil crises in the 1970s, Japan has diversified its energy resources through increased use of nuclear energy, natural gas and coal as well as the promotion of energy efficiency and conservation.

  12. Japan mellem øst og vest

    Hansen, Annette Skovsted; Ipsen, Lene

    Skildrer Japans historie gennem de sidste 200 år inklusiv et kapitel om historiebrug ift. Nanjingmassakren i 1937-1938.......Skildrer Japans historie gennem de sidste 200 år inklusiv et kapitel om historiebrug ift. Nanjingmassakren i 1937-1938....

  13. 75 FR 57980 - Polychloroprene Rubber From Japan


    ... INTERNATIONAL TRADE COMMISSION [Investigation No. AA1921-129 (Third Review)] Polychloroprene Rubber From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five-year... of the antidumping duty finding on polychloroprene rubber from Japan would be likely to lead to...

  14. Internet Ethics Issues and Actions in Japan

    江澤, 義典


    The International Symposium on Internet Ethics 2012 was planned and organized by the Korea Internet Security Agency and was held in September 2012 at the Lotte Hotel World in Seoul. This note relates to the presentation in Japan, it outlines current Internet ethics issues and actions in Japan. Moreover, four aspects of Japanese civilization were introduced as the bases of these ethics issues.

  15. Business Ownership and Unemployment in Japan

    J. van Acht; J. Stam; A.R. Thurik (Roy); I. Verheul (Ingrid)


    textabstractThe influence of industrial structure, more specifically of business ownership, is investigated on the level of unemployment in Japan. The question is to what extent business ownership, i.e., entrepreneurship, can reduce the level of unemployment. It will be concluded that Japan is

  16. Getah Virus Infection among Racehorses, Japan, 2014

    Bannai, Hiroshi; Tsujimura, Koji; Kobayashi, Minoru; Kikuchi, Takuya; Yamanaka, Takashi; Kondo, Takashi


    An outbreak of Getah virus infection occurred among racehorses in Japan during September and October 2014. Of 49 febrile horses tested by reverse transcription PCR, 25 were positive for Getah virus. Viruses detected in 2014 were phylogenetically different from the virus isolated in Japan in 1978. PMID:25898181

  17. On recycling of nuclear fuel in Japan


    In Japan, atomic energy has become to accomplish the important role in energy supply. Recently the interest in the protection of global environment heightened, and the anxiety on oil supply has been felt due to the circumstances in Mideast. Therefore, the importance of atomic energy as an energy source for hereafter increased, and the future plan of nuclear fuel recycling in Japan must be promoted on such viewpoint. At present in Japan, the construction of nuclear fuel cycle facilities is in progress in Rokkasho, Aomori Prefecture. The prototype FBR 'Monju' started the general functional test in May, this year. The transport of the plutonium reprocessed in U.K. and France to Japan will be carried out in near future. This report presents the concrete measures of nuclear fuel recycling in Japan from the long term viewpoint up to 2010. The necessity and meaning of nuclear fuel recycling in Japan, the effort related to nuclear nonproliferation, the plan of nuclear fuel recycling for hereafter in Japan, the organization of MOX fuel fabrication in Japan and abroad, the method of utilizing recovered uranium and the reprocessing of spent MOX fuel are described. (K.I.)

  18. Japan's oil situation and relationship with the Middle East

    Oka, H.


    This paper reports on Japan's energy supply structure and the demand for energy in the country. It focuses on oil relations between Japan and the Middle Eastern oil countries, and Japan's attempt to enhance energy supply-security policy measures

  19. Characteristics of Wet Deposition in Japan

    Iwasaki, A.; Arakaki, T.


    Acid deposition survey in Japan has started since 1991 by Japan Environmental Laboratories Association (JELA). The JELA has about 60 monitoring sites for wet deposition including remote, rural and urban area. The measured constituents of wet deposition are; precipitation, pH, electric conductivity, major Anions, and major Cations. From those data, we analyze spatial and temporal variations of wet deposition components in Japan. Among the 60 monitoring sites, 39 sampling sites were selected in this study, which have kept sampling continuously between 2003JFY and 2014JFY. All samples were collected by wet-only samplers. To analyze area characteristics, all the areas were divided into 6 regions; Northern part of Japan (NJ), Facing the Japan Sea (JS), Eastern part of Japan (EJ), Central part of Japan (CJ), Western part of Japan (WJ) and Southern West Islands (SW). NO3- and non-sea-salt-SO42- (nss-SO42-) are major components of rain acidification. Especially, between December and February (winter) the air mass from west affected the temporal variations of those acid components and the concentrations were higher in JS and WJ regions than those in other regions. Japanese ministry of the Environment reported that mixing ratio of NO2 in Japan has been less than 0.04ppm since 1976, and that of SO2 has been less than 0.02ppm since 1978. Their concentrations in Japan have remained flat or slowly decreased recently. However the temporal variations of NO3-/nss-SO42- ratio in winter in JS region were significantly increased on average at 2.2% y-1 from 2003JFY to 2014JFY. The results suggest that long-range transboundary air pollutants increased NO3- concentrations and NO3-/nss-SO42- ratio.

  20. National Astronomical Observatory of Japan

    Haubold, Hans J; UN/ESA/NASA Workshop on the International Heliophysical Year 2007 and Basic Space Science, hosted by the National Astronomical Observatory of Japan


    This book represents Volume II of the Proceedings of the UN/ESA/NASA Workshop on the International Heliophysical Year 2007 and Basic Space Science, hosted by the National Astronomical Observatory of Japan, Tokyo, 18 - 22 June, 2007. It covers two programme topics explored in this and past workshops of this nature: (i) non-extensive statistical mechanics as applicable to astrophysics, addressing q-distribution, fractional reaction and diffusion, and the reaction coefficient, as well as the Mittag-Leffler function and (ii) the TRIPOD concept, developed for astronomical telescope facilities. The companion publication, Volume I of the proceedings of this workshop, is a special issue in the journal Earth, Moon, and Planets, Volume 104, Numbers 1-4, April 2009.

  1. Japan. Superconductivity for Smart Grids

    Hayakawa, K.


    Currently, many smart grid projects are running or planned worldwide. These aim at controlling the electricity supply more efficiently and more stably in a new power network system. In Japan, especially superconductivity technology development projects are carried out to contribute to the future smart grid. Japanese cable makers such as Sumitomo Electric and Furukawa Electric are leading in the production of high-temperature superconducting (HTS) power cables. The world's largest electric current and highest voltage superconductivity proving tests have been started this year. Big cities such as Tokyo will be expected to introduce the HTS power cables to reduce transport losses and to meet the increased electricity demand in the near future. Superconducting devices, HTS power cables, Superconducting Magnetic Energy Storage (SMES) and flywheels are the focus of new developments in cooperations between companies, universities and research institutes, funded by the Japanese research and development funding organization New Energy and Industrial Technology Development Organization (NEDO)

  2. Application of EB in Japan

    Sunaga, Hiromi [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment


    Radiation processing using electron beam (EB) facilities other than gamma-ray facilities in Japan is introduced. After briefly presented the features of EB compared with gamma ray, present status of EB application is described. Polymerized materials for use of wire, cable, radial tire, heat shrinkable tube, foam polyethylene, PTFE, battery separator, and adsorbent material are known to be resulting from cross-linking, decomposition, and graft polymerization reactions. Environmental preservation includes electron flue gas treatment in the coal- or oil-fired power plants, research for volatile organic compounds (VOC) and dioxins, as well as wastewater and sludge treatment. Finally activity of JAERI in the related fields is overviewed with the authors prospects for utilization of low energy EB with low cost for surface treatment and functional materials. (S. Ohno)

  3. Application of EB in Japan

    Sunaga, Hiromi


    Radiation processing using electron beam (EB) facilities other than gamma-ray facilities in Japan is introduced. After briefly presented the features of EB compared with gamma ray, present status of EB application is described. Polymerized materials for use of wire, cable, radial tire, heat shrinkable tube, foam polyethylene, PTFE, battery separator, and adsorbent material are known to be resulting from cross-linking, decomposition, and graft polymerization reactions. Environmental preservation includes electron flue gas treatment in the coal- or oil-fired power plants, research for volatile organic compounds (VOC) and dioxins, as well as wastewater and sludge treatment. Finally activity of JAERI in the related fields is overviewed with the authors prospects for utilization of low energy EB with low cost for surface treatment and functional materials. (S. Ohno)

  4. The gas industry in Japan

    Jego, H.


    Though oil is the most widely used primary energy in Japan, its market share is decreasing steadily in favour of other energies such as natural gas. Around 80 % of the gas consumed in Japan is imported in the form of LNG, with locally produced natural gas accounting for 5 % and LPG 12%. Annual LNG supplies now total 48 million tons (720 TWh) and are forecast to rise to 57 million tons over the next ten years. However, only on third of the total volume of LNG, i.e., 242 TWh, is distributed to final consumers. The rest is imported directly by power companies to produce electricity. The 245 gas distribution companies, 70 in the public sector and 175 in the private sector (including three large firms: Tokyo Gas, Osaka Gas and Toho Gas) carry the gas through their own non-interconnected networks to around 25 million customers, though the gas supply area covers only 5 % of the country. This small percentage can be explained partly by Japan's topography: 80 % of the land is covered by mountains. This means that only 20 % of the country is suitable for industrial and residential development. Populations living outside the gas supply areas mainly use LPG. The number of LPG customers totals around 25 million, a similar number to those using mains gas. However, the share of mains gas is increasing each year due to the population increase in urban zones. Though gas represents only 11 % of the energy consumed in Japan, it is nevertheless present on practically all markets and holds the leading position for domestic hot water and cooking in the residential sector. However, for heating, it lags well behind oil. In industry, mains gas covers only 5% of energy needs. However, with the expansion of the pipeline network and market liberalization, the share of gas is set to increase. The price of gas for the residential sector is 2 to 3 times higher than in western countries. This can be attributed to the following factors: most natural gas is imported LNG; unit consumption in the

  5. Japan - From Hiroshima to Fukushima

    Pons, Philippe; Guillain, Robert; Pedroletti, Brice; Bouc, Alain; Vichney, Nicolas; Izraelewicz, Erik; Mesmer, Philippe; Fenoglio, Jerome


    This publication proposes a set of articles published by Le Monde and which addressed some important events of the history of the Japanese society since the destruction of Hiroshima by the first atomic bomb until the Fukushima accident. The addressed facts and events are: the destruction of Hiroshima, the surrender of Japan, the end of the peculiar status of the emperor, the strong growth period from the 1950's to the 1980's (the revival of Japanese trusts, industrial pollution in Minamata, the activists of Zengakuren, the Osaka exhibition, Mishima's suicide, nuclear and data processing are defined as national priorities), the lost decades 1990-2010 (a new emperor, the Kobe earthquake, the increasing gap between the society and the political class, life and death in Toyota, demographic decline, etc.). The last articles address the Fukushima accident, and propose some photos and an interview with the Japanese Prime Minister

  6. 78 FR 78338 - Japan-U.S. Decommissioning and Remediation Fukushima Recovery Forum Tokyo, Japan February 18-19...


    ... DEPARTMENT OF COMMERCE International Trade Administration Japan-U.S. Decommissioning and Remediation Fukushima Recovery Forum Tokyo, Japan February 18-19, 2014 AGENCY: International Trade... Japan-United States Decommissioning and Remediation Fukushima Recovery Forum (``Fukushima Recovery Forum...

  7. Forest medicine research in Japan.

    Miyazaki, Yoshifumi; Ikei, Harumi; Song, Chorong


    There has been growing attention on the effects of forest on physiological relaxation and immune recovery, particularly in forest medicine research, from a perspective of preventive medicine. Japan is a world leader in the accumulation of scientific data on forest medicine research. In this review, we summarize the research that has been conducted in this area since 1992. We conducted field experiment, involving 420 subjects at 35 different forests throughout Japan. After sitting in natural surroundings, these subjects showed decrease in the following physiological parameters compared with those in an urban control group: 12.4% decrease in the cortisol level, 7.0% decrease in sympathetic nervous activity, 1.4% decrease in systolic blood pressure, and 5.8% decrease in heart rate. This demonstrates that stressful states can be relieved by forest therapy. In addition, it should be noted that parasympathetic nervous activity was enhanced by 55.0%, indicating a relaxed state. The results of walking experiments provided similar results. Li et al. demonstrated that immune function was enhanced by forest therapy in middle-aged employees who volunteered to participate in these experiments. Natural killer cell activity, an indicator of immune function, was enhanced by 56% on the second day and returned to normal levels. A significant increase of 23% was maintained for 1 month even after returning to urban life, clearly illustrating the preventive benefits of forest therapy. In an indoor room experiment, we conducted tests with the following: 1) olfactory stimulation using wood smell, 2) tactile stimulation using wood, and 3) auditory stimulation using forest sounds. These indoor stimulations also decreased the blood pressure and pulse rate, and induced a physiological relaxation effect. We anticipate that forest medicine will play an increasingly important role in preventive medicine in the future.

  8. Analysis of energy intensity in Japan

    Okajima, Shigeharu; Okajima, Hiroko


    This study discusses the causes of the increase in Japan's energy intensity, defined as energy consumption divided by GDP, since the early 1990s. The significant reduction in Japan's energy intensity ceased in the early 1980s and has even slightly increased since the early 1990s, indicating that Japan seemingly stopped taking aggressive action to improve energy use. However, further analysis at prefecture level and sector level provides additional insight on energy intensity trends. To analyze the causes of the increase in Japan's energy intensity, energy intensity is decomposed into energy efficiency (improvements in energy efficiency) and energy activity (structural changes from the secondary sector to the tertiary sector of the economy). Our result indicates that the non-uniform energy intensity trends between prefectures are attributed to a high variability in energy efficiency. At sector level, we estimate the income elasticity of energy consumption in each sector and find that a structural change in energy consumption behaviors occurred in all sectors at different time points. The industrial sector and commercial sector became less energy efficient after 1981 and 1988, respectively, which is presumably responsible for the deterioration of Japan's energy intensity since the early 1990s. - Highlights: • We examine why the reduction in Japan's energy intensity increased in the early 1990s. • There is a high variability in energy intensity trends between regions. • The structural changes in energy consumption behaviors occurred in sector level. • These changes may be responsible for the deterioration of Japan's energy intensity

  9. Japan's new energy policy


    Japan's energy policy is undergoing fundamental changes. The accident at TEPCO's Fukushima Daiichi nuclear power plant questions the future contribution of nuclear power in the national energy mix. Growing imports of fossil fuels to replace the lost nuclear capacity inflated energy prices and raise economic and energy security challenges. At the same time, the US shale gas and oil revolution is reshaping the global energy scene. Japan expects to take advantage of the trend to eliminate the 'Asian premium' on natural gas prices and expand cheaper natural gas consumption. These developments have driven the Government of Japan to review its energy policy from scratch and adopt a new Strategic Energy Plan. This new policy has far reaching implications for gas and coal development in Japan but also for the international markets as Japan is the world's largest LNG importer and the second largest coal importer. This document summarizes the key findings of a new report by CEDIGAZ 'Japan's new energy policy: In search for stable and competitive energy supply'. The report analyzes the current changes taking place on the gas and coal markets in Japan, in light of the new energy policy adopted in April 2014, and in particular the decision to restart safe nuclear power plants and push forward electricity market reforms

  10. [Building epilepsy care network in Japan].

    Otsuki, Taisuke


    Number of epilepsy patient in Japan officially surveyed by our government in 2008 is 219,000, which is only 0.17% of the total population and less than one third of the prevalence rate reported in Western countries. Number of epilepsy surgery per year in Japan is also low and less than half of other countries such as US, UK and Korea. These numbers may suggest that epilepsy care in Japan is not sufficient to cover all hidden medical needs of people with epilepsy at present. To solve this issue, our research group funded by the government have started to build an epilepsy care network among primary care physicians, secondary care neurology specialists and tertiary care epilepsy centers by utilizing a web site: Epilepsy Care Network-Japan ( from July 2012. We are also proposing an epilepsy care algorithm suitable for our complex medical community consisted with various neurology specialists such as pediatric and adult neurologists, neurosurgeons and psychiatrists. Building Epilepsy Care Network in Japan may facilitate better medical and social support for people with epilepsy in Japan.

  11. Japan's National Security: Structures, norms, and policies

    Katzenstein, P.J.; Okawara, N.


    Japan's national security policy has two distinctive aspects that deserve analysis. First, Japan's definition of national security goes far beyond traditional military notions. National security is viewed in comprehensive terms that also include economic and political dimensions. The second feature of Japan's security policy worth explanation is a distinctive mixture of flexibility and rigidity in the process of policy adaptation to change: flexibility on issues of economic security, rigidity on issues of military security, and flexibility combined with rigidity on issues of political security. With the end of the Cold War and changes in the structure of the international system, it is only natural that we ask whether and how Japan's national security policy will change as well. Optimists insist that the Asian balance of power and the US-Japan relationship will make Japan aspire to be a competitive, noninterventionist trading state that heeds the universal interest of peace and profit rather than narrow aspirations for national power. Pessimists warn us instead that the new international system will finally confirm Herman Kahn's prediction of 1970: Japan will quickly change to the status of a nuclear superpower, spurred perhaps by what some see as a dangerous rise of Japanese militarism in the 1970s and 1980s

  12. Electronic manufacturing and packaging in Japan

    Kelly, Michael J.; Boulton, William R. (Editor); Kukowski, John A.; Meieran, Eugene S.; Pecht, Michael; Peeples, John W.; Tummala, Rao R.


    This report summarizes the status of electronic manufacturing and packaging technology in Japan in comparison to that in the United States, and its impact on competition in electronic manufacturing in general. In addition to electronic manufacturing technologies, the report covers technology and manufacturing infrastructure, electronics manufacturing and assembly, quality assurance and reliability in the Japanese electronics industry, and successful product realization strategies. The panel found that Japan leads the United States in almost every electronics packaging technology. Japan clearly has achieved a strategic advantage in electronics production and process technologies. Panel members believe that Japanese competitors could be leading U.S. firms by as much as a decade in some electronics process technologies. Japan has established this marked competitive advantage in electronics as a consequence of developing low-cost, high-volume consumer products. Japan's infrastructure, and the remarkable cohesiveness of vision and purpose in government and industry, are key factors in the success of Japan's electronics industry. Although Japan will continue to dominate consumer electronics in the foreseeable future, opportunities exist for the United States and other industrial countries to capture an increasingly large part of the market. The JTEC panel has identified no insurmountable barriers that would prevent the United States from regaining a significant share of the consumer electronics market; in fact, there is ample evidence that the United States needs to aggressively pursue high-volume, low-cost electronic assembly, because it is a critical path leading to high-performance electronic systems.

  13. Fukushima accident: the consequences in Japan, France and in Japan

    Foucher, N.; Sorin, F.


    This document begins with a description of the Fukushima accident, the second article reviews the main consequences in Japan of the accident: setting of a forbidden zone around the plant, restriction of the exports of food products, or the shutdown of the Hamaoka plant. The third article is the reporting of an interview of L. Oursel, deputy general director of the Areva group, this interview deals mainly with the safety standard of the EPR and with the issue of passive safety systems. The last part of the document is dedicated to the consequences in France (null sanitary impact, cooperation between Areva, EdF, CEA and the Japanese plant operator Tepco...) and in the rest of the world: the organization of resistance tests in the nuclear power plants operating in the European Union, the decision about the agreement of EPR and AP1000 reactor has been delayed in United-Kingdom, acceleration of the German program for abandoning nuclear energy, Italy suspends its nuclear program, China orders a general overhaul of the safety standard of its nuclear power plants, Poland and Romania reaffirm their trust in nuclear energy, France wishes a 'mechanism' allowing a quick international intervention in case of major nuclear accident, Russia proposes measures to improve nuclear safety. (A.C.)

  14. Childbirth in aristocratic households of Heian Japan.

    Andreeva, Anna


    This paper focuses on childbirth in Japan's aristocratic households during the Heian period (794-1185). Drawing on various sources, including court diaries, visual sources, literary records, and Japan's first medical collection, with its assortment of gynaecological and obstetric prescriptions, as well as Buddhist and other ritual texts, this short excursion into the cultural history of childbirth offers an insight into how childbirth was experienced and managed in Heian Japan. In particular, it addresses the variety of ideas, knowledge systems and professionals involved in framing and supporting the process of childbirth in elite households. In so doing, it casts light on the complex background of early Japanese medicine and healthcare for women.

  15. The scale of biomass production in Japan

    Matsumura, Yukihiko [School of Engineering, Hiroshima University, 1-4-1 Kagamiyama, Higashihiroshima-shi 739-8527 (Japan); Inoue, Takashi; Fukuda, Katsura [Global Warming Research Department, Mitsubishi Research Institute, Inc., 2-3-6 Ohtemachi, Chiyoda-ku, Tokyo 100-8141 (Japan); Komoto, Keiichi; Hada, Kenichiro [Renewable energy Team, Environment, Natural Resources and Energy Division, Mizuho Information and Research Institute, Inc., 2-3 Kanda-nishikicho, Chiyoda-ku, Tokyo 101-8443 (Japan); Hirata, Satoshi [Technical Institute, Kawasaki Heavy Industries, Ltd., 1-1 Kawasakicho, Akashi-shi, Hyogo 673-8666 (Japan); Minowa, Tomoaki [Biomass Recycle Research Laboratory, National Institute of Advanced and Industrial Science and Technology, 2-2-2 Hiro, Suehiro, Kure-shi, Hiroshima 737-0197 (Japan); Yamamoto, Hiromi [Socioeconomic Research Center, Central Research Institute of Electric Power Industry, 1-6-1 Ohtemachi, Chiyoda-ku, Tokyo 100-8126 (Japan)


    Policymakers working to introduce and promote the use of bioenergy in Japan require detailed information on the scales of the different types of biomass resources generated. In this research, the first of its type in Japan, the investigators reviewed various statistical resources to quantify the scale distribution of forest residues, waste wood from manufacturing, waste wood from construction, cattle manure, sewage sludge, night soil, household garbage, and waste food oil. As a result, the scale of biomass generation in Japan was found to be relatively small, on the average is no more than several tons in dry weight per day. (author)

  16. Spent fuel treatment in Japan

    Takahashi, K.


    In Japan, 52 nuclear power reactors are operating with a total power generation capacity of 45 GWe. The cumulative amount of spent fuel arising, as of March 1998, is about 14,700 W. Spent fuel is reprocessed and recovered nuclear materials are to be recycled in LWRs and FBRs. Pu utilization in LWRs will commence in 1999. In January 1997, short-term policy measures were announced by the Atomic Energy Commission, which addressed promotion of the reprocessing programme in Rokkasho, plutonium utilization in LWRs, spent fuel management, back-end measures and FBR development. With regard to the spent fuel management, the policy measures included expansion of spent fuel storage capacity at reactor sites and a study on spent fuel storage away-from-reactor sites, considering the increasing amount of spent fuel arising. Valuable experience was been accumulated at the Tokai Reprocessing Plant (TRP), from the start of hot operation in 1977 up to now. The role of the TRP will be changed from an operation-oriented to a more R and D oriented facility, when PNC is reorganized into the new organization JNC. The Rokkasho reprocessing plant is under construction and is expected to commence operation in 2003. R and D of future recycling technologies is also continued for the establishment of a nuclear fuel cycle based on FBRs and LWRs. (author)

  17. Nuclear Forensics Technologies in Japan

    Shinohara, N.; Kimura, Y.; Okubo, A.; Tomikawa, H.


    Nuclear forensics is the analysis of intercepted illicit nuclear or radioactive material and any associated material to provide evidence for nuclear attribution by determining origin, history, transit routes and purpose involving such material. Nuclear forensics activities include sampling of the illicit material, analysis of the samples and evaluation of the attribution by comparing the analysed data with database or numerical simulation. Because the nuclear forensics methodologies provide hints of the origin of the nuclear materials used in illegal dealings or nuclear terrorism, it contributes to identify and indict offenders, hence to enhance deterrent effect against such terrorism. Worldwide network on nuclear forensics can lead to strengthening global nuclear security regime. In the ESARDA Symposium 2015, the results of research and development of fundamental nuclear forensics technologies performed in Japan Atomic Energy Agency during the term of 2011-2013 were reported, namely (1) technique to analyse isotopic composition of nuclear material, (2) technique to identify the impurities contained in the material, (3) technique to determine the age of the purified material by measuring the isotopic ratio of daughter thorium to parent uranium, (4) technique to make image data by observing particle shapes with electron microscope, and (5) prototype nuclear forensics library for comparison of the analysed data with database in order to evaluate its evidence such as origin and history. Japan’s capability on nuclear forensics and effective international cooperation are also mentioned for contribution to the international nuclear forensics community.

  18. From the Jura to Japan...


    Fifty years ago, a week-long school for physicists took place in Saint Cergue, in the Jura mountains not far from CERN. Its focus was on using emulsion techniques, but its legacy was much more far reaching. Last week I was in Fukuoka, Japan, on the last day of a direct descendent – the first Asia–Europe–Pacific School of High-Energy Physics (AEPSHEP).   That first small school in 1962 was the precursor to the annual European Schools of High-Energy Physics, which are organised jointly by CERN and the Joint Institute for Nuclear Research (JINR) in countries that are a member state of either (or both) of the organisations. They led in turn to the CERN–Latin-American School of High-Energy Physics, first held in Brazil in 2001. The aim of these schools is not only to give young particle physicists the opportunity to learn from leading experts in the field, but also to nurture from the start communication among researchers from different regions. CERN and JI...

  19. Spent fuel management in Japan

    Mineo, H.; Nomura, Y.; Sakamoto, K.


    In Japan 52 commercial nuclear power units are now operated, and the total power generation capacity is about 45 GWe. The cumulative amount of spent fuel arising is about 13,500 tU as of March 1997. Spent fuel is reprocessed, and recovered nuclear materials are to be recycled in LWRs and FBRs. In February 1997 short-term policy measures were announced by the Atomic Energy Commission, which addressed promotion of reprocessing programme in Rokkasho, plutonium utilization in LWRs, spent fuel management, backend measures and FBR development. With regard to the spent fuel management, the policy measures included expansion of spent fuel storage capacity at reactor sites and a study on spent fuel storage away from reactor sites, considering the increasing amount of spent fuel arising. Research and development on spent fuel storage has been carried out, particularly on dry storage technology. Fundamental studies are also conducted to implement the burnup credit into the criticality safety design of storage and transportation casks. Rokkasho reprocessing plant is being constructed towards its commencement in 2003, and Pu utilization in LWRs will be started in 1999. Research and development of future recycling technology are also continued for the establishment of nuclear fuel cycle based on FBRs and LWRs. (author)

  20. Romanticising Shinsengumi in Contemporary Japan

    Rosa Lee


    Full Text Available Shinsengumi, a group of young men recruited by the Bakufu to protect Kyoto from radical Imperial House loyalists in the tumultuous Bakumatsu period, is romanticised and idolised in Japan despite its limited place in history. This article attempts to comprehend this phenomenon by locating the closest crystallisation of popularly imagined Shinsengumi in Moeyo ken, a popular historical fiction by Shiba Ryōtarō. Antonio Gramsci explains readers are attracted to popular literature because it reflects their ‘philosophies of the age’, which may be discovered by examining popular heroes with their subsequent replications. This article will identify why Shinsengumi is appealing by comparing Shiba’s hero in Moeyo ken with its twenty-first century reincarnation in Gintama, a popular manga series, and by discerning reader response to Moeyo ken from customer reviews on It will be demonstrated from these studies that a likely reason for the Japanese public’s romanticisation of Shinsengumi in recent years could be their attraction to autonomous, self-determining heroes who also appreciate the value of community.

  1. Diagnostics in Japan's microgravity experiments

    Kadota, Toshikazu


    The achievement of the combustion research under microgravity depends substantially on the availability of diagnostic systems. The non-intrusive diagnostic systems are potentially applicable for providing the accurate, realistic and detailed information on momentum, mass and energy transport, complex gas phase chemistry, and phase change in the combustion field under microgravity. The non-intrusive nature of optical instruments is essential to the measurement of combustion process under microgravity which is very nervous to any perturbation. However, the implementation of the non-intrusive combustion diagnostic systems under microgravity is accompanied by several constraints. Usually, a very limited space is only available for constructing a highly sophisticated system which is so sensitive that it is easily affected by the magnitude of the gravitational force, vibration and heterogeneous field of temperature and density of the environments. The system should be properly adjusted prior to the experiment. Generally, it is quite difficult to tune the instruments during measurements. The programmed sequence of operation should also be provided. Extensive effort has been toward the development of non-intrusive diagnostic systems available for the combustion experiments under microgravity. This paper aims to describe the current art and the future strategy on the non-intrusive diagnostic systems potentially applicable to the combustion experiments under microgravity in Japan.

  2. Exotic freshwater planarians currently known from Japan

    Sluys, R.; Kawakatsu, M.; Yamamoto, K.


    Biogeographical and taxonomic information on the four non-indigenous freshwater planarians of Japan is reviewed, viz. Dugesia austroasiatica Kawakatsu, 1985, Girardia tigrina (Girard, 1850), G. dorotocephala (Woodworth, 1897), and Rhodax evelinae? Marcus, 1947. The occurrence of Girardia

  3. United States - Japan - European Union probe data.


    The U.S., Japan, and Europe have a long : history of sharing information on ITS : activities. These efforts include both bilateral : and trilateral relationships. International : coordination is underway in several areas, : including: : 1. Internatio...

  4. Summary of the Day Observations - Misawa Japan

    National Oceanic and Atmospheric Administration, Department of Commerce — Summary of the Day Observations - Misawa Japan is a collection of data summarizing daily weather observations taken at Misawa Naval Air Station, near the north end...

  5. Remilitarization of Japan - Prospects and Impacts

    Yee, Tay


    ...? Also, there have always been concerns, especially among older Southeast Asians, who still have vivid memories of Japanese military atrocities during the Japanese Occupation, that Japan may trend towards militarism...

  6. Japan's System of Official Development Assistance | IDRC ...

    Today, and since 1989, Japan is the largest donor of ODA in the world. ... New Dutch-Canadian funding for the Climate and Development Knowledge Network ... (RRF) for Ebola Virus Disease Outbreaks will fund social science, population and ...

  7. May 1983 Akita, Honshu, Japan Images

    National Oceanic and Atmospheric Administration, Department of Commerce — The tsunami generated by a magnitude 7.9 (Mw) earthquake destroyed 700 boats and 59 houses for a total of $800 million in property damage in Japan (1983 dollars)....

  8. Pulse radiolysis facilities and activities in Japan

    Ogasawara, M.


    Pulse radiolysis studies in Japan have been reviewed in special reference to the facilities and the people who have engaged in the experiments. Main achievement is summarized with the list of selected publications. (author)

  9. Should Japan Become a Normal Country

    Yildiz, Ahmet


    This thesis evaluates Japanese geopolitical change in the post-Cold War era. It does so by analyzing Japan's history, its foreign policy since 1945, its reasons for becoming a normal country, and the impact of its normalization...

  10. Food Irradiation In Vietnam And Japan

    Tamikazy Kume


    In 2008, Japan Atomic Energy Commission of Cabinet Office performed the study of current status of food irradiation in the world. The results showed that the total quantity of irradiated foods in 2005 was 405,000 tons. Seven main countries for food irradiation were China, USA, Ukraine, Brazil, South Africa, Vietnam and Japan. In Japan, only the potato irradiation for sprout inhibition is continued more than 35 years since 1974 but the quantity is decreasing. On the other hand, the food irradiation of Vietnam has been developed rapidly in a short time to export the frozen seafood and fruit. This paper shows the status of food irradiation in Vietnam and Japan, and the progress in both countries after 2005. (author)

  11. ITER on display at Yokohama, Japan

    Green, B.


    During the 17th IAEA Fusion Energy Conference, held in Yokohama, Japan, from 19-24 October 1998, the ITER Project exhibited a display, primarily of the research and development which has taken place to support the design of ITER

  12. Japan's contribution to nuclear medical research

    Rahman, M.; Sakamoto, Junichi; Fukui, Tsuguya


    We investigated the degree of Japan's contribution to the nuclear medical research in the last decade. Articles published in 1991-2000 in highly reputed nuclear medical journals were accessed through the MEDLINE database. The number of articles having affiliation with a Japanese institution was counted along with publication year. In addition, shares of top-ranking countries were determined along with their trends over time. Of the total number of articles (7,788), Japan's share of articles in selected nuclear medical journals was 11.4% (889 articles) and ranked 2nd in the world after the USA (2,645 articles). The recent increase in the share was statistically significant for Japan (p=0.02, test for trend). Japan's share in nuclear medical research output is much higher than that in other biomedical fields. (author)

  13. Development of experimental concepts for investigating the strength behavior of fine-grained cohesive soil in the Spacelab/space shuttle zero-g environment

    Bonaparte, R.; Mitchell, J. K.


    Three different sets of tests are proposed for the NASA Spacelab experimental program. The first of tests, designed to measure the true cohesion of several different soils, would be carried out in space through use of a specially prepared direct shear apparatus. As part of this first series of tests, it is recommended that a set of drained unconfined compression tests be performed terrestrially on the same soils as tested in space. A form of the direct tension test is planned to measure the true tensile strength of the same types of soils used in the first series of tests. The direct tension tests could be performed terrestrially. The combined results of the direct shear tests, direct tension tests, and unconfined compression tests can be used to construct approximate failure envelopes for the soils tested in the region of the stress origin. Relationships between true cohesion and true tensile strength can also be investigated. In addition, the role of physio-chemical variables should be studied. The third set of tests involves using a multiaxial cubical or true triaxial test apparatus to investigate the influence of gravity induced fabric anisotropy and stress nonhomogeneities on the stress strain behavior of cohesive soils at low effective stress levels. These tests would involve both in space and terrestrial laboratory testing.

  14. Epidemiology of diabetes mellitus in Japan

    Blackard, W G; Omori, Yoshiaki; Freedman, L R


    The clinical and epidemiological features of diabetes mellitus in Japan have been compiled and compared with data from other countries. Diabetes is basically the same in Japan as elsewhere: however, consideration of important differences has led to the following conclusions: The rarity of ketoacidosis in Japan is due to the mild carbohydrate defect present in most diabetics. The mild carbohydrate intolerance in diabetics is probably in part due to a high carbohydrate intake. Diabetic retinopathy is more common in women than in men in Japan; there are limited and conflicting data from the West on this point, but retinopathy, nephropathy and neuropathy occur about as frequently in Japan as in the West. Because of marked dietary differences between Japan and Western countries, these findings suggest that dietary fat has no significance in the pathogenesis of these lesions. Peripheral gangrene is distinctly unusual in Japanese diabetics. This suggests that either: the responsible vascular lesions are different from those responsible for nephropathy and retinopathy; or that small vessel lesions are the same but the lack of large vessel atherosclerosis in the population accounts for the decreased incidence of gangrene. Men have diabetes 2 or 3 times as commonly as women in Japan. If sex-limited inheritance is discarded as a possible reason, it is likely that adult-onset diabetes is more common in men than women except in those countries (the West) where women gain relatively large amounts of weight. The rarity of juvenile diabetes in Japan is best explained by the infrequency of responsible genetic factors. As a consequence, it is likely that juvenile diabetes is caused by different or additional genetic factors which are not significant in adult-onset diabetes. Diabetes prevalance varies sufficiently between different localities in the same country to render the concept of national prevalance of doubtful usefulness. 55 references, 3 figures, 3 tables.

  15. Explaining Meiji Japans Top Down Revolution


    Operations and Reports, 1215 Jefferson Davis Highway, Suite 1204, Arlington, VA 22202-4302, and to the Office of Management and Budget, Paperwork Reduction...Modernization in Japanese Culture, ed. Donald H. Shively (Princeton, NJ: Princeton University Press, 1971), 93–97. 24 David J. Lu, Japan: A Documentary ...but also took advantage of international developments. Japan managed to alter the unequal treaties with his oversight. The Japanese began to study an

  16. Revitalizing US electronics lessons from Japan

    Sprague, John


    Written by one of the few executives who have extensive experience in the electronics industry in both the US and Japan, this book compares market research, design, and manufacturing techniques as used in both countries. Unlike other books on theJapanese business culture, Sprague gives specific advice and recommendations about what companies can do now to compete with Japan, clearly pointing out what is and what is not adaptable from the Japanese approach to business.

  17. Testing the Nuclear Will of Japan


    particularly the United States. This was significant because a soured economic relationship would undoubtedly affect the U.S.-Japan security...around the world, has sometimes soured its image as a serious international player.136 This is because many of the world’s great powers have extended...for International Exchange, 2005. Beer , Lawrence W. “Japan Turning the Corner.” Asian Survey 11, no. 1 (January 1971): 74 – 85. Bueno de Mesquita

  18. Explaining Meiji Japan's top-down revolution

    McClain, Kendra M.


    Approved for public release; distribution is unlimited Meiji Japanese leaders consisted of an oligarchy that strived to overcome Western imperialist pressures in Asia. They did so by overturning some deeply rooted Tokugawa-Era traditions in Japanese society and replaced them with Western ones. They understood that Western norms dictated world affairs, so they sought to make Japan strong along Western norms. Modeling the West provided enough traction for Japan to meet Western threats and ma...

  19. Theorizing School Bullying: Insights from Japan

    Shoko Yoneyama


    This paper identifies a lacuna in the existing paradigms of bullying: a gap caused by the frame of reference being largely limited to the highly industrialized societies of the 'west': Europe, North America and Oceania. The paper attempts to address this gap by presenting research developed in Japan. In Japan, sociological discourse on school bullying, i.e. the analysis of institutional factors relevant to understanding bullying was established relatively early, as was the epistemology now re...

  20. Japan's Fiscal Policy and Fiscal Reconstruction

    Ihori, Toshihiro; Nakamoto, Atsushi


    This paper investigates the macroeconomic effects of fiscal policy and the fiscal reconstruction movement in Japan. We first summarize Japan's fiscal policy in recent years and discuss advantages and disadvantages of government deficits. Next, we investigate the macroeconomic effects of Japanese fiscal policy and evaluate the plausibility of non-Keynesian effects. We also analyze the possibility of the crowding-in effect of fiscal policy and investigate the spillover effects of deregulation. ...

  1. The disappointments for nuclear energy in Japan


    Several dysfunctions are reported in this paper: A reactor (Onagawa) closed after a nitrogen leakage; a small leakage of radioactive water in the nuclear power plant of Mihama assessment raised to five deaths, the operator stops its nuclear power plants for inspection, the Japan face to its ageing nuclear power plants, the truth about the cost of M.O.X., the seven reactors of Japan closed for inspection after cracks and leaks hidden to authorities, Tokai MURA accident. (N.C.)

  2. Proto-Industrialization in Tokugawa Japan

    Murphy, Martin J.


    This research examines the process of early capitalism in Japanese history. Generally it is thought that capitalism developed in the years leading to the Meiji Restoration. Like European models of early capitalist development in handicraft and cottage industries, Japan went through a similar process. Development of rural trade and small-scale capitalism sowed the seeds that broke feudal bonds and resulted in the mass factory system that made modern capitalist Japan.

  3. [History of pandemic influenza in Japan].

    Matsumoto, Keizo


    In Japan, influenza like epidemics were described many times since Heian era. However, Spanish flu as the modern medicine invaded Japan in 1918, thus almost infected 390,000 patients died with associated pneumonia. After the discovery of influenza virus in 1933, Japan experienced pandemic influenza--Asian flu(H2N2) in 1957. After about 10 years, Hong Kong flu (H3N2) came to Japan at 1968. However, we had many reliable antibiotics but had not any antiviral drug at the early time. After year 2000, we fortunately obtained reliable three antiviral drugs such as amantadine, oseltamivir and zanamivir. Moreover, very useful rapid test kits for influenza A and B viruses were developed and used in Japan. 2009 H1N1 influenza epidemic occured in Japan after the great epidemic in Mexico and North America but elderly patient was few. With together, host conditions regarding with high risk are changing. Lessons from past several pandemic influenza are those that many issues for changing high risk conditions, viral genetic changes, developing antiviral agents, developing new useful vaccins and determinating bacterial secondary pathogens are important.

  4. Future Accelerators Seminar in Japan



    ICFA, the International Committee for Future Accelerators, was set up by the Particles and Fields Commission of the International Union of Pure and Applied Physics (IUPAP) in 1976. Its mandate was 'To organize workshops for the study of problems related to an international super-high energy accelerator complex (VBA) and to elaborate the framework of its construction and of its use. To organize meetings for the exchange of information on future plans of regional facilities and for the formulation of advice on joint studies and uses.' In the seven years of its existence (it first met in August 1977), ICFA has organized three workshops on the first topic — t w o on 'Possibilities and Limitations of Accelerators and Detectors' (Fermilab, 1978 and Les Diablerets, 1979) and one on 'Possibilities and Limitations for Superconducting Accelerator Magnets' (Protvino, 1981). At an ICFA meeting at Fermilab in August 1983, it was realized that the second topic had been somewhat neglected. It was therefore decided to postpone a fourth workshop scheduled at the Japanese National Laboratory for High Energy Physics (KEK) and to organize instead a Seminar on 'Future Perspectives in High Energy Physics' similar to that held in New Orleans in 1975, which had in fact led to the creation of ICFA.The Seminar (jointly hosted by the Institute of Nuclear Study of Tokyo University and KEK, with support from the Ministry of Education, Science and Culture, the Yamada Science Foundation and the Nishina Memorial Foundation) took place from 14-20 May. There were about a hundred participants, mostly senior scientists from Western and Eastern Europe, USA, USSR and Japan (including the Directors of almost all the major high energy physics Laboratories) and representatives from Australia, Canada, China, India, Mexico, South Korea and Vietnam

  5. Future Accelerators Seminar in Japan



    ICFA, the International Committee for Future Accelerators, was set up by the Particles and Fields Commission of the International Union of Pure and Applied Physics (IUPAP) in 1976. Its mandate was 'To organize workshops for the study of problems related to an international super-high energy accelerator complex (VBA) and to elaborate the framework of its construction and of its use. To organize meetings for the exchange of information on future plans of regional facilities and for the formulation of advice on joint studies and uses.' In the seven years of its existence (it first met in August 1977), ICFA has organized three workshops on the first topic — t w o on 'Possibilities and Limitations of Accelerators and Detectors' (Fermilab, 1978 and Les Diablerets, 1979) and one on 'Possibilities and Limitations for Superconducting Accelerator Magnets' (Protvino, 1981). At an ICFA meeting at Fermilab in August 1983, it was realized that the second topic had been somewhat neglected. It was therefore decided to postpone a fourth workshop scheduled at the Japanese National Laboratory for High Energy Physics (KEK) and to organize instead a Seminar on 'Future Perspectives in High Energy Physics' similar to that held in New Orleans in 1975, which had in fact led to the creation of ICFA.The Seminar (jointly hosted by the Institute of Nuclear Study of Tokyo University and KEK, with support from the Ministry of Education, Science and Culture, the Yamada Science Foundation and the Nishina Memorial Foundation) took place from 14-20 May. There were about a hundred participants, mostly senior scientists from Western and Eastern Europe, USA, USSR and Japan (including the Directors of almost all the major high energy physics Laboratories) and representatives from Australia, Canada, China, India, Mexico, South Korea and Vietnam.

  6. Research of fault activity in Japan

    Nohara, T.; Nakatsuka, N.; Takeda, S.


    Six hundreds and eighty earthquakes causing significant damage have been recorded since the 7. century in Japan. It is important to recognize faults that will or are expected to be active in future in order to help reduce earthquake damage, estimate earthquake damage insurance and siting of nuclear facilities. Such faults are called 'active faults' in Japan, the definition of which is a fault that has moved intermittently for at least several hundred thousand years and is expected to continue to do so in future. Scientific research of active faults has been ongoing since the 1930's. Many results indicated that major earthquakes and fault movements in shallow crustal regions in Japan occurred repeatedly at existing active fault zones during the past. After the 1995 Southern Hyogo Prefecture Earthquake, 98 active fault zones were selected for fundamental survey, with the purpose of efficiently conducting an active fault survey in 'Plans for Fundamental Seismic Survey and Observation' by the headquarters for earthquake research promotion, which was attached to the Prime Minister's office of Japan. Forty two administrative divisions for earthquake disaster prevention have investigated the distribution and history of fault activity of 80 active fault zones. Although earthquake prediction is difficult, the behaviour of major active faults in Japan is being recognised. Japan Nuclear Cycle Development Institute (JNC) submitted a report titled 'H12: Project to Establish the. Scientific and Technical Basis for HLW Disposal in Japan' to the Atomic Energy Commission (AEC) of Japan for official review W. The Guidelines, which were defined by AEC, require the H12 Project to confirm the basic technical feasibility of safe HLW disposal in Japan. In this report the important issues relating to fault activity were described that are to understand the characteristics of current fault movements and the spatial extent and magnitude of the effects caused by these movements, and to

  7. Reconsidering Japan's underperformance in pharmaceuticals: evidence from Japan's anticancer drug sector.

    Umemura, Maki


    Unlike its automobile or electronics industries, Japan's pharmaceutical industry did not become a global leader. Japan remains a net importer of pharmaceuticals and has introduced few global blockbuster drugs. Alfred Chandler argued that Japan's pharmaceutical firms remained relatively weak because Western firms enjoyed an insurmountable first first-mover advantage. However, this case study of the anticancer drug sector illustrates that Chandler's explanation is incomplete. Japanese medical culture, government policy, and research environment also played a substantial role in shaping the industry. In the 1970s and 1980s, these factors encouraged firms to develop little few effective drugs with low side effects, and profit from Japan's domestic market. But, these drugs were unsuitable to foreign markets with more demanding efficacy standards. As a result, Japan not only lost more than a decade in developing ineffective drugs, but also neglected to create the infrastructure necessary to develop innovative drugs and build a stronger pharmaceutical industry.

  8. The great East Japan earthquake

    Fluke, R.


    'Full text:' More formally called the Tohoku-Chihou-Taiheiyo-Oki Earthquake of March 11, 2011, it was the ensuing tsunami that caused the most death and destruction to the north-east coastal region of Japan. It is also what caused the multiple meltdowns at Fukushima Dai-ichi. Reactor Unit 1, ironically, was scheduled to be permanently shut down for decommissioning just two weeks later. The Fukushima Dai-ichi nuclear power plant has a tsunami protection barrier designed for the worst recorded tsunami in that area since 1896 - to a height of 5.7 m. The plant itself is on an elevated grade of about 10 m. The tsunami, reported to be 14-15 m, caused inundation of the entire site with at least four metres of seawater. The seawater flooded the turbine building and damaged electrical equipment including the emergency diesel generators, leaving the entire six-unit nuclear power plan without any source of AC power, known as the 'station blackout scenario'. There are numerous reports available on-line at various sites. The Japanese Government report is frank and forthcoming on the causes and the lessons learned, and the lAEA Mission report is in-depth and well presented, not only as a factual account of the events but as a unified source of the conclusions and lessons learned. Photos of the catastrophe are available at the TEPCO web site: In this edition of the Bulletin there is a 'layman's' description of CANDU and BWR design in terms of the fundamental safety principles - Control, Cool and Contain as well as a description of how these principles were met, or not met at Fukushima Dai-ichi. Also, an excerpt from the IAEA Expert Mission is included. We 'technocrats' sometimes forget about the human aspects of a nuclear disaster. An essay by Dr. Michael Edwards is included entitled 'Psychology, Philosophy and Nuclear Science'. Other references to the events appear throughout this

  9. The great East Japan earthquake

    Fluke, R.


    'Full text:' More formally called the Tohoku-Chihou-Taiheiyo-Oki Earthquake of March 11, 2011, it was the ensuing tsunami that caused the most death and destruction to the north-east coastal region of Japan. It is also what caused the multiple meltdowns at Fukushima Dai-ichi. Reactor Unit 1, ironically, was scheduled to be permanently shut down for decommissioning just two weeks later. The Fukushima Dai-ichi nuclear power plant has a tsunami protection barrier designed for the worst recorded tsunami in that area since 1896 - to a height of 5.7 m. The plant itself is on an elevated grade of about 10 m. The tsunami, reported to be 14-15 m, caused inundation of the entire site with at least four metres of seawater. The seawater flooded the turbine building and damaged electrical equipment including the emergency diesel generators, leaving the entire six-unit nuclear power plan without any source of AC power, known as the 'station blackout scenario'. There are numerous reports available on-line at various sites. The Japanese Government report is frank and forthcoming on the causes and the lessons learned, and the lAEA Mission report is in-depth and well presented, not only as a factual account of the events but as a unified source of the conclusions and lessons learned. Photos of the catastrophe are available at the TEPCO web site: In this edition of the Bulletin there is a 'layman's' description of CANDU and BWR design in terms of the fundamental safety principles - Control, Cool and Contain as well as a description of how these principles were met, or not met at Fukushima Dai-ichi. Also, an excerpt from the IAEA Expert Mission is included. We 'technocrats' sometimes forget about the human aspects of a nuclear disaster. An essay by Dr. Michael Edwards is included entitled 'Psychology, Philosophy and Nuclear Science'. Other references to the events appear throughout this edition.(author)

  10. Advanced USC technology in Japan

    Fukuda, Masafumi [National Institute for Materials Science, Tsukuba, Ibaraki (Japan). High Temperature Materials Center


    The 600deg-C class Ultra Super-Critical(USC) steam condition technology was mainly developed through projects led by J-Power in the '80s and 90s'. In 2001, the project was successfully finished with newly developed 9-12% chromium steels. These materials were selected for the major parts of the USC power plants in Japan and almost half of the coal power plants have the USC steam condition today. However, aged plants, which were built in the '70s and early '80s will reach the point where they will need to be rebuilt or refurbished in the near future. The steam temperatures of the older plants are 538 deg-C or 566deg-C. We did a case study, retrofitting these plants with the USC and an advanced USC technology that takes a 700deg-C class steam temperature to increase thermal efficiency and to reduce CO{sub 2} emissions. The study showed that the advanced USC Technology(A-USC) is suitable for the retrofitting of aged plants and can reduce CO{sub 2} emissions by about 15%. The Japanese government launched the ''Cool Earth-Innovative Energy Technology Program'' in 2008 March to promote international cooperation and actively contribute to substantial global greenhouse gas emissions reductions. 21 technologies that will contribute to substantial reductions in CO{sub 2} emissions by efficiency improvement and low carbonization were selected. The A-USC that aims at 46% (net, HHV) thermal efficiency of coal power generation is included in the technologies. We started a large-scale development project of the A-USC technology in 2008 August. 700deg-C class boiler, turbine and valve technologies, which include high temperature material technology, will be developed. Some candidate materials for boilers are being tested. Turbine rotor and casing materials are being developed and tested, as well. Two years from the beginning of the project, we have obtained some useful test results regarding the candidate materials. (orig.)

  11. Japan/India. Towards a nuclear cooperation?

    Pajon, Celine


    As diplomatic, economic and strategic relationships between Japan and India have been intensively developed for a decade, the author aims at discussing the very sensitive approach to a nuclear cooperation between these two countries as Japan, while taking benefit of the American nuclear umbrella, is a strong defender of nuclear disarmament and non proliferation, and India has been developing its own civilian and military nuclear programme outside of the international regime which it considers as discriminative. The author first discusses factors which incited Japan to build up a strategic partnership with India in front of the evolution of the political context, of the powerful upswing of China, and of the new American orientation with respect to Delhi. She comments the economic and political stakes of the currently negotiated Japan-India nuclear cooperation agreement which not only concerns the relationships between these both countries, but also French and American industrial groups which are present on the Indian market. She also notices that the Fukushima accident which has put Japan energy choices into question again, is a new deal which is to be taken into account

  12. Male acceptance of condoms in Japan.

    Uchida, Y


    Current surveys indicate that more than 70% of married couples in Japan use condoms as their primary contraceptive method. The popularity of condoms is due to the oral contraceptive (OC) pills not being recognized as safe forms of contraception and IUDs not being legalized by the government until 1974. The history of condom use in Japan goes back to 1872 when condoms of thin leather were imported into Japan from England and France. Manufacturing of condoms in Japan began in 1909, mainly as a method for venereal disease prevention. The condom and induced abortion are now the major methods of contraception. 60% of the distribution of condoms is through pharmacies and cosmetic stores; 50% of the buyers are women. Since 1955, teams of family planning workers have distributed condoms by selling on a door-to-door basis, especially to lower middle class couples. Between 1969-75, 75% of contraceptive users were using condoms. Currently there are 81% users. The rhythm method ranks second in popularity at 30% between 1969-75. OCs have gradually increased recently to 3% users, but side effects have deterred people from selecting them. The proportion of IUD users has remained at a consistently low level for the past several years. Japan accounts for 1/3 of the total world production of condoms.

  13. Middle term prospects for Japan's safeguards

    Ogawa, T.


    Japan has responded to IAEA requirements on reinforced safeguard regulations. The IAEA additional protocol entered in force in Japan on December 1999. Japan submitted a preliminary information report to IAEA on June 2000 after joint works with the Nuclear Material Control Center (NMCC) of Japan. The first annual report was submitted to IAEA on May 2001. Another activity for the additional protocol is complementary accesses. The total 36 accesses to facilities have been done from November 2000 to September 2001. Procedures of access to managements are under discussion. MEXT (Ministry of Education, Culture, Sports, Science and Technology) has been constructing the Rokkasho Safeguards On-Site Laboratory from 1997, and the Rokkasho Safeguards Center from 2000. The Design Information Verification (DIV) is now ongoing. Much more personal resources will be needed for future inspections. Therefore, the budget for safeguards is increasing in contrast to the flat base budget for the total atomic energy. As for future activity, a MOX (Mixed Oxide Fuels) fuel processing plant is one of the issues for discussion. The construction of the MOX processing plant is supposed to begin on around 2004. The conclusion of additional protocol will be given by IAEA until end of 2002. Shift to integrated safeguards are under discussions by MEXT, NMCC and utilities of Japan parallel with IAEA. Key issues of discussion are cost saving for safeguards, development of personal resources for inspectors and the role of NMCC. (Y. Tanaka)

  14. Electronics manufacturing and assembly in Japan

    Kukowski, John A.; Boulton, William R.


    In the consumer electronics industry, precision processing technology is the basis for enhancing product functions and for minimizing components and end products. Throughout Japan, manufacturing technology is seen as critical to the production and assembly of advanced products. While its population has increased less than 30 percent over twenty-five years, Japan's gross national product has increase thirtyfold; this growth has resulted in large part from rapid replacement of manual operations with innovative, high-speed, large-scale, continuously running, complex machines that process a growing number of miniaturized components. The JTEC panel found that introduction of next-generation electronics products in Japan goes hand-in-hand with introduction of new and improved production equipment. In the panel's judgment, Japan's advanced process technologies and equipment development and its highly automated factories are crucial elements of its domination of the consumer electronics marketplace - and Japan's expertise in manufacturing consumer electronics products gives it potentially unapproachable process expertise in all electronics markets.

  15. L-Band RFI in Japan

    Soldo, Yan; de Matthaeis, Paolo; Le Vine, David M.


    In recent years, three instruments have been launched into orbit with the aim of producing global maps of sea surface salinity and soil moisture using the 1400-1427 MHz band: SMOS, Aquarius and SMAP. Although this frequency band is allocated to passive measurements only, RFI (Radio-Frequency Interference) is present in the data of all three missions. On a global scale, the three sensors have observed approximately the same distribution of RFI. Japan is an important exception that has implications for the design of RFI detection algorithms. RFI in Japan is caused by a large number of emitters belonging to the same system (TV receivers) and for this reason some traditional RFI detection strategies detect little to no RFI over Japan. The study of this case has led to an improvement of the approach to detect RFI in Aquarius data.

  16. Low level waste solidification practice in Japan

    Sakata, S.; Kuribayashi, H.; Kono, Y.


    Both sea dumping and land isolation are planned to be accomplished for low level waste disposal in Japan. The conceptual design of land isolation facilities has been completed, and site selection will presently get underway. With respect to ocean dumping, safety surveys are being performed along the lines of the London Dumping Convention and the Revised Definitions and Recommendations of the IAEA, and the review of Japanese regulations and applicable criteria is being expedited. This paper discusses the present approach to waste solidification practices in Japan. It reports that the bitumen solidification process and the plastic solidification process are being increasingly used in Japan. Despite higher investment costs, both processes have advantages in operating cost, and are comparable to the cement solidification process in overall costs

  17. Japan's Ambivalent Diplomacy on Climate Change

    Pajon, C.


    Japan often pictures itself as an environmental leader. While many examples of Japan's actions against climate change are in line with global climate change norms, others can be in opposition to them. This study, based on first hand interviews with Japanese policy makers and actors from the private and civil society sector, gives an informed perspective on the process through which Japan came to integrate and implement, at the domestic level, the international objective of climate change prevention, pointing out the discrepancies, tensions or synergies that emerged. As the current governance on climate change, and particularly after the Copenhagen conference, tends to reassert the importance of the national level against the global one, the Japanese case can serve as an example of tools and strategies that fully integrate the domestic level

  18. Insights into software development in Japan

    Duvall, Lorraine M.


    The interdependence of the U.S.-Japanese economies makes it imperative that we in the United States understand how business and technology developments take place in Japan. We can gain insight into these developments in software engineering by studying the context in which Japanese software is developed, the practices that are used, the problems encountered, the setting surrounding these problems, and the resolution of these problems. Context includes the technological and sociological characteristics of the software development environment, the software processes applied, personnel involved in the development process, and the corporate and social culture surrounding the development. Presented in this paper is a summary of results of a study that addresses these issues. Data for this study was collected during a three month visit to Japan where the author interviewed 20 software managers representing nine companies involved in developing software in Japan. These data are compared to similar data from the United States in which 12 managers from five companies were interviewed.

  19. Introduction of nuclear medicine research in Japan

    Inubushi, Masayuki [Kawasaki Medical School, Division of Nuclear Medicine, Department of Radiology, Kurashiki, Okayama (Japan); Higashi, Tatsuya [National Institutes of Quantum and Radiological Science and Technology, National Institute of Radiological Sciences, Chiba, Chiba (Japan); Kuji, Ichiei [Saitama Medical University International Medical Center, Department of Nuclear Medicine, Hidaka-shi, Saitama (Japan); Sakamoto, Setsu [Dokkyo University School of Medicine, PET Center, Mibu, Tochigi (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai, Miyagi (Japan); Momose, Mitsuru [Tokyo Women' s Medical University, Department of Diagnostic Imaging and Nuclear Medicine, Tokyo (Japan)


    There were many interesting presentations of unique studies at the Annual Meeting of the Japanese Society of Nuclear Medicine, although there were fewer attendees from Europe than expected. These presentations included research on diseases that are more frequent in Japan and Asia than in Europe, synthesis of original radiopharmaceuticals, and development of imaging devices and methods with novel ideas especially by Japanese manufacturers. In this review, we introduce recent nuclear medicine research conducted in Japan in the five categories of Oncology, Neurology, Cardiology, Radiopharmaceuticals and Technology. It is our hope that this article will encourage the participation of researchers from all over the world, in particular from Europe, in scientific meetings on nuclear medicine held in Japan. (orig.)

  20. Marital Adjustment and Psychological Distress in Japan

    Li, Angela; Robustelli, Briana L.; Whisman, Mark A.


    This study was conducted to examine the association between marital adjustment and psychological distress in a large, probability sample of married adults in Japan (N = 710) from the Midlife Development in Japan (MIDJA) study. Results indicate that positive and negative dimensions of marital adjustment were significantly associated with dimensional and categorical measures of psychological distress. Furthermore, the associations between marital adjustment and psychological distress remained significant when statistically controlling for neuroticism, quality of friend and family relationships, and demographic variables. These results demonstrate that the well-established association between marital adjustment and psychological distress found in European-American countries is also found in Japan. Findings support continued research on marital functioning and psychological distress in East Asian countries. PMID:28082761

  1. Situation of nuclear industry in Japan


    This document is a reprint of a note published by the nuclear service of the French embassy in Japan. It evokes the present day situation of nuclear facilities in Japan, the public acceptance and its attitude in front of accidents, the national energy program, the deregulation and competitiveness of nuclear power, the carrying out of the nuclear program, the future reactors, the fast neutron reactors, the dismantling activities, the fuel enrichment and reprocessing of spent fuels, the use of MOX fuel, the off-site storage, the vitrified and radiological wastes, the geological disposal of wastes, the prospects of the nuclear program, the companies involved in the Japan nuclear industry, the French-Japanese bilateral cooperation, and the ITER project in the domain of nuclear fusion. (J.S.)

  2. Current trends in rehabilitation engineering in Japan.

    Ohnabe, Hisaichi


    In 2005, the elderly generation comprised 20% of the Japanese population. This percentage will grow to approximately 30% in 2030, meaning that nearly one in three people in Japan will be 65 years of age or older. Japan is the first nation in the world to face this situation. This article uses the context of Japanese society to give an overview of the elderly and people with disabilities; the International Classification of Functioning, Disability, and Health model; rehabilitation engineering-related policy; and education. In addition, we examine how governmental programs and Japanese law regarding technical aids may evolve by 2030. Partner robots, intelligent powered wheelchairs, nursing robots, and other technologies are introduced as examples of rehabilitation engineering and assistive technology. We also discuss the volunteer activities of the Rehabilitation Engineering Society of Japan (RESJA) in response to the Asian tsunami disaster and the achievements of a group of students from a Japanese senior high school of industry.

  3. Status report of shielding investigation in Japan

    Shindo, M.


    The Japan Atomic Energy Research Institute (JAERI) was established in 1954, and immediately proceeded with the construction of a research reactor. The first symposium in Japan on nuclear energy was held in 1957. Most of the papers presented in the field of reactor shielding were limited to shielding materials and their fabrication. In the first stage of our investigations, our efforts were devoted to practical design studies of reactor shielding. As a result of these studies, it was found that the formulae at hand for calculations were inadequate, but at that time no electronic computer was available in Japan nor were theoretical calculations very actively undertaken. Problems on nuclear ship shielding had been investigated at the Ship Research Institute, since 1956 and many fruitful results had been obtained. About that time the Japan Atomic Industry Forum started activities and took the initiative in organizing shielding research. Research workers in the shipbuilding industry in particular have been seriously studying shielding problems. Few years after the first symposium, problems concerning more fundamental studies were treated by many research workers. Shielding experiments using radioisotopes were carried out and many fruitful results were obtained. They are described in the this paper. Medium size electronic computers became available in Japan, permitting a theoretical study group to make an active contribution. They produced some codes, and their results are also described in the following sections. This constituted the second stage of our investigations. A swimming-pool reactor, JRR-4 (Japan Research Reactor-4), has been under construction at JAERI since 1962 and will become critical in autumn 1964. After characteristic tests it will be a very powerful tool for the shielding investigations. This id the beginning of the third stage of investigations

  4. Toward freedom from cancer pain in Japan.

    Otsuka, Kuniko; Yasuhara, Hajime


    Life expectancy in Japan is highest in the world. Cancer is the leading cause of mortality in Japan, accounting for about 30 percent of all deaths. Many Japanese cancer patients experience severe pain although they and their families hope to be pain free at the end of their lives. Toward that end, the consumption of morphine in Japan has increased markedly since 1989. The amount of morphine hydrochloride and morphine sulfate consumed in 2001 was 6.1 times that used in Japan in 1989. However, the amount of morphine consumed in Japan is still less than in other developed nations, and was only one-sixth of the amount used in Australia in 2001. As a result, many Japanese cancer patients experience potentially manageable cancer pain, largely because the amount of the drug used by doctors is insufficient for pain control. An increasing number of Japanese doctors now understand that their patients' quality of life is most important in end-of-life care and how to use the three step analgesic ladder of the World Health Organization (WHO). However, other doctors do not understand these issues sufficiently causing some patients to die without good pain control. Both the general population and some medical professionals misunderstand and have prejudice against the use of morphine. Patients often do not participate in decision making about medical treatment because of remaining paternalism in the relationship between Japanese doctors and patients. Thus, cancer pain management in Japan is not as effective as it can be and not all Japanese cancer patients receive appropriate management for their cancer pain. To improve outcomes for Japanese patients, it is necessary for health professional and social work students and practicing professionals to receive contemporary education including an introduction to palliative care and ethics.

  5. Universal varicella vaccine immunization in Japan.

    Yoshikawa, Tetsushi; Kawamura, Yoshiki; Ohashi, Masahiro


    In 1974, Japanese scientists developed a live attenuated varicella vaccine based on the Oka strain. The efficacy of the vaccine for the prevention of varicella has been primarily demonstrated in studies conducted in the United States following the adoption of universal immunization using the Oka strain varicella vaccine in 1996. Although the vaccine was developed by Japanese scientists, until recently, the vaccine has been administered on a voluntary basis in Japan resulting in a vaccine coverage rate of approximately 40%. Therefore, Japan initiated universal immunization using the Oka strain varicella vaccine in November 2014. Given the transition from voluntary to universal immunization in Japan, it will also be important to monitor the epidemiology of varicella and herpes zoster. The efficacy and safety of co-administration of the varicella vaccine and measles, mumps, and rubella vaccine have been demonstrated in many countries; however, there was no data from Japan. In order to adopt the practice of universal immunization using the Oka strain varicella vaccine in Japan, data demonstrating the efficacy and safety of co-administration of varicella vaccine and measles and rubella (MR) vaccine were required. Additionally, we needed to elucidate the appropriate time interval between the first and second administrations of the vaccine. It is also important to differentiate between wild type and Oka vaccine type strains in herpes zoster patient with past history of varicella vaccine. Thus, there are many factors to consider regarding the adoption of universal immunization in Japan to control varicella zoster virus (VZV) infections. Copyright © 2016 Elsevier Ltd. All rights reserved.

  6. Outline of geothermal power generation in Japan

    Ezaki, Y


    The utilization of geothermal energy in electrical power generation throughout the world is described. Details of generating capacity and cost are given for Larderello, Italy; Wairakei, New Zealand: and the Geysers, USA. In Japan three types of conversion systems are used. These include the direct use of steam, direct use of hot water and binary fluid type systems. The history of Japanese investigation and exploitation of geothermal energy is reviewed and the status of the Matsukawa, Hakone, Otake and Takenoyu geothermal power plants is discussed. It is recommended that laws be enacted in Japan to encourage the development of this form of energy conversion.

  7. Operational experiences of INES in Japan


    Japan has introduced IAEA's INES in August, 1992. As of September, 1997, the total number of domestic nuclear events which have evaluated by using the INES system has amounted 119. In Japan, when a nuclear event occurs at a nuclear power plant, a provisional evaluation is performed immediately by Nuclear Power Operation Administration Office, MITI. The final evaluation of events is implemented a few months after event occurrence by the Evaluation Committee on Incidents and Failures of Nuclear Power Plant which holds a neutral position. The results of the evaluation are transmitted to IAEA according to the INES reporting criteria

  8. The Arctic policy of China and Japan

    Tonami, Aki


    At the May 2013 Arctic Council Ministerial Meeting, five Asian states, namely China, Japan, India, Singapore and South Korea, were accepted to become new Permanent Observers at the Arctic Council. Nonetheless, little attention has been paid to the Asian states and their interest in the Arctic. Most...... discussions have focused on China and the assessment of China’s interest in the Arctic is divided. This paper attempts to fill this gap by presenting and comparing the various components of the Arctic policies of China and Japan. Referring to Putnam’s model of the “two-level game” and Young’s categorization...

  9. Status of LMFBR development project in Japan

    Nagane, G.; Akebi, M.; Matsuno, Y.


    Initiation of the LMFBR development project in Japan was decided by the Atomic Energy Commission of Japan in 1966. In 1967, the Power Reactor and Nuclear Fuel Development Corporation (PNC) was established to realize the project as a part of its tasks of a wide scope covering all the reseatch and development activities concerning fuel cycle. In the present paper the status of experimental fast reactor (Joyo), which is the first milestone of the LMFBR project, prototype fast reactor (Monju) and R and D activities supporting the project including that for larger LMFBRs in the future is described. (author)

  10. Introductory Overview of Stone Heritages in Japan

    Kato, Hirokazu; Oikawa, Teruki; Fujita, Masayo; Yokoyama, Shunji


    As one contribution to 'Global Heritage Stone Resources' (GHSR), some stone heritages in Japan, which are nominated in the interim list, are briefly introduced. The geology of Japanese Islands where are the one of the most active areas in the history of the Earth, is very complicated. Therefore Japanese Islands consist of various kinds of minerals and rocks. Some of them were used to make stone implements and accessories. Japanese people also used to the best possible advantage to built tombstone, gate, pavement ,and the basement and wall of the large building such as temples, shrines, castles and modern buildings. 1. Stone Heritages of Pre-historical age: In the late Pleistocene and the early Holocene, ancient Japanese used obsidian cooled rapidly from rhyolitic make small implements and accessories. For example, Shirataki, Hokkaido (north island) is the largest place producing obsidian in Japan where Paleolithic people made arrowhead, knives and so on. Another example, Jade yielded in Itoigawa City, Japan Sea coast of central Japan, was made in the metamorphic rock about five hundred million years ago. Itoigawa area is only one place where jade is abundantly produced in Japan. Ancient people had been already collected and processed to ornaments although it is very hard and traded in wide area more than several thousand years ago. 2. Stone Heritages of Historical age: 2.1 Archaeological remains: In the Kofun (old mound) period (250 to 538 AD), stone burial chambers were used for old mounds to preserve against the putrefaction and to protect from the theft. For example, Ishibutai Kofun ("ishi" means "stone" and "butai" means "stage") in Nara old capital city, southwest Japan, is the largest known megalithic structure made of granite in Japan. 2.2 Stone walls of some typical castles Stones used is because of not only the rich reserves of rocks but also restriction of transportation. Osaka (second biggest city) castle, are composed of Cretaceous granite

  11. Control of radiation sources in Japan

    Maki, S.


    The report refers to the regulations for radioactive material in force in Japan, and to the organizations with responsibilities for regulating radiation sources. An outline of the law regulating the use of radiation sources and radioactive materials is provided, including its scope, types of radiation sources under control, exemptions and the system of notification, authorization and inspection. The experience of Japan with orphan sources is presented in three different cases, and the measures carried out to store the orphan sources in safe conditions. (author)

  12. Current Indoor Air Quality in Japan.

    Jinno, Hideto


    People spend more than two thirds of their daily time indoors. Hence, maintaining a healthy indoor environment is indispensable for the prevention of building related illness. In Japan, guidelines for indoor air quality have been established for 13 volatile/semi-volatile organic compounds (VOCs/SVOCs). These guidelines are now under revision by the Committee on Sick House Syndrome: Indoor Air Pollution. In order to gain information on the current indoor air pollutants and their levels, we carried out a nation-wide survey of VOCs and aldehydes in indoor residential air during 2012-2013. In this review, I concisely summarized the current indoor air quality of Japan.

  13. Japan's telecommunications - New initiatives in space communications

    Iida, T.


    Despite recent advances in optical transmission technology, intensive R&D work in the field of satellite communications is now being undertaken in Japan. It is believed that satellites offer advantages in several important areas, including wide coverage broadcasting, immediacy of service, suitability for the implementation of HDTV, and advantages in disaster communications and other social services. Here, some experimental projects in the field of satellite communications planned in Japan for the 1990s are summarized. In particular, attention is given to broadcast satellite development, intersatellite links, advanced mobile communication concepts, large antenna assembly experiment, small satellite R&D, and Pan-Pacific information network experiment.

  14. Human rights in Japan: progress and challenges

    Yolanda Muñoz González


    Full Text Available The aim of this paper is to present an overview of the improvements and challenges that Japan has been facing between 1983 and 2007. The paper explores the interaction among the different stakeholders –i.e. the Japanese Government, international organizations and civil society- to advance full access to citizenship regarding gender equality, the elimination of social and physical barriers for the inclusion of people with disabilities and elderly persons; ethnic minorities –specifically the situation of the Ainu people and the Buraku community – and the persons considered as “foreigners” living in Japan.

  15. 76 FR 8774 - Granular Polytetrafluoroethylene Resin From Japan


    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-386 (Third Review)] Granular Polytetrafluoroethylene Resin From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five... revocation of the antidumping duty order on granular polytetrafluoroethylene resin from Japan would be likely...

  16. Area Handbook Series: Japan: A Country Study


    special decorations, eating noodles on New Year’s Eve to show continuity into the new year, and playing a poetry card game are among the more...transmitted by satellite for instant replay after the government, in 1979, set up the Communications and Broadcasting Satellite Or- ganization. Japan’s first

  17. Family Psychology and Family Therapy in Japan.

    Kameguchi, Kenji; Murphy-Shigematsu, Stephen


    Reviews the development of family psychology and family therapy in Japan, tracing the origins of these movements, explaining how these fields were activated by the problem of school refusal, and describing an approach to family therapy that has been developed to work with families confronting this problem, as well as preventive programs of family…

  18. Characteristics of primary sclerosing cholangitis in Japan.

    Takikawa, Hajime


    At a workshop on primary sclerosing cholangitis (PSC) held during Digestive Disease Week - Japan 2003, 388 PSC cases in Japan were analyzed. Two peaks in the age distribution were also observed in this survey. Jaundice and itching, major symptoms in PSC patients included in the diagnostic criteria, were observed in only 28% and 16%, respectively. Alkaline phosphatase levels were less than twofold of the upper limit of the normal range in 35%. In this regard, the diagnostic criteria in 2003 from the Mayo Clinic, including cholestatic symptoms and two- to threefold increases in serum alkaline phosphatase, should be modified in Japan. Inflammatory bowel diseases were complicated in 37%, and autoimmune pancreatitis (AIP) in 7.2%. PSC cases with inflammatory bowel diseases were younger than the average, creating the firstpeak in age distribution, and have similar characteristics compared to patients with PSC in foreign countries. In addition, even after the exclusion of cases of sclerosing cholangitis complicated with AIP, the second peak in the age distribution was clearly evident. Recently, a concept of immunoglobulin G4-related sclerosing cholangitis has been postulated, which has a similar pathogenesis to AIP but without apparent pancreatic lesions. PSC patients without apparent involvement of the pancreas may be present in older patients and seem to be specific to Japan.


    Rini Shahriyani Shahrullah


    Full Text Available Japan has ratified the 1951 Convention regarding the status of Refugees and the 1967 Protocol relating to the Status of Refugees since 1981 and 1982, yet Japan only accepted an exceptionally low number of refugees in the course 30 years since it ratified the Convention. Japan needs to closely revise and align its national policies with international agreements that it is signatory to. The main framework with which Japan’s government still tackles the issue of refugees is tightly restrained by its overall controlling immigration policies in an attempt to remain a homogenous nation. Japan has a long way to go in order to fully comply with the spirit of the Convention, the Protocol, and international instruments relating to the Status of Refugees. Jepang telah meratifikasi Konvensi Mengenai Status Pengungsi 1951 dan Protokol tentang Kedudukan Pengungsi 1967 sejak tahun 1981 dan 1982, namun Jepang hanya menerima sejumlah kecil pengungsi dalam kurun waktu 30 tahun sejak diratifikasinya konvensi tersebut. Jepang harus meninjau kembali dan memastikan bahwa kebijakan-kebijakan nasional negaranya telah sesuai dengan perjanjian internasional yang telah ditandatangani Jepang. Kerangka kerja pemerintah Jepang dalam menangani isu pengungsi sangat dibatasi oleh berbagai pengetatan kebijakan imigrasi yang dikeluarkan dalam semangat mempertahankan homogenitas bangsa. Jepang memiliki banyak pekerjaan rumah yang harus dilakukan agar dapat memenuhi semangat konvensi, protokol, dan berbagai instrumen internasional terkait status pengungsi.

  20. English Textbooks in Japan and Korea

    Yuasa, Katsura


    English education in Japan and Korea are similar in some respects. Although both countries are not completely but mostly monolingual societies, where citizens do not need English in their daily life, they have begun to realize the importance of English as a tool for international communication, and as a result their English education is becoming…

  1. On Being There: Korean in Japan.

    Maher, John C.; Kawanishi, Yumiko


    Examines the experiences of ethnic Koreans and the Korean language in Japan since 1945, focusing on Japanese attitudes toward Koreans and the Korean language, provisions for Korean and bilingual education, and the increasing influence of Koreans in Japanese society. (18 references) (MDM)

  2. Japan's spent fuel and plutonium management challenge

    Katsuta, Tadahiro; Suzuki, Tatsujiro


    Japan's commitment to plutonium recycling has been explicitly stated in its long-term program since 1956. Despite the clear cost disadvantage compared with direct disposal or storage of spent fuel, the Rokkasho reprocessing plant started active testing in 2006. Japan's cumulative consumption of plutonium has been only 5 tons to date and its future consumption rate is still uncertain. But once the Rokkasho reprocessing plant starts its full operation, Japan will separate about 8 tons of plutonium annually. Our analysis shows that, with optimum use of available at-reactor and away-from-reactor storage capacity, there would be no need for reprocessing until the mid-2020s. With an additional 30,000 tons of away-from-reactor (AFR) spent-fuel storage capacity reprocessing could be avoided until 2050. Deferring operation of the Rokkasho plant, at least until the plutonium stockpile had been worked down to the minimum required level, would also minimize international concern about Japan's plutonium stockpile. The authors are happy to acknowledge Frank von Hippel, Harold Feiveson, Jungming Kang, Zia Mian, M.V. Ramana, and other IPFM members, as well as the generous grant from the MacArthur Foundation for helping make this research possible.

  3. Development of nuclear powered ship in Japan

    Sato, Hiroshi


    The development of nuclear merchant ship in Japan was started in 1955 by the establishment of Nuclear Ship Study Group, and since then, the investigation, test and research on nuclear ships have been continued. As a result, a nuclear ocean observation and supply ship was designed for trial. Researches were carried out also in JAERI and Institute for Technical Research of Ships. Meanwhile, the nuclear icebreaker Lenin was completed in Soviet Union in 1959, the nuclear ship Savannah set out for maiden voyage in U.S. in 1962, and the construction of the nuclear ore carrier Otto Hahn was prepared in FRG. Japan Nuclear Ship Development Corp. was established in 1963, and started the design and construction of the first nuclear ship in Japan, Mutsu. The basic policy in the construction is the improvement of nuclear ship technology, the securing of safety, and the use of domestic technologies as far as possible. The progress of the design, construction and test of the Mutsu is described. Owing to the problem of radiation leak, the development of nuclear ships stagnated for a while, but the nuclear plant of the Mutsu demonstrated the expected performance in the functional test, land criticality test and zero output test, and it is expected that the bud of the independent development brought up so far can bear valuable fruit. The independent development of marine nuclear reactors should be continued by selecting the way most suitable to Japan. (Kako, I.)

  4. Multicultural and Multiethnic Education in Japan

    Nomoto, Hiroyuki


    In Japan, the Ainu people have been living mainly in Hokkaido and many Koreans continue to live since the end of the World War Two. Since 1990's, the number of migrant workers has increased rapidly. In this sense, Japanese society has been multicultural and multiethnic. However, those minority groups have been strictly discriminated against in…

  5. Japan's Teachers Earn Tenure on Day One

    Ahn, Ruth; Asanuma, Shigeru; Mori, Hisayoshi


    Teachers in Japan earn tenure on their first day of employment--not after two years of experience based on evaluations of teaching performance or student test scores. This is almost too good to be true. If tenure is so easy to attain, how do the Japanese make sure their teachers, especially novice teachers hired with little teaching experience,…

  6. Role of fast breeders in Japan

    Oyama, A.; Tomabechi, K.


    To meet increasing future energy demand in Japan utilization of fission energy should be promoted. In particular it is of vital importance to develop and utilize FBRs as soon as possible in order to save the natural uranium needed. If one considers the commercial introduction of FBRs in the mid-1990s in Japan, a delay of only one year will eventually result in an additional demand for natural uranium of more than 20,000 tons, because several LWRs will have to be installed instead. Ten years have passed since the development of FBRs in Japan was initiated as a national project with the highest priority and now the experimental fast reactor JOYO is successfully being operated at 50MW and the prototype fast breeder reactor MONJU has reached the stage of proceeding to construction with a schedule of operation in the mid-1980s. Following operation of MONJU, construction of a large demonstration reactor of 1000 - 15000 MW(e) will be undertaken. Some 2 - 3 years after the construction of the demonstration reactor, a series of reactors will be constructed similar in size and design to promote commercialization of LMFBRs. Strong efforts will be made to put this programme into practice. It is expected that LMFBRs will play an important role in mitigating the serious problem of energy supply in Japan foreseeable around the turn of the century

  7. X-Ray Lithography In Japan


    electrons hitting the walls of the ring is not in the direct line of sight of a tilted beamline. A translating mirror is then used to expand the...34 Remarch Peromnnel and Facilities for Resist R&D T. Nakayama TOK, 1590 Tabata , Samukawa-cho, Kohza-gun, Kanagawa-ken 253-01 Japan M. Sasago Matsushita

  8. Entomological journals and publishing in Japan.

    Fukatsu, Takema

    Here I present an overview of entomological journals and publishing in Japan, thereby providing a convenient portal to the valuable scientific resources for the world's entomological researchers and scientific communities. Currently, except for several international journals published fully in English such as Applied Entomology and Zoology and Entomological Science , many entomological and entomology-related journals in Japan are not indexed by major scientific databases like Web of Science, and therefore they are neither conveniently recognizable nor accessible for the world's entomological communities. However, I point out that many of the contents of such journals are freely available via Japan's public platforms for electronic scientific literature, Japan Science and Technology Information Aggregator, Electronic (J-stage) or Citation Information by National Institute of Informatics (CiNii). Here I list 32 entomological and entomology-related societies and their 45 journals, the majority of which belong to either the Union of Japanese Societies for Insect Sciences (UJSIS), the Union of the Japanese Societies for Systematic Biology (UJSSB), the Union of Japanese Societies for Natural History (UJSNH), or the Union of Japanese Societies for Biological Science (UJSBS), with their respective URL and open-access availability.

  9. Japan's System of Official Development Assistance

    ... is a founding principle of the “IDRC approach” to development assistance. ...... Given the structure and practices of the Government of Japan, it is very difficult to ...... The recipient country must provide their housing and tax exemptions on ...... involving 11 Japanese corporations for the afforestation of land in Malaysia.

  10. Current asthma deaths among adults in Japan

    Tsugio Nakazawa


    Full Text Available Recent asthma deaths were examined from yearly reports of the Ministry of Health, Labor and Welfare of Japan and from reports published by the Japan Asthma Death Investigation Committee on 811 deaths over the period 1992–2000. The rate and number of recent asthma deaths in Japan have been decreasing rapidly. Most asthma deaths were of patients aged 70–90 years and there has been a marked trend for increased asthma deaths in the elderly. As for the circumstances surrounding the deaths, sudden death, unstable sudden aggravation and intermittent aggravation were mainly noted. Respiratory infections, fatigue and stress were the major courses of fatal attacks contributing to deaths due to asthma. Many of the patients who died from asthma had been diagnosed as having as moderate to severe asthma and many had non-atopic asthma. There are some reports that suggest that the recent decrease in asthma deaths in Japan is correlated with the use of inhaled cortico- steroids.

  11. Urbanization and Changing Funerals in Japan

    栗原, 淑江; Toshie, Kurihara


    In recent years, the 'death problem' has become a big topic of discussion in Japan. In the past, Japanese people did not like to talk about such an ominous matter as death. However, issues surrounding death, such as euthanasia, brain death, terminal care,

  12. APWR - Mitsubishi, Japan/Westinghouse, USA

    Aeba, Y.; Weiss, E.H.


    Nuclear power generated by light water reactors accounts for approximately 1/3 of Japan's power supply. Development of the Advanced Pressurized Water Reactor (APWR) was initiated by five PWR electric power companies (Hokkaido, Kansai, Shikoku, Kyushu and Japan Atomic Power), Mitsubishi Heavy Industries, and Westinghouse, with a view to providing a nuclear power source to meet future energy demand in Japan. The APWR was developed based on the results of the Improvement and Standardization Program, promoted by the Ministry of International Trade and Industry, with reconsideration of the needs of age, such as construction cost reduction, enhanced safety and increased reliability. One of the important concepts of the APWR is its large power rating that decreases the construction cost per unit of electric generation capacity. Though the electric output was lower at the early stage of basic design than it is now, uprating to approximately 1530 MW is achieved based on the results of design progress and high efficiency improvements to the steam turbine and reactor coolant pumps. Furthermore, the APWR remarkably enhances reliability, safety operability and maintainability by introducing new technologies that include a radial reflector and advanced accumulators. The first APWR is planned to be built at Tsuruga No. 3 and No. 4 by the Japan Atomic Power Company and will be the largest commercial operation plant in the early 21st century. (author)

  13. Free Resources for Teaching About Japan.

    Wojtan, Linda S.

    This publication describes free print and audiovisual materials for teaching about Japan in elementary and secondary schools. The booklet was written to enable teachers to take advantage of the many free materials that are currently available. The first section cites sources of free materials in the United States. Names and addresses of groups…

  14. The Japan white book about nuclear energy


    We find here a partial translation of the white book on nuclear energy published by Japan. In this document are the following themes: the safety of nuclear energy, research and development (JAERI), international cooperation, financing distribution, administrative chart of principal authorities and state agencies, budget for 1996 of nuclear energy and situation of the Japanese nuclear park. (N.C.)

  15. With a Little Help from Japan

    Purcell, John


    Over the last year, the author's students have become very interested in popular culture from Korea and Japan. In particular, the class liked the films of Hayao Miyazaki, an Oscar-winning director who is considered one of the foremost anime filmmakers. In this article, the author came to an idea while he and the first-grade class were discussing…

  16. Solid state ionics: a Japan perspective

    Yamamoto, Osamu


    The 70-year history of scientific endeavor of solid state ionics research in Japan is reviewed to show the contribution of Japanese scientists to the basic science of solid state ionics and its applications. The term 'solid state ionics' was defined by Takehiko Takahashi of Nagoya University, Japan: it refers to ions in solids, especially solids that exhibit high ionic conductivity at a fairly low temperature below their melting points. During the last few decades of exploration, many ion conducting solids have been discovered in Japan such as the copper-ion conductor Rb4Cu16I7Cl13, proton conductor SrCe1-xYxO3, oxide-ion conductor La0.9Sr0.9Ga0.9Mg0.1O3, and lithium-ion conductor Li10GeP2S12. Rb4Cu16I7Cl13 has a conductivity of 0.33 S cm-1 at 25 °C, which is the highest of all room temperature ion conductive solid electrolytes reported to date, and Li10GeP2S12 has a conductivity of 0.012 S cm-1 at 25 °C, which is the highest among lithium-ion conductors reported to date. Research on high-temperature proton conducting ceramics began in Japan. The history, the discovery of novel ionic conductors and the story behind them are summarized along with basic science and technology.

  17. Policy of Japan of radioactive waste management

    Oyama, A.


    Development and utilization of nuclear power has been steadily pursued in Japan in order to secure a stable source of energy over a long-term period. According to the author, nuclear power plants are operated carefully and safely and have been generating electricity for more than twenty years. In fact, it now accounts for approximately 30% of total electricity generated, and has become an integral part of the energy supply in Japan. The benefits of nuclear technology are now enjoyed not only in the electricity production, but also in the fields such as medicine and other industries. Under such circumstances, radioactive waste management generated in nuclear power plants and reprocessing plants as well as in industrial and medical uses of radiation, is an important part of the nuclear energy policy, and there is also a strong public interest in this field. The government is active in formulating waste management policies based on the basic policies indicated by Japan ATomic Energy Commission (JAEC). This presentation will touch upon the future perspective of radioactive waste management policy in Japan

  18. Identity, gender and teaching English in Japan

    Nagatomo, Diane Hawley


    How do teachers, who have chosen to settle down in one country, manage the difficulties of living and teaching English in that country? This book answers this question by investigating the personal and professional identity development of ten Western women with Japanese spouses who teach English in various educational contexts in Japan.

  19. Application of neutron radiography in Japan

    Kobayashi, M.; Wada, N.; Sekita, J.; Sanno-cho, Ota-ku, Tokyo, Japan)


    The history and the present state of neutron radiography in Japan are reviewed. Three types of neutron sources, namely nuclear reactors, accelerators and radioisotopes are now used. The interests on the application on neutron radiography become greater and greater in the industries, such as atomic energy, aeronautics and space etc. (Auth.)

  20. Megastock'97 Kongres, Juni, 1997, Sapporo, Japan

    Heller, Alfred


    Report on experiences, contacts and novelties in the technics of energy storage made at the Megastock'97 konference in Sapporo, Japan, seen from a Danish point of view.A number of methods and technics for energy storgare are discussed and recommendations to the Ministery of Environment and Energy...

  1. U.S.-Japan Quake Prediction Research

    Kisslinger, Carl; Mikumo, Takeshi; Kanamori, Hiroo

    For the seventh time since 1964, a seminar on earthquake prediction has been convened under the U.S.-Japan Cooperation in Science Program. The purpose of the seminar was to provide an opportunity for researchers from the two countries to share recent progress and future plans in the continuing effort to develop the scientific basis for predicting earthquakes and practical means for implementing prediction technology as it emerges. Thirty-six contributors, 15 from Japan and 21 from the U.S., met in Morro Bay, Calif.September 12-14. The following day they traveled to nearby sections of the San Andreas fault, including the site of the Parkfield prediction experiment. The conveners of the seminar were Hiroo Kanamori, Seismological Laboratory, California Institute of Technology (Caltech), for the U.S., and Takeshi Mikumo, Disaster Prevention Research Institute, Kyoto University, for Japan . Funding for the participants came from the U.S. National Science Foundation and the Japan Society forthe Promotion of Science, supplemented by other agencies in both countries.

  2. Parental Educational Investments and Aspirations in Japan

    Lee, Kristen Schultz


    Previous models of parental educational investments focus on the composition of the sibship (number, gender, ordering, and spacing) and on the social and institutional context in which investment decisions are made. Social-institutional models predict that parents in Japan are likely to underinvest in girls because of their transient status in the…

  3. Japan, new agenda for energy security

    Chrisstoffels, J.H.


    The author argues that the Japanese government will actively seek to strengthen security of supply. Japan has almost no domestic energy reserves. It is Asia's leading energy importer, but it faces increasing competition for resources from China and India. This has led to growing concern among Japanese policy makers. In the spring of 2007 a new Basic Energy Law was drafted that offers a strategic change of direction, away from a policy emphasis on free (energy) trade promotion and liberalisation of domestic energy markets. Japan will boost energy diplomacy towards energy producing countries and increase financial guarantees to Japanese oil and gas development companies. At the same time, Japan will raise efforts to lower its dependency on foreign oil and gas. To this end, it has set ambitious targets for further nuclear power development and the promotion of bio-trade. The author points at a multitude of complexities that may impede the success of these policies, Still, EU policy makers should be aware that Japan's energy policy has changed, driven by the conviction that markets alone cannot be relied upon to guarantee a secure supply of energy. [nl

  4. The lithium-ion accumulators in Japan

    Lazzari, O.


    This document takes stock on the different technologies of lithium based batteries developed in Japan as the materials used to produce their different elements. The today tendencies of the japanese researches are discussed. The applications of the lithium-ion are presented. A list of the main public and private laboratories in the domain and the research programs is provided. (A.L.B.)

  5. Core Discussion Networks in Japan and America

    Boase, Jeffrey; Ikeda, Ken'ichi


    Arguments regarding the high prevalence of interpersonal collectivism in Japan typically hinge on the assumption that Japanese communication networks are more enduring, frequently contacted, and dominated by kin and work ties than networks in Western countries. However, this assumption has not been examined using nationally representative data.…

  6. IAEA Remediation Mission to Japan Concludes


    Full text: A team of international experts today completed a preliminary assessment of the strategy and plans being considered by the Japanese authorities to remediate the areas off-site the Fukushima Dai-ichi Nuclear Power Plant reported to have elevated levels of radiation. The IAEA dispatched the mission to Japan on 7 October following a request from the country's Government. The mission, comprising 12 international and IAEA experts from several countries, visited numerous locations in the Fukushima Prefecture and conducted meetings in Tokyo and Fukushima with Japanese officials from several Ministries and institutions. ''The meetings held and visits made by the team over the last eight days gave us a first-hand appreciation of the extraordinary efforts and dedication on the part of Japanese people in their effort to remediate the areas affected by elevated levels of radiation in the Fukushima Prefecture,'' says Mr. Juan Carlos Lentijo, Team Leader and General Director for Radiation Protection at Spain's nuclear regulatory authority. ''As Japan continues its current remediation efforts, it is our belief that this work will bring relief to the populations who are affected by the consequences of the nuclear accident at the Fukushima Dai-ichi nuclear power plant.'' In a Preliminary Summary Report delivered to Japanese authorities today, the team prepared a set of conclusions including, though not limited to, the following: - Japan developed an efficient program for remediation - allocating the necessary legal, financial and technological resources to bring relief to the people affected by the accident, with priority being given to children. The Team was impressed with the strong commitment to the remediation effort from all institutions and parties involved, including the public; - Japan has also taken practical measures to inform the public and involve residents and local institutions in the process of defining its remediation strategy; - Japan is advised to avoid

  7. Japan’s National Interests in Taiwan


    the existential recognition of the power asymmetry at the core of the issue. C. PRC POWER ASYMMETRY: “COMPREHENSIVE NATIONAL POWER” Dealing with a...technological strength. Japan needs a grand strategy consonant with its self-image as a humanistic , democratic and peaceful nation, and a strategy able

  8. Military aspect of nuclear policy of Japan

    Fujita, Yuko


    Military aspect of nuclear policy of Japan was outlined. In 1952 Prime Minister Yoshida asked to prepare production of weapons for rearmament and to establish Science and Technology Agency such as to overcome lack of science research budget and inefficiency of research and cooperation. Kaya and Fushimi proposed establishment of Atomic Energy Commission as recommendation of Science Council of Japan. In 1954 Nakasone proposed budget for nuclear energy with yen 235 million to construct reactor. In 1955 Japanese delegation participated in international conference on peaceful use of nuclear energy at Geneva and nonpartisan members proposed Atomic Energy Basic Law, which limited the use of nuclear technology to peaceful purposes, ensured three principles - democratic methods, independent management, and transparency - as the basis of nuclear research and promoted international co-operation. In 1956 Atomic Energy Commission and Science and Technology Agency were established with other organizations under this law. According to internal report in the age of Prime Minister Sato, nuclear policy in Japan would be (1) no holding nuclear weapon for the time being, (2) maintaining economic and technical potential of nuclear weapon production and (3) considering no restraint for this policy whether Japan participated in NPT or not. Fuel cycle program of Monju reactor and reprocessing for power production seemed to be deployed corresponding to (3) above. Irradiated blanket of Monju reactor could be reprocessed to produce highly purified plutonium suited for nuclear bombs. (T. Tanaka)

  9. Servicing NPPs in Japan, Korea and Taiwan

    Bohmann, W.; Poetz, F.


    More than 45 comparable orders (for equipment or services ) have been carried out in Japan, Korea and Taiwan by ABB Reaktor since 1982. Recently contracts to deliver inspection and repair equipment for the core baffle former bolts of Japanese NPPs, and in 1990, a contract to clean two steam generators in Korea, together with Pacific Nuclear Services, USA, were won. 2 figs

  10. Brasil-Japan collaboration experiment at Chacaltaya

    Fujimoto, Y.


    The historical aspects on the beginning of the Brazil-Japan Collaboration on cosmic ray experiments at Chacaltaya-Bolivia are introduced. The physical aspects concerning with this subject are presented. Some well-Known results are briefly discussed. (L.C.) [pt

  11. Japan's international peace operations in South Sudan ...


    Nov 20, 2016 ... the new mission was based on the Peace and Security Legislation enacted by the Abe government in .... Japan's commitment to human security and peacekeeping operations in. South Sudan. On the basis of ..... cameras on their helmets in order to prove that their shootings were legally justifiable (Mainichi ...

  12. Central bank capital, financial strength, and the Bank of Japan

    Thomas F. Cargill


    This Economic Letter addresses central bank capital and financial strength in the context of Bank of Japan policy (Cargill 2005). Specifically, it reviews general considerations about central bank capital and financial strength, discusses recent Bank of Japan policy in the context of capital structure, evaluates the Bank of Japan's concern in the context of the broader issue of central bank independence, and draws some lessons from recent Bank of Japan policy.

  13. Memento. Maritime transport of MOX fuels from Europe to Japan


    The maritime transport of MOX fuels from Europe to Japan represents the last of the 3 steps of transport of the nuclear fuel reprocessing-recycling program settled between ORC (Japan), BNFL (UK) and Cogema (France). This document summarizes the different aspects of this program: the companies concerned, the physical protection measures, the US-Japan agreements (accompanying warship), the in-depth safety, the handling of MOX fuels (containers and ships), and the Japan MOX fuel needs. (J.S.)

  14. The cost of schizophrenia in Japan

    Sado M


    Full Text Available Mitsuhiro Sado,1 Ataru Inagaki,2 Akihiro Koreki,1 Martin Knapp,3 Lee Andrew Kissane,4 Masaru Mimura,1 Kimio Yoshimura4 1Department of Neuropsychiatry, Keio University School of Medicine, 2Center for Clinical Psychopharmacology, Institute of Neuropsychiatry, Tokyo, Japan; 3Department of Social Policy, London School of Economics and Political Science, London, UK; 4Department of Health Policy and Management, Keio University School of Medicine, Tokyo, Japan Introduction: Schizophrenia is a disorder that produces considerable burdens due to its often relapsing/remitting or chronic longitudinal course. This burden is felt not only by patients themselves, but also by their families and health care systems. Although the societal burden caused by this disorder has been evaluated in several countries, the magnitude of the societal cost of schizophrenia in Japan has never been estimated. The aim of this study is to clarify the societal burden of schizophrenia by estimating the cost of schizophrenia in Japan in 2008. Methods: A human capital approach was adopted to estimate the cost of schizophrenia. The total cost of schizophrenia was calculated as the sum of the direct, morbidity, and mortality costs. Schizophrenia was defined as disorders coded as F20.0–F20.9 according to the International Classification of Diseases-10. The data required to estimate the total cost was collected from publicly available statistics or previously reported studies. Results: The total cost of schizophrenia in Japan in 2008 was JPY 2.77 trillion (USD 23.8 billion. While the direct cost was JPY 0.770 trillion (USD 6.59 billion, the morbidity and mortality costs were JPY 1.85 trillion (USD 15.8 billion and JPY 0.155 trillion (USD 1.33 billion, respectively. Conclusion: The societal burden caused by schizophrenia is tremendous in Japan, similar to that in other developed countries where published data exist. Compared with other disorders, such as depression or anxiety disorders

  15. Japan and atomic co-operation


    Japan, which is host country for the Ninth Regular Session of the Agency General Conference, has an important programme of nuclear power development to meet future needs. In addition, Japan is active in other applications of atomic energy and is building up a domestic nuclear engineering industry. Japan has profited by the Agency as a channel of international cooperation, and was a party to the first bilateral agreement in which the responsibility for administering safeguards against the diversion of materials to military purposes, was transferred to the Agency. Japan has also lent support to Agency programmes by gifts, training courses, research, and the loan of experts. In 1961, the Japan Atomic Energy Commission (AEC) formulated the 'Long-Range Programme for Development and Utilization of Atomic Energy', on the basis of the economic prospects of nuclear power generation, and the conditions necessary to meet the ever-increasing domestic energy demands. According to this programme, in the light of power reactor development trends overseas, it is expected that nuclear power costs will compete with those of oil burning stations by 1970. On this basis, total nuclear power generating capacity of 1000 MW(e) will be attained by 1970, and 7000 - 9 500M(e) by 1980. As a prelude to the above programme the Japan Atomic Power Company (JAPCO) began construction in 1959 of a graphite-moderated gas-cooled nuclear power station (Improved Calder Hall type) of 165 MW(e) gross capacity. This is now progressing smoothly, and reached criticality in May 1965; it is expected to supply commercial power by the end of this year. The second nuclear power station will be built by the same company on the coast of the Japan Sea, with a light water-moderated reactor of 250 - 300 MW(e) capacity. The construction plan i s currently being pushed forward for completion in 1970. Thereafter three private utility companies - Tokyo, Kansai and Chubu Electric Companies - are doing preparatory work for

  16. International development of Japan's Nuclear Industry. Indispensable Japan-U.S. cooperation

    Saigo, Masao


    It is significant to internationally develop the nuclear power plants technology that has been fostered by Japan's nuclear industry. It is also important to work with taking the degree of development of nuclear power plants of the recipient country into consideration. ''Forum on International Development of Nuclear Industry'' organized by the Japan Atomic Industrial Forum, Inc. (JAIF) proposed it would be indispensable for a Japan's nuclear industry to establish a Japan-U.S. Cooperation with the support of Government in order to develop the nuclear technology internationally. In November 2005, the investigating team including utilities and nuclear industry visited U.S. and exchanged opinions on its possibility. Investigating results and their evaluation were described. (T.Tanaka)

  17. 78 FR 66767 - Chlorinated Isocyanurates From China and Japan


    ...)] Chlorinated Isocyanurates From China and Japan Determinations On the basis of the record \\1\\ developed in the... reason of imports from China and Japan of chlorinated isocyanurates, provided for in subheadings 2933.69... (LTFV) from Japan and subsidized by the Government of China.\\2\\ \\1\\ The record is defined in sec. 207.2...

  18. 77 FR 60380 - Renewable Energy Policy Business Roundtable in Japan


    ... Roundtable in Japan AGENCY: International Trade Administration, Department of Commerce. ACTION: Notice... December 3, 2012 in Tokyo in conjunction with the U.S.-Japan Energy Policy Dialogue. The U.S. Department of... roundtable and other related events will be held in Japan the week of December 3-7, 2012. Participants must...

  19. 75 FR 67105 - Granular Polytetrafluoroethylene Resin From Italy and Japan


    ... Polytetrafluoroethylene Resin From Italy and Japan AGENCY: United States International Trade Commission. ACTION... resin from Italy and Japan. SUMMARY: The Commission hereby gives notice that it has instituted reviews... revocation of the antidumping duty orders on granular polytetrafluoroethylene resin from Italy and Japan...

  20. 75 FR 67100 - Superalloy Degassed Chromium From Japan


    ... Chromium From Japan AGENCY: United States International Trade Commission. ACTION: Institution of a five-year review concerning the antidumping duty order on superalloy degassed chromium from Japan. SUMMARY... order on superalloy degassed chromium from Japan would be likely to lead to continuation or recurrence...

  1. 77 FR 64487 - Renewable Energy Policy Business Roundtable in Japan


    ... Roundtable in Japan AGENCY: International Trade Administration, Department of Commerce. ACTION: Revised... conjunction with the U.S.-Japan Energy Policy Dialogue. The U.S. Department of Energy--the lead U.S. agency... more about the policy and regulatory landscape for renewable energy developing in Japan at this time...

  2. Clinical statistics of gynecologic cancers in Japan

    Nagase, Satoru


    Cervical, endometrial, and ovarian cancers, have both high morbidity and mortality among the gynecologic malignant tumors in Japan. The present study was conducted using both the population-based cancer registry and the gynecologic cancer registry to elucidate the characteristics of gynecologic malignant tumors in Japan. Based on nationwide estimates from the population-based cancer registry in Japan, the morbidities and mortality of cervical, endometrial, and ovarian cancers were obtained and used for analysis. Clinicopathologic factors for cervical cancer, endometrial cancer, ovarian cancer, including age, clinical stage, postsurgical stage, histological type, therapeutic strategy, and prognosis were retrieved from the gynecologic cancer registry published by the Japan Society of Obstetrics and Gynecology and used for analysis. The morbidities of cervical, endometrial, and ovarian cancers were 10,908, 13,606, and 9,384 women in 2012, respectively. The prevalence of endometrial cancer has significantly and consistently been increasing and represents the most common gynecologic malignant tumor in Japan. The mortalities of cervical, endometrial, and ovarian cancers were 2.1, 1.3, and 3.2 per 100,000 in 2012, respectively. In 2014, 52.2% of cervical cancer patients were classified as stage I, 22.5% as stage II, 10.2% as stage III, and 11.2% as stage IV. In addition, 71.9% of endometrial cancer patients were classified as stage I, 6.0% as stage II, 13.3% as stage III, and 7.5% as stage IV. Finally, 43.2% of ovarian cancer patients were classified as stage I, 9.1% as stage II, 27.6% as stage III, and 7.2% as stage IV. Twelve-point six percent of ovarian cancer patients received neoadjuvant chemotherapy. PMID:28198168

  3. Establishment of the Japan Atomic Energy Agency

    Okazaki, Toshio


    A goal of the 21. century is for society to pursue 'sustainable economic development and prosperous life by recycling resources', thus rejecting 'development based on the waste of resources'. For Japan, which has limited energy resources, it is important to secure safe, inexpensive, environmentally friendly energy resources having long-term availability. To contribute to long-term energy security and solve global environmental issues, and to create advanced competitive science and technology, the Japan Atomic Energy Agency (JAEA) was established by integrating the Japan Atomic Energy Research Institute (JAERI) and the Japan Nuclear Cycle Development Institute (JNC) in October 2005. JAEA is endeavoring to establish nuclear fuel cycles, to contribute to social improvement through hydrogen production initiated by atomic energy, and to pursue research and development of thermonuclear fusion and quantum beam technology. This paper reviews the main R and D activities of JAEA. The structure of the paper is the following: 1. Introduction; 2. Japan Atomic Energy Agency; 3. Efforts to Commercialize the Fast Reactor Cycle; 4. Monju Progress; 5. Geological Disposal of High-Level Radioactive Waste R and D; 6. High Temperature Gas-Cooled Reactor System R and D; 7. Fusion Research and Development; 8. LWR Spent Fuel Reprocessing Technology; 9. Quantum Beam Technologies; 10. Nuclear Safety Research and Regulatory Applications; 11. Basic Science and Engineering Research; 12. Contribution to the Enhanced International Nonproliferation Regimes; 13. Conclusions. To summarize, JAEA will promote the above R and D activities, addressing the following commitments: - On problems that atomic energy faces, we shall extend technical assistance in response to the government and the industrial sectors. - We shall produce technical options to attain political goals to secure medium to long-term stable energy supplies and to solve global environmental issues. - With the high potentials of atomic

  4. Current status of SFR development in Japan

    Ieda, Yoshiaki; Chikazawa, Yoshitaka [Japan Atomic Energy Agency, Tokyo (Japan). Project Promotion Office; Kotake, Shoji [Japan Atomic Power Company, Tokyo (Japan)


    Fast Reactor development experiences and status in Japan are summarized. Even though international SFR circumstances were against in 1980s and 1990s, e.g. CRBRP, SNR-300 and Superphenix terminations, we kept on with our R and D activities steadily aiming at positive development targets in Japan. As results of our efforts, it has shown that our commercialized SFR concept, Japan Sodium-cooled Fast Reactor (JSFR) could meet the targets in the Feasibility Study on Commercialized Fast Reactor Cycle Systems (FS) and the Fast Reactor Cycle Technology Development (FaCT) project. Further, Monju has finally achieved restart in May 2010 after having been shut for almost 15 years. A future plan of Monju is to be determined based on a direction of the national nuclear and energy policies that will be established in 2012. The undergoing FaCT project is pursuing commercialization of fast reactor cycle system around 2050 under cooperation of MEXT (Ministry of Education, Culture, Sports, Science and Technology), METI (Ministry of Economy, Trade and Industry), utilities, venders and JAEA (Japan Atomic Energy Agency). As results of the FaCT Phase I, feasibility of the key technologies for JSFR has been evaluated and the project is waiting for launching the phase II due to the Tohoku large earthquake. It is considered that the nuclear development policy might be affected by the Tohoku large Earthquake/Tsunami in Japan. Nevertheless the significance of nuclear energy will not be changed and thus we will focus on the issues learnt from Fukushima accidents and reflect into the improvement of the safety of Monju and the safety design criteria for the next generation Fast Reactor systems. (orig.)

  5. A Hybrid Tsunami Risk Model for Japan

    Haseemkunju, A. V.; Smith, D. F.; Khater, M.; Khemici, O.; Betov, B.; Scott, J.


    Around the margins of the Pacific Ocean, denser oceanic plates slipping under continental plates cause subduction earthquakes generating large tsunami waves. The subducting Pacific and Philippine Sea plates create damaging interplate earthquakes followed by huge tsunami waves. It was a rupture of the Japan Trench subduction zone (JTSZ) and the resultant M9.0 Tohoku-Oki earthquake that caused the unprecedented tsunami along the Pacific coast of Japan on March 11, 2011. EQECAT's Japan Earthquake model is a fully probabilistic model which includes a seismo-tectonic model describing the geometries, magnitudes, and frequencies of all potential earthquake events; a ground motion model; and a tsunami model. Within the much larger set of all modeled earthquake events, fault rupture parameters for about 24000 stochastic and 25 historical tsunamigenic earthquake events are defined to simulate tsunami footprints using the numerical tsunami model COMCOT. A hybrid approach using COMCOT simulated tsunami waves is used to generate inundation footprints, including the impact of tides and flood defenses. Modeled tsunami waves of major historical events are validated against observed data. Modeled tsunami flood depths on 30 m grids together with tsunami vulnerability and financial models are then used to estimate insured loss in Japan from the 2011 tsunami. The primary direct report of damage from the 2011 tsunami is in terms of the number of buildings damaged by municipality in the tsunami affected area. Modeled loss in Japan from the 2011 tsunami is proportional to the number of buildings damaged. A 1000-year return period map of tsunami waves shows high hazard along the west coast of southern Honshu, on the Pacific coast of Shikoku, and on the east coast of Kyushu, primarily associated with major earthquake events on the Nankai Trough subduction zone (NTSZ). The highest tsunami hazard of more than 20m is seen on the Sanriku coast in northern Honshu, associated with the JTSZ.

  6. Current status of SFR development in Japan

    Ieda, Yoshiaki; Chikazawa, Yoshitaka


    Fast Reactor development experiences and status in Japan are summarized. Even though international SFR circumstances were against in 1980s and 1990s, e.g. CRBRP, SNR-300 and Superphenix terminations, we kept on with our R and D activities steadily aiming at positive development targets in Japan. As results of our efforts, it has shown that our commercialized SFR concept, Japan Sodium-cooled Fast Reactor (JSFR) could meet the targets in the Feasibility Study on Commercialized Fast Reactor Cycle Systems (FS) and the Fast Reactor Cycle Technology Development (FaCT) project. Further, Monju has finally achieved restart in May 2010 after having been shut for almost 15 years. A future plan of Monju is to be determined based on a direction of the national nuclear and energy policies that will be established in 2012. The undergoing FaCT project is pursuing commercialization of fast reactor cycle system around 2050 under cooperation of MEXT (Ministry of Education, Culture, Sports, Science and Technology), METI (Ministry of Economy, Trade and Industry), utilities, venders and JAEA (Japan Atomic Energy Agency). As results of the FaCT Phase I, feasibility of the key technologies for JSFR has been evaluated and the project is waiting for launching the phase II due to the Tohoku large earthquake. It is considered that the nuclear development policy might be affected by the Tohoku large Earthquake/Tsunami in Japan. Nevertheless the significance of nuclear energy will not be changed and thus we will focus on the issues learnt from Fukushima accidents and reflect into the improvement of the safety of Monju and the safety design criteria for the next generation Fast Reactor systems. (orig.)

  7. What is nuclear power in Japan?

    Suzuki, Toshikazu


    The aggressive use of such non-fossil energy as the atomic energy with high power density and energy production efficiency is an indispensable choice aiming at the low-carbon society. There is a trial calculation that the carbon dioxide emission of 40000 ton can be suppressed by nuclear power generation by one ton of uranium. The basis of nuclear research after the Second World War in Japan was established by the researchers learnt in Argonne National Laboratory. In 2010, NPPs under operation are 54 units and the total electric generating power is 48.85GW. The amount of nuclear power generation per person of the people is 0.38kW in Japan, and it is near 0.34kW of the United States. However, the TMI accident and the Chernobyl disaster should have greatly stagnated the nuclear industry of Japan although it is not more serious than the United States. A lot of Japanese unconsciously associate a nuclear accident with the atomic bomb. According to the investigation which Science and Technology Agency carried out to the specialist in 1999, ``What will be the field where talent should be emphatically sent in the future?'' the rank of nuclear technology was the lowest in 32 fields. The influence of the nuclear industry stagnation was remarkable in the education. The subject related to the atomic energy of a university existed 19 in 1985 that was the previous year of the Chernobyl disaster decreased to 7 in 2003. In such a situation, we have to rely on the atomic energy because Japan depends for 96% of energy resources on import. The development of the fuel reprocessing and the fast breeder reactor has been continued in spite of a heavy failure. That is the only means left behind for Japan to be released from both fossil fuel and carbon dioxide.

  8. Proceedings of the Japan-USA Collaborative Workshops on the History of Particle Theory in Japan, 1935-1960

    Kawabe, Rokuo; Konuma, Michiji; Elementary particle theory in Japan, 1935-1960 : Japan-USA collaboration, second phase


    This volume consists mainly of papers presented at five "workshop", each of two or three days duration, held at various locations in Japan and the United States during 1984-5 by a USA-Japan collaboration for the study of the history of particle physics in Japan, together with some of the discussions and additional interviews.

  9. An overview of work, retirement, and pensions in Japan.

    Bass, S A


    Work to retirement in Japan is a sequential transition for the most part, and Japan permits mandatory retirement by firms at age 60. But many older people work beyond the age of 60, many more than in other industrialized countries. A number of hypotheses are examined, having to do with pensions, health, opportunity, interest in working, cultural attitudes (including the concept of ikigai), and public policy initiatives (such as employment policy and the Silver Human Resource Centers). Japan's cultural attitudes and existing policies appear to have set Japan on a unique course in considering the aging of its population. To what extent should other nations emulate Japan?

  10. The Early Overseas Activities of IBM in Japan

    吉沢, 正広; 田中, 雅章; Masahiro, YOSHIZAWA; Masaaki, TANAKA; 愛知学院大学; 鈴鹿短期大学; / SUZUKA JUNIOR COLLEGE


    The purpose of this paper is to examine how IBM entered into prewar Japan and ran its wholly-owned subsidiary thereafter. Before examining something noted above, this paper surveys the process of formation of IBM and then traces its early overseas activities. Turning to the initial contacts between Japan and IBM, at first IBM carried out its mere export trade to Japan through Morimura and then Kurosawa. IBM then established its wholly-owned subsidiary, Japan Watson,in Japan to expand the busi...

  11. Transport of MOX fuel from Europe to Japan


    The MOX fuel transports from Europe to Japan represent a main part in the implementing of the Japan nuclear program. They complement the 160 transports of spent fuels realized from Japan to Europe and the vitrified residues return from France to Japan. In this framework the document presents the MOX fuel, the use of the MOX fuel in reactor, the proliferation risks, the MOX fuel transport to Japan, the public health, the transport regulations, the safety and the civil liability. (A.L.B.)

  12. JTEC panel on display technologies in Japan

    Tannas, Lawrence E., Jr.; Glenn, William E.; Credelle, Thomas; Doane, J. William; Firester, Arthur H.; Thompson, Malcolm


    This report is one in a series of reports that describes research and development efforts in Japan in the area of display technologies. The following are included in this report: flat panel displays (technical findings, liquid crystal display development and production, large flat panel displays (FPD's), electroluminescent displays and plasma panels, infrastructure in Japan's FPD industry, market and projected sales, and new a-Si active matrix liquid crystal display (AMLCD) factory); materials for flat panel displays (liquid crystal materials, and light-emissive display materials); manufacturing and infrastructure of active matrix liquid crystal displays (manufacturing logistics and equipment); passive matrix liquid crystal displays (LCD basics, twisted nematics LCD's, supertwisted nematic LCD's, ferroelectric LCD's, and a comparison of passive matrix LCD technology); active matrix technology (basic active matrix technology, investment environment, amorphous silicon, polysilicon, and commercial products and prototypes); and projection displays (comparison of Japanese and U.S. display research, and technical evaluation of work).

  13. Applications of shape memory alloys in Japan

    Asai, M.; Suzuki, Y.


    In Japan, a first application of shape memory TiNi alloy was a moving flap in an air-conditioner which was developed as sensing function of shape memory alloy at Matsushista Electric Industrial Co. Then, shape memory utilized in a coffee maker, an electric rice-cooker, a thermal mixing valve and etc. were commercialized in Japan. And brassiere wires, a guide wire for medical treatment, an antenna for portable telephone and others were commercialized utilizing superelasticity. At the same time with these commercial products, there was not only progress in fabrication technology to effect accurate transformation temperature, but also the discovery of small hysteresis alloy such as R-phase or TiNiCu alloy and low transformation temperature alloy such as TiNiFe, TiNiV and TiNiCo alloys. Therefore the shape memory alloy market has expanded widely to electric appliances, automobile, residence, medical care and other field today. (orig.)

  14. Nuclear power in Japan in 1987

    Molodtsov, S.D.


    Data on the development level of nuclear power in Japan as of 1988 beginning are presented. Total registed electric power of 36 nuclear power units under operation constituted 28046 MW. 13 power units with 12268 MW total power are under construction. In 1987 188.4 TWH electric power was generated at the Japanese NPPs, it constituted 31.7% of total electric power generation. About 360 bil. yens were assigned from the state budget to further development of nuclear power engineering. Efforts to create the improved BWR type reactor, as well as, scientific and research efforts on the development of fast breeder reactors, improvement of uranium enrichment and radioactive waste storage are carried out. It is expected that share of nuclear power in electric power generation in Japan will reach 40% to the beginning of the 21-th century

  15. Japan's oil market and refining sector

    Yamaguchi, N.D.


    The present economic situation in Japan is discussed. In particular, the focus is on fluctuations in oil product demand, imports of crude oil, and the refining industry. Throughout the 1990s, Japan was plagued by a volatile economy and the new millennium has shown no improvement. A prolonged recession means that the country now has little confidence in its leaders and its institutions, consumer confidence is low and asset values have deflated. Due to a low birth rate and long life expectancy, the population is aging and this means lower savings rates. The contrast between the present situation and the so-called economic miracle once enjoyed by the Japanese is hard to accept, but despite all this, the Japanese lifestyle and economy are to be envied

  16. Progress of metallic superconductors in Japan

    Tachikawa, Kyoji, E-mail: [Faculty of Engineering, Tokai University, 4-1-1, Kitakaname, Hiratsuka, Kanagawa 259-1292 (Japan)


    Highlights: ► Japanese contributions on the R and D of different metallic superconductors are summarized. ► Nb–Ti wires have been developed for MRI, accelerator, MAGLEV train and other applications. ► Multifilamentary Nb{sub 3}Sn wires with excellent performance have been developed for high-field use. ► Long-length Nb{sub 3}Al wires with promising strain tolerance have been fabricated by a new process. -- Abstract: This article overviews the development of metallic superconductors in Japan covering different kinds of alloys and intermetallic compounds. Metallic superconductors have opened many new application areas in science and technology. Japan has been one of the leading countries in the world, both in the research and development and in large-scale manufacturing of metallic superconductors.

  17. Water pollution control technology in Japan



    This work is a compilation by members of the Committee for Studying Transfer of Environmental Technology on the expertise and technology developed by the members for controlling water pollution in Japan, together with consideration of issues concerning the transfer of environmental technologies to developing countries. The committee is composed of representatives for the Environment Agency, Japan, Osaka Prefectural Government, Osaka Municipal Government, and 25 companies such as manufacturers of environmental equipment. The document contains a total of 93 short papers grouped into sections on: industrial wastewater treatment; sewage treatment; right soil treatment; sludge treatment; and miscellaneous. One paper by the Kausai Electric Power Co., Inc., discusses waste water treatment systems in oil-fired thermal power plants; another describes an internally circulating fluidized bed boiler for cocombusting coal with industrial wastes.

  18. Marriage and labor market discrimination in Japan.

    Anderson, K H; Hill, M A


    "Many Japanese firms have engaged in the practice of compulsory retirement upon a female employee's marriage. In 1966, this practice was ruled as being contrary to provisions in Japan's Civil Code. [The authors] have specified and estimated a model of the economic determinants of age at marriage in order to analyze the effect that this discrimination has had on nuptiality in Japan. [The] results indicate that on average, after accounting for an upward trend, women who married after the 1966 court decision married about one year younger than women who married before 1966." It is also found that age at marriage is influenced by several socioeconomic variables, including wife's wage and educational level, husband's income and educational level, and wife's family background. Data are from a 1975 survey of women aged 20-59 who were living in the Tokyo metropolitan area. excerpt

  19. Status reports of supercomputing astrophysics in Japan

    Nakamura, Takashi; Nagasawa, Mikio


    The Workshop on Supercomputing Astrophysics was held at National Laboratory for High Energy Physics (KEK, Tsukuba) from August 31 to September 2, 1989. More than 40 participants of physicists, astronomers were attendant and discussed many topics in the informal atmosphere. The main purpose of this workshop was focused on the theoretical activities in computational astrophysics in Japan. It was also aimed to promote effective collaboration between the numerical experimentists working on supercomputing technique. The various subjects of the presented papers of hydrodynamics, plasma physics, gravitating systems, radiative transfer and general relativity are all stimulating. In fact, these numerical calculations become possible now in Japan owing to the power of Japanese supercomputer such as HITAC S820, Fujitsu VP400E and NEC SX-2. (J.P.N.)

  20. Promotion of food irradiation in Japan

    Kondo, Shunsuke; Tanaka, Shunichi; Tada, Mikitaro; Furuta, Masakazu; Kume, Tamikazu; Hayashi, Toru; Yamamoto, Kazuko


    Atomic Energy Commission of Japan has organized special symposia inviting citizens and consumers on food irradiation based on the report presented by expert members meeting discussing about food irradiation in various countries as well as in Japan. This document summarizes the lectures and talks presented at the symposia: usefulness of food irradiation, one of the most effective means of sterilization to ensure sanitary supplies and to prevent loss from spoilage, activities of the subcommittee consisting of experts of this field, a report of the open forum with public participants on food irradiation, present status of detection techniques for the irradiated foods, the role of phyto-sanitary measures in plant protection, and how to realize the consumer's free choices for irradiated foods. (S. Ohno)

  1. Substitute energy resource policy in Japan

    Umehara, Katsuhiko


    Japan depends 88% of energy resources and 99.8% of petroleum on imports. The solution of energy problems is now made internationally. As the means for Japan, there are the substitution of other resources for petroleum and its promotion. However, this involves the considerable funds for the development and utilization, which must be borne by the people in the form of tax. For governmental financing, a special account must be set up for the particular purpose. In the research and development of new energy resources, new institution is required. The following matters are described: petroleum shortage coming even in 1980s, the international need of substitute energy development, the need for establishing measures for substitute energy resources, acquisition of the funds, special-account governmental financing, and an institute of new energy development. (author)

  2. Beyond EFL : Globalizing Education in Japan

    Smith, Michael


    Current approaches to education are not providing students in Japan with the skills necessary to become global human resources. How can skills such as effective communication, problem solving, cultural awareness, and leadership, all necessary in a rapidly globalizing world, be developed and nurtured in Japan’s schools? National public education must begin to play a more prominent role in the development of these important global skills. This paper will describe first year university students’...

  3. Nuclear power in Japan and the USA

    Titterton, E.


    The development of the nuclear power industry in Japan and the USA is discussed. The author lists the number of nuclear power plants operating, under construction and planned and considers the contribution made by nuclear power stations to the total electricity generated. The advantages of nuclear power to both countries are outlined and forecasts are made of the role to be played by nuclear power in future years

  4. History of nuclear technology development in Japan

    Yamashita, Kiyonobu


    Nuclear technology development in Japan has been carried out based on the Atomic Energy Basic Act brought into effect in 1955. The nuclear technology development is limited to peaceful purposes and made in a principle to assure their safety. Now, the technologies for research reactors radiation application and nuclear power plants are delivered to developing countries. First of all, safety measures of nuclear power plants (NPPs) will be enhanced based on lesson learned from TEPCO Fukushima Daiichi NPS accident.

  5. History of nuclear technology development in Japan

    Yamashita, Kiyonobu, E-mail: [Visiting Professor, at the Faculty of Petroleum and Renewable Energy Engineering, University Teknologi Malaysia Johor Bahru 81310 (Malaysia); General Advisor Nuclear HRD Centre, Japan Atomic Energy Agency, TOKAI-mura, NAKA-gun, IBARAKI-ken, 319-1195 (Japan)


    Nuclear technology development in Japan has been carried out based on the Atomic Energy Basic Act brought into effect in 1955. The nuclear technology development is limited to peaceful purposes and made in a principle to assure their safety. Now, the technologies for research reactors radiation application and nuclear power plants are delivered to developing countries. First of all, safety measures of nuclear power plants (NPPs) will be enhanced based on lesson learned from TEPCO Fukushima Daiichi NPS accident.

  6. Current status of VHTR development in Japan

    Aochi, A.; Kondo, T.


    The status of the program at the beginning of fiscal 1982 is reviewed. Special emphasis is placed on the altering of the output helium temperature of the experimental VHTR to 950 0 . The modification is aimed at establishing the technical basis for post-experimental VHTR output helium temperature of 1000 0 C. Notes are given on the design of the VHTR as well as various research and development efforts in Japan on multi-purpose nuclear heat applications and HTGR technology

  7. The Programs of Japan in the Philippines


    functions of theI U cii’?rsi:rity in tho follo,:ing way: : ’"The purposo an’d - fanc - tion of th Unive-rsiy o.f ti.e Phil) ippines shall be to provide .. ;i :if Japan co to the P’hilippines very soon tor a, series of genes wv-h.:i t - local- players. The ( loa.ding) teoia is (T" ..:yo. Six - .3

  8. Globalization and Women's Labour Activism in Japan

    BISHOP, Beverley


    The concept of globalization not only encompasses increased economic integration and increased flows of capital, but also social, political and cultural change. While considerable attention has been paid to the pro-active role that Japanese government and business actors have played, there has been rather less analysis of the way civil actors in Japan have been affected by, and have adapted their goals and strategies to the changing global polity. This paper examines how female labour activis...

  9. The Evolving Relations of Japan and India


    relations, domestic factors have the same potential. A variety of issues, some of which have no direct bearing on international relations, can and 220 Ibid.; Ankit Panda , “Vietnam to Acquire Japanese Maritime Surveillance Ships,” The Diplomat...Occasion of Official Visit.” 222 Ankit Panda , “India Will Buy 15 Amphibious Aircraft From Japan: So What?,” The Diplomat, January 29, 2014, http

  10. Core Indicators of Japan's Consumer Price Index

    Shigenori Shiratsuka


    The primary objective of the Bank of Japan (BOJ) in conducting monetary policy is to promote sustainable growth by achieving price stability. The price stability that needs to be achieved is regarded as not just short-term and temporary, but sustainable in the medium to long term, which is the common understanding among major central banks. To fulfill this mandate, the BOJ is required to identify the underlying trend of inflation by excluding various idiosyncratic disturbances from measured p...

  11. [Beginning Knowledge of Transfusion in Japan].

    Mazda, Toshio; Shimizu, Masaru


    Blood components and plasma derivatives are two of the most useful tools in modern medicine. When the Portuguese opened the maritime routes to the Far East in the 16th century. Western medicine traveled to Japan on the trading vessels that carried physicians and barber-surgeons to care for the body and Christian missionaries to care for the soul. Skilled interpreters such as Kōgyū Yoshio translated and studied Dutch editions of early medical books, like Lorenz Heister's "Chirurgie" (Nürnberg, 1719), that illustrate the concept of transfusion. The oldest description of transfusion originating in Japan is a handwritten manuscript entitled "Bansui Sensi Chojutsu Shomoku" by Masamichi Nishijima, a student of Bansui Otsuki. It is a list of Otsuki's translated works. He described book names and chapter names in the manuscript, and when he finished translation of a chapter, he marked a circle on the chapter name. The transfusion chapter had a circle. That dates the earliest writing on transfusion in Japanese to 1804, shortly after the death of Kōgyū. Unfortunately, the manuscript translation no longer exists. In 1814, Shunzō Yoshio, grandson of Kōgyū, and in 1820, Tokki Koshimura, translated the figure legends of "Chirurgie." Soon afterwards, after the first report of transfusion from human-to-human by James Blundell in London in 1818, Western medical books published on the subject began to arrive. The works of Christoph Wilhelm Hufeland, Georg Friedrich Most and Carl Canstatt all mentioning transfusion, albeit without details, were translated by Kōan Ogata and Shinryō Tsuboi. During the Edo period, Japan was a closed country; only open to the Dutch through a tiny island in Nagasaki. But Japanese doctors in the Edo period learned about blood transfusion through Dutch-translated versions of Western medical Books. Transfusion began being practiced in Japan in 1919, almost exactly 100 years after the concept was introduced

  12. Energy R and D in Japan; TOPICAL

    J.J. Dooley


    In 1997, the public and private sectors in Japan invested$90.3 billion in R and D. Japan is the second largest supporter of R and D after the United States. A very large percentage (79.4%) of all R and D in Japan is supported by the private sector. The prolonged economic recession that has plagued the Japanese economy for most of the 1990s has significantly reduced the scale of the Japanese R and D effort compared to what it would have been had the economy been more robust. The Japanese government has recently attempted to bring the economy out of this recession through the use of economic stimulus packages. These stimulus packages have contained significant new funding for R and D, although it is apparent that much of the funding is going to R and D programs and R and D construction projects with very near tern payoff and not to the support of longer term R and D. In 1998, the Japanese government devoted 13.7% of all public R and D funds to the support of energy R and D. The priority accorded to energy R and D in Japan is significantly higher than in any other industrialized nation. The Japanese energy R and D program, which was funded at$2.5 billion in 1997, is overwhelmingly focused on nuclear energy R and D. Nuclear energy R and D (fission and fusion) accounts for 75% of the total national energy R and D budget. The fission energy R and D effort has decreased nearly 24% since 1996 as the government attempts to refocus this program in the face of growing public opposition to the Japanese government's efforts to expand the nuclear power program. Energy efficiency R and D (8% of the total national energy R and D budget) and renewable energy R and D receive relatively modest support from the Japanese government

  13. Japan’s Emerging World Role.


    refusal of Japanese fishermen to let Japan’s first nuclear ship , the Mutsu , return to port after it suffered reactor problems on its maiden voyage...producing nuclear ships . The f Japanese Navy is highly trained and, with a one-to-four ratio between officers and enlisted men, is capable of very rapid...1946/3-RR 4 broad rearmament program, especially one including the development of nuclear weapons. Current Japanese economic relations with the PRC and

  14. High-speed railways in Japan

    Kyotani, Y.


    This paper reviews the development of conventional railways in Japan, leading up to the Shinkansen line, which at present runs at speeds up to 210km/h, and will in the future be speeded up to 260km/h. It then goes on to review the development of a superconductive, magnetically levitated train, which will constitute the next generation of railways, running at speeds of up to 500km/h. (author)

  15. Education of nuclear engineering in Japan

    Ozawa, Yasutomo; Yamamuro, Nobuhiro


    The research Committee of Nuclear Engineering Education has two working groups. One group has carried out surveyes on the curriculums of nuclear engineering course of universities in Japan and the activities of graduates in the industrial worlds. The other group conducted an investigation on the present status of energy education in senior high schools. This is an interim report on the activity of the research committee. (author)

  16. History of nuclear technology development in Japan

    Yamashita, Kiyonobu


    Nuclear technology development in Japan has been carried out based on the Atomic Energy Basic Act brought into effect in 1955. The nuclear technology development is limited to peaceful purposes and made in a principle to assure their safety. Now, the technologies for research reactors radiation application and nuclear power plants are delivered to developing countries. First of all, safety measures of nuclear power plants (NPPs) will be enhanced based on lesson learned from TEPCO Fukushima Daiichi NPS accident

  17. Prospect of heavy ion studies in Japan

    Sakai, M.


    The status and future developments of heavy ion facilities in Japan are presented. New tandem, linear accelerator and Mumatron for studies of nuclear matter are under construction. Mumatron which provides 500 MeV/nucleon with rather small intensity consists of four parts, namely, Wideroe-type linear accelerator, Alvarez-type linear accelerator, Cockcroft-Walton accelerator and synchrotron. Mumatron is expected not only to open an entirely new field of nuclear physics but for application to the cancer therapy

  18. Japan's prospects in the Shanghai cooperation organization

    Nurgaliev, Marat


    At the present stage, the Shanghai Cooperation Organization (SCO) is arousing great interest in the international community. The leading actors in international relations, such as the U.S., Japan, and the European countries, are keeping a careful watch over the organization's development. The interest of these countries is mainly related to the lack of information about the SCO's actual activity and the organization's real essence. The leaders of the SCO member states constantly assure everyo...

  19. Development of emission computed tomography in Japan

    Tanaka, E.


    Two positron emission computed tomography (PCT) devices developed in Japan are described. One is for head and the other for wholebody. The devices show fairly quantitative images with slight modifications of the existing algorithms because they were developed based on filtered back-projection. The PCT device seems to be better than the single photon emission computed tomography (SPECT) since it provides adequade compensation for photon attenuation in patients. (M.A.C.) [pt

  20. Mercury emission from crematories in Japan

    M. Takaoka


    Full Text Available Anthropogenic sources of mercury emissions have a significant impact on global pollution. Therefore, finding uncharacterised sources and assessing the emissions from these sources are important. However, limited data are available worldwide on mercury emissions from crematories. In Japan, 99.9% of dead bodies are cremated, which is the highest percentage in the world, and more than 1600 crematories are in operation. We thus focused on emissions from crematories in Japan. The number of targeted facilities was seven, and we used continuous emission monitoring to measure the mercury concentrations and investigate mercury behaviour. The total mercury concentrations in stack gases were a few μg/Nm3 (normal cubic meters. Considering the time profile of mercury and its species in cremations, the findings confirmed that the mercury in stack gas originated from dental amalgam. The amount of mercury emissions was calculated using the total concentration and gas flow rate. Furthermore, the annual amount of mercury emission from crematories in Japan was estimated by using the total number of corpses. The emission amount was considerably lower than that estimated in the United Kingdom. From statistical analyses on population demographics and measurements, future total emissions from crematories were also predicted. As a result, the amount of mercury emitted by crematories will likely increase by 2.6-fold from 2007 to 2037.

  1. Theorizing School Bullying: Insights from Japan

    Shoko Yoneyama


    Full Text Available This paper identifies a lacuna in the existing paradigms of bullying: a gap caused by the frame of reference being largely limited to the highly industrialized societies of the 'west': Europe, North America and Oceania. The paper attempts to address this gap by presenting research developed in Japan. In Japan, sociological discourse on school bullying, i.e. the analysis of institutional factors relevant to understanding bullying was established relatively early, as was the epistemology now referred to as the second paradigm of bullying. The paper attempts to integrate the research strengths of Japan with this new trend in bullying research, with the view of incorporating 'non-western' research traditions into mainstream discourse on bullying. It introduces a typology of school bullying: Types I and II, and discusses 1 hierarchical relationships in schools, focusing on corporal punishment and teacher-student bullying, and 2 group dynamics surrounding bullying. The paper illustrates how bullying among students is entwined with various aspects of schools as social institutions. It argues that school bullying may represent a state of anomie in both formal and informal power structures in schools, which have become dysfunctional communities unable to deal with bullying, while at the same time it can be students' way of compensating their sense of alienation and disconnectedness from school.

  2. [Establishment of anatomical terminology in Japan].

    Shimada, Kazuyuki


    The history of anatomical terminology in Japan began with the publication of Waran Naikei Ihan-teimŏ in 1805 and Chŏtei Kaitai Shinsho in 1826. Although the establishment of Japanese anatomical terminology became necessary during the Meiji era when many western anatomy books imported into Janan were translated, such terminology was not unified during this period and varied among translators. In 1871, Tsukumo Ono's Kaibŏgaku Gosen was published by the Ministry of Education. Although this book is considered to be the first anatomical glossary terms in Japan, its contents were incomplete. Overseas, the German Anatomical Society established a unified anatomical terminology in 1895 called the Basle Nomina Anatomica (B.N.A.). Based on this development, Kaibŏgaku Meishŭ which follows the BNA, by Buntarŏ Suzuki was published in 1905. With the subsequent establishment in 1935 of Jena Nomina Anatomica (J.N.A.), the unification of anatomical terminology was also accelerated in Japan, leading to the further development of terminology.

  3. Results of operation of BWRs in Japan

    Fueki, Kensuke


    It is considered that the development of BWR plants in Japan has been advanced relatively smoothly though sometimes there were complications. As of the end of fiscal year 1986, the BWR plants in operation were 16, and the total power output amounted to 12,917 MW, which was equivalent to 8 % of 153 GW of the total power source facilities in Japan. Reflecting the excellent operational result of BWR plants, the generated electric power in fiscal year 1986 reached 85.9 TWh and about 15 % of the total, exceeding hydroelectric power. This means that about 18 million tons of petroleum import was reduced. At the initial stage, BWR plants suffered the stress corrosion cracking of stainless steel pipings in the reactor primary system. This trouble was successfully solved by the efforts of the government, electric power companies, plant manufacturers and research institutes. In fiscal year 1983, the capacity factor of all BWR plants in Japan recovered to more than 70 %, and in fiscal year 1986, it has reached 75.9 %. In order to improve the capacity factor further, it is necessary to prevent troubles by the development of diagnostic techniques and preventive maintenance, and to shorten regular inspection period. The change of accidents and troubles, the measures to reduce regular inspection period, the reduction of radiation exposure, and the reduction of wastes are reported. (Kako, I.)

  4. English education for healthcare professionals in Japan.

    Moross, Janelle; Seki, Naoko; Morio, Ikuko


    In a global environment, education for healthcare professionals should include cultivating human resources who have the necessary skills to work in an international arena. This article will review the current status of English education for dental healthcare professionals in Japan. After conducting a literature search using the keywords: English education, Japan, and dental, only a few studies were found that investigated and proposed suggestions for dental professional English education. Even so, these were still in the early stages with outcomes yet to be fully evaluated. Even though English is thought indispensable for global professionals, and that increasing chances for communication skills is necessary, little attention has been addressed to English education for dental professionals or the implementation of such education in the Japanese undergraduate dental curricula. With the current reality of field expansion in dentistry, the need for not only improved English communication skills for Japanese dentists, but also the acquisition of essential expertise, psychomotor, teambuilding, critical thinking, and creative thinking skills in English as well as Japanese, is a definite probability. In order to reach this level of knowledge, further efforts and research would be necessary for the advancement and development of dental professional English education in Japan.

  5. Surrogacy: donor conception regulation in Japan.

    Semba, Yukari; Chang, Chiungfang; Hong, Hyunsoo; Kamisato, Ayako; Kokado, Minori; Muto, Kaori


    As of 2008, surrogacy is legal and openly practised in various places; Japan, however, has no regulations or laws regarding surrogacy. This paper reports the situation of surrogacy in Japan and in five other regions (the USA, the UK, Taiwan, Korea and France) to clarify the pros and cons of prohibiting surrogacy, along with the problems and issues relating to surrogacy compensation. Not only in a country such as France that completely prohibits surrogacy within the country, but also in a country such as the UK that allows non-commercial surrogacy, infertile couples travel overseas for the purpose of surrogacy. In addition, some couples might seek underground surrogacy if the government prohibits surrogacy. If an intended parent couple and a surrogate make an agreement among themselves and then a problem occurs, they cannot ask for support from professionals or bring a case to court, as can be observed in South Korea and Taiwan. We also conclude that there is little difference between commercial surrogacy and non-commercial surrogacy in the absence of a clear definition of 'reasonable expenses.' In the UK, the law does not allow surrogates to receive compensation. However, in reality, there may be little difference between the amounts paid to surrogates for profit in the US and those paid to surrogates for reasonable expenses in the UK. We conclude that the issue of surrogacy demands further discussion in Japan.

  6. Virtual laboratory for fusion research in Japan

    Tsuda, K.; Nagayama, Y.; Yamamoto, T.; Horiuchi, R.; Ishiguro, S.; Takami, S.


    A virtual laboratory system for nuclear fusion research in Japan has been developed using SuperSINET, which is a super high-speed network operated by National Institute of Informatics. Sixteen sites including major Japanese universities, Japan Atomic Energy Agency and National Institute for Fusion Science (NIFS) are mutually connected to SuperSINET with the speed of 1 Gbps by the end of 2006 fiscal year. Collaboration categories in this virtual laboratory are as follows: the large helical device (LHD) remote participation; the remote use of supercomputer system; and the all Japan ST (Spherical Tokamak) research program. This virtual laboratory is a closed network system, and is connected to the Internet through the NIFS firewall in order to keep higher security. Collaborators in a remote station can control their diagnostic devices at LHD and analyze the LHD data as they were at the LHD control room. Researchers in a remote station can use the supercomputer of NIFS in the same environment as NIFS. In this paper, we will describe detail of technologies and the present status of the virtual laboratory. Furthermore, the items that should be developed in the near future are also described

  7. Japan, world leader of photovoltaic energy

    Strasser, F.


    Since the beginning of the 1970's, the potentialities of photovoltaic energy has been recognized by the Japanese government which has sustained this technology in two ways. First, by the financing of R and D programs, and second, by giving subsidies to citizens for the installation of solar panels. Today, Japan is the world leader of photovoltaic energy, both for the installed power and for the production of solar cells. In 2003, the International Energy Agency was reporting 1.809 GW of worldwide installed capacity among which 48% was in Japan (0.86 GW) with respect to 0.4 GW in Germany, 0.275 GW in the USA and only 20 MW in France. This capacity would have exceeded 1.1 GW at the end of 2004. Half of the solar modules are manufactured in Japan. The ministry of economy, trade and industry (METI) has fixed ambitious goals for 2010: the overall new energy sources much represent 3% of the primary energy (with respect to 1% today) and the installed capacity must reach 4.8 GW. The road-map of the New Energy and Industrial Technology Development Organisation (NEDO) foresees 100 GW by 2030. (J.S.)

  8. FBR/VHTR deployment scenarios in Japan

    Richards, Matt; Kunitomi, Kazuhiko


    Co-deployment of Fast Breeder Reactors (FBRs) and Very High Temperature Reactors (VHTRs) can be used as the nuclear technologies to meet a significant portion of Japan's future energy demands. The FBR provides the fissile fuel for energy security and sustainability, and can be used to provide a significant portion of the electricity demand. The VHTR can provide flexible energy outputs (electricity, hydrogen, and high-temperature heat) with high efficiency, can operate with a wide variety of fuel cycles, and can be sited at locations that have limited availability of cooling water. These features, combined with its passive safety and high degree of proliferation resistance, make the VHTR an ideal complement for co-deployment with the FBR in Japan and also a very low-risk technology of export to foreign countries. In addition to hydrogen production, the high-temperature thermal energy produced by the VHTR fleet can be used for a wide variety of process-heat applications, and the VHTR can play a key role for significantly reducing greenhouse-gas emissions. This paper describes assessments for deploying FBRs and VHTRs in Japan using a closed fuel cycle, with the FBRs supplying the fissile material to sustain the combined FBR/VHTR fleet. (author)

  9. [WHO Healthy City Initiative in Japan].

    Yoshizawa, Kazuko


    City environmental conditions are associated with health outcomes in people living there. World Health Organization (WHO) initiated Healthy City in 1986. To promote the networking, Alliance for Healthy Cities (AFHC) was launched in 2003 with local offices including AFHC Japan. As of 2010, 26 cities are members of AFHC Japan. A questionnaire was sent to those member cities. It includes questions on why they became an AFHC member, which section is in charge of the initiatives, what factors are important for promotion, and others. Out of the 26 cities, 13 cities returned the completed questionnaire. As for factors important for promoting the initiatives, 10 (77%) out of the 13 cities answered "consciousness of residents", while five (38%) chose "budget". This result suggests that community participation is a more important factor than budget for promoting and succeeding in the initiatives. Aging is a problem in any of the member cities, and six cities out the 13 falls under the category of superaged society, which is defined as a society with the proportion of aged people cities (85%) agreed that bicycles are an alternative means of transportation to cars; however, infrastructure for ensuring safety needs further improvement. In the promotion of Healthy City, networking among the member cities in Japan and worldwide should be promoted. Community participation with empowerment from the planning stage should lead to sustainable initiatives. The function of AFHC in collaboration among the members should be strengthened to cope with the rapidly changing city environment.

  10. Changing epidemiology of Helicobacter pylori in Japan.

    Inoue, Manami


    Helicobacter pylori (H. Pylori) is known as the most important cause of gastric cancer. The prevalence of H. pylori infection varies widely by geographic area, age, and socioeconomic status. In Japan, H. pylori infection has been highly correlated with the incidence rate of gastric cancer, and a reduction in H. pylori infection is therefore crucial for decreasing the incidence of gastric cancer, especially at the population level. Infection occurs during childhood, commonly before 5 years of age. In Japan, where gastric cancer has ranked as the most common cancer by incidence and mortality for the last several decades, the prevalence of H. pylori infection has dramatically declined by birth cohort effect, mainly due to improvements in the general hygiene environment in childhood. Older generations born before around 1950 show a high prevalence of around 80-90 %, decreasing with age to reach around 10 % or less in those born around the 1990s, and less than 2 % for children born after the year 2000. This change will have generational effects on gastric cancer prevention strategies, both primary and secondary. The risk-stratified approach to gastric cancer prevention should be considered in Japan and other countries which have similarly experienced rapid economic development.

  11. Dynamic axes of informed consent in Japan.

    Specker Sullivan, Laura


    Scholarship in cross-cultural bioethics routinely frames Japanese informed consent in contrast to informed consent in North America. This contrastive analysis foregrounds cancer diagnosis disclosure and physician paternalism as unique aspects of Japanese informed consent that deviate from American practices. Drawing on in-depth interviews with 15 Japanese medical professionals obtained during fieldwork in Japan from 2013 to 15, this article complicates the informed consent discourse beyond East-West comparisons premised on Anglo-American ethical frameworks. It expands professional perspectives to include nurses, medical social workers, clinical psychologists, and ethicists and it addresses informed consent for a broad range of conditions in addition to cancer. The results suggest that division of affective labor is an under-theorized dimension of informed consent that is perceived as at odds with principled demands for universal informed consent. These practical tensions are conceptualized as cultural differences, with Japan identified in terms of omakase as practical and supportive and the United States identified in terms of jiko kettei as principled and self-determining. These results have implications for the methodology of cross-cultural bioethics as well as for theories and practices of informed consent in both Japan and the United States. I conclude that responsible cross-cultural work in bioethics must begin from the ground up, incorporating all relevant stakeholder perspectives, attitudes, and experiences. Copyright © 2016 Elsevier Ltd. All rights reserved.

  12. Status of cold fusion research in Japan

    Kitamura, Akira


    In Japan, the Condensed Matter Nuclear Science (CMNS) works have been centering around the Japan CF-Research Society (JCFRS) established in 1999. Recently, about 10 research groups were actively working in the CMNS field, and have been exchanging information mainly in the annual meetings of JCFRS in addition to the International ICCF conferences. For many years efforts have been exclusively devoted to clarification of the underlying physics of excess heat phenomenon and isotopic composition change. Recently, however, an entrepreneur group, Clean Planet Inc., has entered into the CMNS field in Japan, and joined Mizuno to form the above-mentioned group and made a presentation at the LANR/CF Colloquium, at MIT in March 2014. In their work they used glow discharge to form surface nanostructures on nickel mesh wires that are to be subjected to deuterium exposure. They claimed excess power on the order of kilowatts with a coefficient of performance of 1.9. Confirmation of their claim by third parties is highly expected

  13. Can GRACE detect winter snows in Japan?

    Heki, Kosuke


    Current spatial resolution of the GRACE (Gravity Recovery and Climate Experiment) satellites is 300-400 km, and so its hydrological applications have been limited to continents and large islands. The Japanese Islands have width slightly smaller than this spatial resolution, but are known to show large amplitude seasonal changes in surface masses due mainly to winter snow. Such loads are responsible for seasonal crustal deformation observed with GEONET, a dense array of GPS (Global Positioning System) receivers in Japan (Heki, 2001). There is also a dense network of surface meteorological sensors for, e.g. snow depths, atmospheric pressures, etc. Heki (2004) showed that combined effects of surface loads, i.e. snow (predominant), atmosphere, soil moisture, dam impoundment, can explain seasonal crustal deformation observed by GPS to a large extent. The total weight of the winter snow in the Japanese Islands in its peak season may reach ~50 Gt. This is comparable to the annual loss of mountain glaciers in the Asian high mountains (Matsuo & Heki, 2010), and is above the detection level of GRACE. In this study, I use GRACE Level-2 Release-4 data from CSR, Univ. Texas, up to 2009 November, and evaluated seasonal changes in surface loads in and around the Japanese Islands. After applying a 350 km Gaussian filter and a de-striping filter, the peak-to-peak change of the water depth becomes ~4 cm in northern Japan. The maximum value is achieved in February-March. The region of large winter load spans from Hokkaido, Japan, to northeastern Honshu, which roughly coincides with the region of deep snow in Japan. Next I compiled snow depth data from surface meteorological observations, and converted them to loads using time-dependent snow density due to compaction. By applying the same spatial filter as the GRACE data, its spatial pattern becomes similar to the GRACE results. The present study suggests that GRACE is capable of detecting seasonal mass changes in an island arc not

  14. Concentrations of ethane (C2H6) in the lower stratosphere and upper troposphere and acetylene (C2H2) in the upper troposphere deduced from Atmospheric Trace Molecule Spectroscopy/Spacelab 3 spectra

    Rinsland, C. P.; Russell, J. M., III; Zander, R.; Farmer, C. B.; Norton, R. H.


    This paper reports the results of the spectroscopic analysis of C2H6 and C2H2 absorption spectra obtained by the Atmospheric Trace Molecule Spectroscopy (ATMOS) instrument flown on the Shuttle as part of the Spacelab 3 mission. The spectra were recorded during sunset occultations occurring between 25 deg N and 31 deg N latitudes, yielding volume-mixing ratio profiles of C2H6 in the lower stratosphere and the upper troposphere, and an upper tropospheric profile of C2H2. These results compare well with previous in situ and remote sounding data obtained at similar latitudes and with model calculations. The results demonstrate the feasibility of the ATMOS instrument to sound the lower atmosphere from space.

  15. Japan-U.S. cooperation in transport of plutonium

    Takeda, Yu


    Japan's effort to utilize plutonium for peaceful purpose since 1950s was caught in a cross fire after the end of the Cold War. Maritime transport of plutonium from France to Japan in 1993, for instance, was criticized by U.S. Congress, nonproliferation specialists and environmental activists. U.S. government, however, compiled with Japan-US Nuclear Cooperation Agreement and cooperated to ship plutonium. This paper focuses on why Washington was supportive for the sealift of plutonium despite of opposition against it. By solving the puzzle, this research will contribute to studies of Japan's plutonium policy and Japan-U.S. nuclear relations. Based on newspaper articles, memoirs and official documents, this paper examines backgrounds and features of controversy surrounding the transport. The analyses show the causes of U.S. cooperation to the transport, such as Japan's efforts toward nuclear nonproliferation. (author)

  16. A review of studies on persuasion in Japan (1)

    深田, 博己; 木村, 堅一; 牧野, 幸志; 樋口, 匡貴; 原田, 耕太郎; 山浦, 一保


    The purpose of this study is to review the studies on persuasion in Japan. An examination has been made of 152 persuasion studies published in Japan-141 journal papers and 11 technical books. The present study consists of the following four parts. 1. Overview of persuasion studies in Japan: (1) quantitative characteristics of persuasion studies, (2) change in the number of persuasion studies with the times, (3) viewpoint of the review. 2. General problems of persuasion studies: (1...

  17. Japan-U.S. Relations: Issues for Congress


    fields in an area of the East China Sea that both countries claim as their territory. Hu also announced that China would lease two giant pandas to replace a recently deceased panda at a Tokyo zoo. Days later, after China was struck by a devastating earthquake, Japan immediately offered...other shipments of U.S. beef from Japan. In May 2007, the World Organization for Animal Health (OIE) announced that the United States was a “controlled

  18. Impacts of the Japan-Mexico EPA on Bilateral Trade

    ANDO Mitsuyo; URATA Shujiro


    This paper examines the impacts of the Japan-Mexico EPA on bilateral trade by using two different types of information, trade statistics and the EPA utilization rate. Using trade data, we found that Japan's exports of built-up cars, auto parts, base metals, electrical machinery, precision machinery, and ballpoint pens to Mexico increased sharply. We also found that Japan's imports of live animals and products, leather, and footwear with leather from Mexico increased significantly. These are s...

  19. Gender and the Labour Market: Comparing Austria and Japan

    Biffl, Gudrun


    Japan and Austria are among the OECD countries with an average labour force participation rate but an above average gender gap as far as employment opportunities and earnings are concerned. In Japan, women in the main working age have a fairly large margin of labour resources not employed in the market economy. In Austria in contrast, the proportion of unused labour resources of mature workers is high, and the gender gap is less pronounced than in Japan, which suggests that a different combin...

  20. Challenge to the enhancement of LWRs in Japan

    Inoue, T.


    Japan was way behind western countries in nuclear power development. This is partly because of the defeat in the second world war which bound Japan to the ban on nuclear power development. As a result, Japan was obliged to take the policy of introducing the power reactor, and its technology, from overseas advanced countries in order to promote the development of power reactors for its own country. (orig.)


    Masuda, S.


    This paper is entitled ''A QUARTER CENTURY OF NUCLEAR WASTE MANAGEMENT IN JAPAN''. Since the first statement on the strategy for radioactive waste management in Japan was made by the Atomic Energy Commission (AEC) in 1976, a quarter century has passed, in which much experience has been accumulated both in technical and social domains. This paper looks back in this 25-year history of radioactive waste management in Japan by highlighting activities related to high-level radioactive waste (HLW) disposal

  2. Present status of Japan materials testing reactor

    Hori, Naohiko; Kaminaga, Masanori; Kusunoki, Tsuyoshi; Ishihara, Masahiro; Niimi, Motoji; Komori, Yoshihiro; Suzuki, Masahide; Kawamura, Hiroshi [Japan Atomic Energy Agency, Oarai Research and Development Center, Oarai, Ibaraki (Japan)


    The Japan Materials Testing Reactor (JMTR) in Japan Atomic Energy Agency (JAEA) is a light water cooled tank type reactor with first criticality in March 1968. Owing to the connection between the JMTR and hot laboratory by a canal, easy re-irradiation tests can be conducted with safe and quick transportation of irradiated samples. The JMTR has been applied to fuel/material irradiation examinations for LWRs, HTGR, fusion reactor and RI production. However, the JMTR operation was once stopped in August 2006, and check and review on the reoperation had been conducted by internal as well as external committees. As a result of the discussion, the JMTR reoperation was determined, and refurbishment works started from the beginning of JFY 2007. The refurbishment works have finished in March 2011 taking four years from JFY 2007. Unfortunately, at the end of the JFY 2010 on March 11, the Great-Eastern-Japan-Earthquake occurred, and functional tests before the JMTR restart, such as cooling system, reactor control system and so on, were delayed by the earthquake. Moreover, a detail inspection found some damages such as slight deformation of the truss structure at the roof of the JMTR reactor building. Consequently, the restart of the JMTR will be delayed from June to next October, 2012. Now, the safety evaluation after the earthquake disaster is being carried out aiming at the restart of the JMTR. The renewed JMTR will be started from JFY 2012 and operated for a period of about 20 years until around JFY 2030. The usability improvement of the JMTR, e.g. higher reactor availability, shortening turnaround time to get irradiation results, attractive irradiation cost, business confidence, is also discussed with users as the preparations for re-operation. (author)

  3. Present status of Japan materials testing reactor

    Hori, Naohiko; Kaminaga, Masanori; Kusunoki, Tsuyoshi; Ishihara, Masahiro; Niimi, Motoji; Komori, Yoshihiro; Suzuki, Masahide; Kawamura, Hiroshi


    The Japan Materials Testing Reactor (JMTR) in Japan Atomic Energy Agency (JAEA) is a light water cooled tank type reactor with first criticality in March 1968. Owing to the connection between the JMTR and hot laboratory by a canal, easy re-irradiation tests can be conducted with safe and quick transportation of irradiated samples. The JMTR has been applied to fuel/material irradiation examinations for LWRs, HTGR, fusion reactor and RI production. However, the JMTR operation was once stopped in August 2006, and check and review on the reoperation had been conducted by internal as well as external committees. As a result of the discussion, the JMTR reoperation was determined, and refurbishment works started from the beginning of JFY 2007. The refurbishment works have finished in March 2011 taking four years from JFY 2007. Unfortunately, at the end of the JFY 2010 on March 11, the Great-Eastern-Japan-Earthquake occurred, and functional tests before the JMTR restart, such as cooling system, reactor control system and so on, were delayed by the earthquake. Moreover, a detail inspection found some damages such as slight deformation of the truss structure at the roof of the JMTR reactor building. Consequently, the restart of the JMTR will be delayed from June to next October, 2012. Now, the safety evaluation after the earthquake disaster is being carried out aiming at the restart of the JMTR. The renewed JMTR will be started from JFY 2012 and operated for a period of about 20 years until around JFY 2030. The usability improvement of the JMTR, e.g. higher reactor availability, shortening turnaround time to get irradiation results, attractive irradiation cost, business confidence, is also discussed with users as the preparations for re-operation. (author)

  4. PV in Japan - improving energy security?



    Currently, almost 80% of Japan's primary energy is imported and about 50% of this comes from politically unstable countries. The Japanese are now working hard to improve energy security in a clean and sustainable fashion. Since the wind patterns are not favourable for wind power, the emphasis is on photovoltaics (PVs), and many companies that once manufactured integrated circuits are now working on solar cells where their knowledge and experience of mass production, quality control, sales and marketing stand them in good stead. It is expected that the Japanese will be world leaders in the making and export of solar equipment, as well as one of the world's greatest users

  5. Integrated solid waste management in Japan


    The Japanese, through a combination of public policy, private market conditions, a geographic necessity, practice integrated municipal solid waste (MSW) management. The approach of MSW management in Japan is as follows: The basic concept of refuse treatment consists of recycling discharged refuse into usable resources, reusing such resources as much as possible, and then treating or disposing of the usable portion into a sanitary condition. Considering the difficulty of procuring land or seaside areas for such purpose as a refuse disposal site, it will be necessary to minimize the volume of refuse collected for treatment or disposal.

  6. The 1998 World Solar Rallye: Akita, Japan

    Shacklock, Andy; Duke, Mike; Burgess, Nigel

    In early August 1998, 81 solar/electric vehicles participated in a three day endurance race in Japan. The objective was to complete as many laps of the 31 km circuit as possible. Some of the cars used state-of-the-art motors, batteries, chassis, solar cells and tyres to produce vehicles which could travel at speeds of 70-80 km/h on about 1 kW of input power. With only 20 kg of battery, some solar cars were travelling around 450 km a day. This paper tells the story of the race and the technological developments behind the successful vehicles.

  7. Alexander Williamson and the modernisation of Japan.

    Davies, Alwyn G


    One hundred and fifty years ago, five students were smuggled out of feudal Japan and came to London to learn Western technology, governance, and economics. They were put into the care of Alexander Williamson, who was Professor of Chemistry at University College London, and when they went back they, and the students who followed them, became the founders of the modern Japanese state. This is the British side of that remarkable story. Williamson's career and chemistry are briefly reviewed, followed by an account of the students' presence in Britain, and then the commemoration of the sesquicentenary of these events.

  8. Microbiology of Bartholin's Gland Abscess in Japan

    Tanaka, Kaori; Mikamo, Hiroshige; Ninomiya, Mochiyoshi; Tamaya, Teruhiko; Izumi, Koji; Ito, Kunihiko; Yamaoka, Kazukiyo; Watanabe, Kunitomo


    This study was conducted to determine the current epidemiology concerning the causative organisms for Bartholin's gland abscess in Japan. Microbiological examination of 224 cases showed positive results in 219 cases and negative results in 5 cases. Of all of the bacterial isolates, 307 and 118 were aerobes and anaerobes, respectively. The most frequently isolated bacterium was Escherichia coli. Of the anaerobes, the most frequently isolated organism was Bacteroides species, followed by Prevotella species. The organisms related to respiratory infectious diseases, such as Streptococcus pneumoniae and Haemophilus influenzae, including resistant bacteria, were sometimes involved between 2000 and 2004. PMID:16081994

  9. High energy physics computing in Japan

    Watase, Yoshiyuki


    A brief overview of the computing provision for high energy physics in Japan is presented. Most of the computing power for high energy physics is concentrated in KEK. Here there are two large scale systems: one providing a general computing service including vector processing and the other dedicated to TRISTAN experiments. Each university group has a smaller sized mainframe or VAX system to facilitate both their local computing needs and the remote use of the KEK computers through a network. The large computer system for the TRISTAN experiments is described. An overview of a prospective future large facility is also given. (orig.)

  10. 210Pb ingestion in Akita City, Japan

    Hisamatsu, Shunichi; Takizawa, Yukio; Komura, Kazuhisa; Tada, Tetsuo.


    Ingestion of 210 Pb in Akita City, northern Japan was studied with food category samples and total diet samples by means of a low energy photon spectrometry. Results for food category samples revealed that the contribution of marine products to total 210 Pb ingestion was the largest. Mean 210 Pb ingestion of the two total diet samples was found to be 0.19 Bq d -1 , and approximately 1/3 of a previous reported value which was cited in an UNSCEAR report as an example of high 210 Pb ingestion by marine foods consumption. (author)

  11. AESJ: communicating about nuclear issues in Japan



    The AESJ (Atomic Energy Society of Japan) was founded in 1959 to promote the information of the Japanese public about nuclear energy and to develop exchanges between professionals of the sector. AESJ gathers about 7000 professionals and is organized around 8 regional groups and 10 technical sessions. AESJ has been publishing 2 journals: Journal of Nuclear Science and Technology since 1964 and ATOMOΣ since 1959. AESJ also awards several prizes for promoting communication and technical achievements in nuclear activities. AESJ takes part into numerous international events like for instance supporting conferences or organizing student exchanges between research centers or universities. (A.C.)

  12. The first decade of INIS in Japan

    Ebinuma, Yukio; Narui, Shigeko; Yokoo, Hiroshi; Komatsubara, Yasutoshi; Hino, Shuji; Shimizu, Akio; Tsuda, Nobuyoshi


    Outlined are the operational developments of the JAERI acting as the INIS national center for Japan for ten years from the beginning of the project in 1970. These include preparation of main manuals, establishment of national network, expansion of coverage, improvement of quality, computerization and microfilming for the input as well as machine retrieval on INIS. Subjects of relatively common attention of secondary information societies are also selected from the many studies and examinations published in Japanese during the period. These efforts are summarized on analysis of input processing period, promotion of keyword assignment, search properties of the data base and their evaluation. (author)

  13. Dating Petroglyphs from Fugoppe Cave, Japan

    Masaru Ogawa


    Full Text Available For over 20 years, I have tried to establish a relative date for petroglyphs in Fugoppe Cave, Japan. Unsuspected amidst debris accumulating from about 1300 years ago, the petroglyphs were rediscovered accidentally in 1950. From an analysis of petroglyphs on fallen rocks scattered randomly on the site floor, I argue that the artworks date from ca.1900 years ago. The cave itself, formed by wave action, saw its main occupation by pottery-making people from 1700–1500 years ago; although the petroglyphs on the rock walls predated their occupation, it seems unlikely that the occupants attached any meaning to them.

  14. History of controlled nuclear fusion in Japan

    Uematsu, Eisui; Nishio, Shigeko; Takeda, Tatsuoki


    A research development of nuclear fusion was divided four periods: the first period as prehistory (until about 1955), the second period as begin of research (1955 to 1969), the third as the growth period (1970 to 1985) and the forth as the large tokamak age. In this paper I explained the second period, because general physicists and young plasma and controlled nuclear fusion researcher did not know about this period. The controlled nuclear fusion research was begun by the experiment of hydrogen bomb by USA and USSR in 1952 and 1953. In Japan, on the basis of many societies, 'The Controlled Nuclear Fusion Meeting' was established as an independent system and KAKEA (Journal of Fusion Research) was published in 1958. Japan government began to make the system by the Nuclear Commission in 1957. The main research devices in 1962 were linear pinch, mirror device, toroidal pinch, helical system, plasma gun and plasma measurement. USSR showed the excellent results of tokamak device in 1968. Ookawa spoke the effect of the average minimum-B, the best report in this period, at the second IAEA meeting, 1965. JAERI constructed JFT-1 and JFT-2, the latter was the first class device in the world and made the first step of Japanese research into the world, for examples, to attain the equilibrium of divertor plasma and to control impurity. Many research centers of controlled fusion were established in many universities in Japan from 1966 to 1980. Cooperation researchs between Japan and USA, USSR and many countries has been carried out after 1978: JIFT (Joint Institute for Fusion Theory) and FPPC (Fusion Power Coordinating Committee). The important results increased in this period. After 1985, the research activities are processing and data increased very fast depend on the larger devices and system, good measurement system and development of information system. JT-60 in JAERI opened to the large tokamak period. It led controlled fusion researchs in the world the same as TFTR (US

  15. Electric-power economy of Japan

    Dobrochotov, V.I.; Wolfberg, D.B.


    This is a survey on a) development and present capacity of electricity-supply companies in Japan, b) the structural shift in the capacity of power plants which took place from 1966 until 1974, arranged according to thermal, nuclear and hydraulic power stations, c) the structural shift in the use of fossile fuels, also from 1966 until 1974, d) the major thermal and nuclear power stations and pump storage plants under construction and in operation, e) interconnected operation. The survey ends with the development study of the Japanese Government being outlined. (GG/LN) [de

  16. Review of the activities in Japan

    Otake, I.


    The fast breeder reactor development project in Japan has been in progress through.operation of the experimental fast reactor JOYO, design of the prototype fast breeder reactor MONJU and related R and D works. JOYO began operation in mid-1977, increased power from 50 MWt to 75 MWth in July 1979 and operation cycles at 75 MWth are continued at present. With respect to MONJU, which is a 300 MWe plant, progress toward construction has been made and the safety review are started by the concerned authorities. Conceptual design studies of large demonstration fast breeder reactor are also being made by PNC. It is a 1000 MWe, loop type plant

  17. First LNG deliveries from Qatar to Japan

    Legros, E.J.


    Twenty five years after the discovery of the giant North Field natural gas deposit, the Qatargas company has delivered its first LNG freight to Japan in December 1996. This paper recalls the history of the company from the discovery of the offshore North Field, its valorization and development, the LNG project with the building of the Ras Laffan harbour and its condensates processing factory and the 3 offshore production platforms. Ten methane-tanker ships will be in operation in the year 2000. Qatar's LNG exports should reach 20 to 25 Mt/year in the next ten years, when all its liquefaction factory projects will be completed. (J.S.)

  18. The development of breeder reactors in Japan

    Segawa, M.


    In the framework of a global analysis of the various available sources of energy, Japan has reserved a prominent place to the nuclear energy and, in the long-term view, to the breeder reactor which will be due for commercial deployment in 20)10. To achieve these objectives, three stages are envisaged, one of the experimental reactor Joyo (in service), one of the demonstration reactor Monju (its construction has been decided), and one of the pre-commercial reactor (due to be taken in hand at the beginning of the Nineties). Efforts will be made in parallel concerning the fuel cycle [fr

  19. Reacting plasma project at IPP Japan

    Miyahara, A.; Momota, H.; Hamada, Y.; Kawamura, K.; Akimune, H.


    Contributed papers of the seminar on burning plasma held at UCLA are collected. Paper on ''overview of reacting plasma project'' described aim and philosophy of R-Project in Japan. Paper on ''Burning plasma and requirements for design'' gave theoretical aspect of reacting plasma physics while paper on ''plasma container, heating and diagnostics'' treated experimental aspect. Tritium handling is essential for the next step experiment; therefore, paper on ''Tritium problems in burning plasma experiments'' took an important part of this seminar. As appendix, paper on ''a new type of D - ion source using Si-semiconductor'' was added because such an advanced R and D work is essential for R-Project. (author)

  20. Maintaining nuclear competence and expertise in Japan

    Fujii, Y.


    The fundamental law of atomic energy, which strictly restricts the application of atomic energy to the peaceful use, was established in 1955 in Japan. Since then, during the past five decades, great efforts were made to develop atomic energy. So far 52 units of light water reactors, 29 BWRs and 23 PWRs, have been built and in operation, 5 units are under construction and 6 units are planed to be built. Total capacity of presently operated NPPs amounts to 45.7 Gwe and the nuclear energy shares 30 % of the total electricity generation in Japan. During the past 10 years, several accidents occur in the nuclear facilities of electric power companies, and JNC ( previously PNC ). In spite of these accidents, including the accident of Kansai Electric Power Co. this year, the important role of nuclear energy to sustain the lives of people in Japan is intact. In the nuclear energy projection, the construction of NPPs continues till 2010. Thereafter reconstructions of NPPs are foreseen in the decade 2030's for the replacement of present NPPs in operation after 60 years services. Attention has been directed to the technology preservation: how competence and expertise of nuclear engineering can be maintained till the next period of replacement construction, in particular, the period between years 2010 and 2030. The present paper reviews the status of nuclear engineering programs in universities in Japan. The nuclear education programs started in graduate schools in 1957 and expanded to undergraduate schools of major national universities. Presently nine universities are providing systematic nuclear education programs in their graduate schools, although the corresponding department have been changed their names from 'nuclear' to more broaden terms of 'quantum', 'energy' and 'system' in several universities. Under the conditions of shrinking nuclear industries, how to maintain the present education system is seriously concerned matter in the universities. The present paper

  1. The U.S. Financial Crisis: Lessons From Japan

    Nanto, Dick K


    .... Overcoming the crisis in Japan s banks took a combination of capital injections, new laws and regulations, stronger oversight, a reorganization of the banking sector, moderate economic recovery...

  2. Trauma and posttraumatic stress disorder in Japan: Results from the World Mental Health Japan Survey

    Kawakami, Norito; Tsuchiya, Masao; Umeda, Maki; Koenen, Karestan C.; Kessler, Ronald C.


    The purpose of the study was to report the prevalence of trauma exposure and PTSD, conditional risk of PTSD associated with each trauma exposure in the community population in Japan. An interview survey was conducted of a random sample of adult residents in 11 communities of Japan. Among 4134 respondents (response rate, 55%), data from those who completed the part 2 interview (n = 1682) were analyzed with a weight for this subsample. Lifetime experiences of 27 trauma events and PTSD were assessed using the WHO-Composite International Diagnostic Interview version 3.0. Sixty percent of the part 2 sample reported exposure to at least one lifetime traumatic event. Lifetime and 12-month PTSD prevalences were 1.3% and 0.7%, respectively. Percentage of all months lived with PTSD in the population was predominantly accounted for by physical/sexual assaults and having a child with serious illness, and unexpected death of loved one. Ten percent of respondents reported “private events”, for which respondents did not have to describe the content, which accounted for 19% of months with PTSD. The lower prevalence of PTSD in Japan seems attributable to lower conditional risks of PTSD following these events, as well as different distributions of the events. The greater impact of events that occurred to loved ones rather than to oneself and “private events” on PTSD in Japan warrants further research of cross-cultural assessment of trauma exposure and cultural heterogeneity in the trauma-PTSD relationship. PMID:24572682

  3. Research; BOSS Study Trip Japan '09 : Architecture, Urbanism, Real Estate & Housing and Technology in Japan

    Feenstra, R.; Van Beelen, C.; Wamelink, J.W.F.; Geraedts, R.P.


    Japan is a land of many faces as we discovered: from seasonal changes, and thereby heavy rainfall, high humidity, tropical cyclones; to a stunning 127,300,000 inhabitants; or what about the only 10% buildable surface of the continent; seismic activity; fast going technological developments like

  4. Advances in food composition tables in Japan-Standard Tables Of Food Composition in Japan - 2015 - (Seventh Revised Edition).

    Watanabe, Tomoko; Kawai, Ryoko


    The latest version of the Standard Tables of Food Composition in Japan-2015- comprises the main food composition table (Standard Tables of Food Composition in Japan-2015-[Seventh revised Edition)) and three supplementary books. The supplementary books are Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Amino Acids -, Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Fatty Acids - and Standard Tables of Food Composition in Japan - 2015 - (Seventh Revised Edition) - Available Carbohydrates, Polyols and Organic Acids-. We believe understanding these food composition tables can give greater insight into Japan's gastronomic culture and changes in eating habits. We expect them to play important roles as part of the East Asia food composition tables. Copyright © 2017. Published by Elsevier Ltd.

  5. Development of safety performance indicators in Japan

    Ohashi, H.; Tamao, S.; Tanaka, J.; Sawayama, T.


    For the purpose of safety regulations of operating nuclear power stations in Japan, the regulatory authorities utilize two types of regulations. One is the direct regulation, such as periodical inspection to inspect the function and performance of equipment important to safety, and the other is the audit type regulation such as preservation inspection to audit the compliance with the safety preservation rules. As performance indicators are expected to be an effective tool to evaluate the activities by audit type regulations, NUPEC is studying a comprehensive set of operational performance indicators to meet the effective evaluation method for the safety preservation activities in the audit type regulations under the frame of current safety regulation system. The study includes the establishment of comprehensive operational performance indicators applicable in Japan, the effective application of performance indicators to the current Japanese regulation, the clarification of the applicable scope of utilization, the possibility of applying the performance indicators. This report describes the present status of our performance indicator studies. After the completion of these studies the regulatory authorities will evaluate if and how the new set of comprehensive performance indicators could be introduced to Japanese regulatory scheme. (author)

  6. Medical preparedness for radiation emergency in Japan

    Akashi, Makoto


    Medical preparedness for radiation emergency in Japan is primary for off-site public protection. Many things remains to be discussed about on-site emergency medical problems. On the other hand, each nuclear facility should have a countermeasure plan of radiation emergency including medical measures for the emergency. Disaster countermeasure act and a guideline from NSC entitled 'Off-site emergency planning and preparedness for nuclear power plants' establish the system for countermeasures in radiation emergencies. The guideline also establishes medical plans in radiation emergencies, including care system for the severely contaminated or injured. NIRS is designated by the guideline as the definite care hospital for radiation injuries and is prepared to dispatch medical specialists and to receive the injured. NIRS conducts clinical follow-up studies of the injured, researches of diagnosis and treatments for radiation injuries, and education and training for medical personnel. NIRS has the plans to serve as the reference center for emergency in Japan and also in Asia, if necessary. NIRS would like to serve as a member of WHO Collaborating Center for Radiation Emergency Medical Preparedness and Assistance (REMPAN). Now NIRS is making preparation for providing 24-hours direct or consultative assistance with medical problems associated with radiation accidents in local, national, and hopefully international incidents. (author)

  7. Citrulline for urea cycle disorders in Japan.

    Tanaka, Kenichi; Nakamura, Kimitoshi; Matsumoto, Shirou; Kido, Jun; Mitsubuchi, Hiroshi; Ohura, Toshihiro; Endo, Fumio


    The amino acid l-citrulline is used as a therapeutic agent for urea cycle disorders (UCD) including ornithine transcarbamylase deficiency (OTCD), carbamoyl phosphate synthetase I deficiency (CPSD), and N-acetylglutamate synthase deficiency. There are few reports, however, on the use of l-citrulline in Japan and little consensus regarding the effects of l-citrulline. We conducted a questionnaire survey of patients undergoing l-citrulline treatment for a UCD to evaluate the current status of this therapy. The survey included patient background, details of l-citrulline treatment, clinical examination data, treatment, frequency of vomiting, and liver transplantation. We retrospectively investigated 43 questionnaire respondents (OTCD, n = 33; CPSD, n = 10). The weight of male OTCD patients improved by +0.79 SD, and the ammonia level decreased by a mean of 44.3 μmol/L in all patients. The protein intake of all patients and of male OTCD patients increased by 0.14 g/kg/day and 0.17 g/kg/day, respectively. l-Citrulline effectively reduced ammonia level, increased protein intake, and improved weight gain in UCD patients. l-Citrulline should be considered a standard therapy in OTCD and CPSD patients. © 2016 Japan Pediatric Society.

  8. Japan's involvement in oil sands development

    Sugiura, T.


    According to Japanese national policy, exploration and development by Japanese companies in overseas countries are promoted in order to ensure stable oil supplies. Japan Canada Oil Sands Limited (JACOS), part of the JAPEX group, was established during the 1978 world oil crisis to explore and develop Canadian oil sand resources in accordance with Japan's national policy. The JAPEX group, including JACOS, has invested $123 million in oil sands projects in Alberta. JAPEX's first involvement in oil sands was in the Primrose Project operated by Norcen in the Cold Lake area. Five years of cyclic steam stimulation pilot tests did not produce sufficiently good results to justify further operation. The second involvement was the PCEJ Project, a joint effort by four companies that are participating in a bitumen recovery test project in the Athabasca Deposit. JACOS holds 2,452 km 2 of oil sands leases in Alberta. Tests conducted since 1978 in the PCEJ Project include multiwell steam injection pilot tests, some of which showed promise. JACOS is also participating in steam assisted gravity drainage projects and in federal/provincial research programs. Obstacles identified in developing Alberta oil sands are the lack of a bitumen pipeline to Edmonton and the insufficient length of oil sands leases (currently 10 years), given the difficulties of oil sand development. 10 figs

  9. Suicidal behavior among homeless people in Japan.

    Okamura, Tsuyoshi; Ito, Kae; Morikawa, Suimei; Awata, Shuichi


    The purpose of this study is to investigate the frequency and correlates of suicidal behavior among homeless people in Japan. A face-to-face survey was conducted in two districts of Tokyo, Japan, with 423 subjects who resided on streets and riversides and in urban parks and stations (street homeless) or who were residents of shelters, cheap hotels, or welfare homes for homeless people (sheltered homeless). When questioned about suicidal ideation in the previous 2 weeks, 51 subjects (12.2% of valid responses) had a recurring wish to die, 29 (6.9%) had frequent thoughts of suicide, and 22 (5.3%) had made suicide plans. In addition, 11 (2.9%) subjects had attempted suicide in the previous 2 weeks and 74 (17.7%) reported that they had ever attempted suicide. In univariate logistic regression analyses, street homelessness, lack of perceived emotional social support, poor subjective health perception, visual impairment, pain, insomnia, poor mental well-being, and current depression were significantly associated with recurrent thoughts of suicide in the previous 2 weeks. Among these, current depression had the greatest significance. In multivariate logistic regression analyses after controlling for depression, street homelessness and lack of perceived emotional social support were significantly associated with recurrent thoughts of suicide in the previous 2 weeks. Comprehensive interventions including housing and social support as well as mental health services might be crucial as effective strategies for suicide prevention among homeless people.

  10. Response to the Chernobyl accident in Japan



    The worst nuclear accident in history happened at No.4 unit of the Chernobyl Atomic Power Station in USSR. Since the Chernobyl accident, a number of measures have been introduced in many countries, including the reconsideration of programs for construction and operation of nuclear power plants. In Japan, the press and television first reported the accident on April 29. The next day, all the relevant governmental agencies began to collect and analyze information in order to prepare possible countermeasures. The Nuclear Safety Commission issued a statement covering three points: 1) the radioactive substances released by the accident will have virtually no influence on the health of people in Japan, 2) a Special Committee on the Chernobyl Atomic Power Station Accident will be established, and 3) the Soviet government must provide all detailed information about the accident as soon as it is available. On April 30, the Committee on Radioactivity decided to increase radioactivity observations by the Science and Technology Agency, the Defence Agency, and the Meteorological Agency. On the same day, the Ministry of International Trade and Industry set up a survey committee for the Chernobyl accident with the responsibility of collecting and analyzing information about the accident. A review is also made in this article as to how the Japanese media reported the accident and how people reacted on reading the newspapers and watching TV on the accident. (Nogami, K.)

  11. Economical scale of radiation applications in Japan

    Yanagisawa, Kazuaki; Kume, Tamikazu; Makuuchi, Keizo; Takeshita, Hidefumi


    As a scale to quantify actual state of a thing, person, material and money are used in general, and money or economical scale has been frequently investigated on radiation application. As some investigations on annual sales (economical scale) of tire for car and germination protection of tomato had been tried to estimate in Japan, they were carried out only partially but not in general. On the other hand, in U.S.A. some general investigations were carried out, to report 421 billion dollars for nuclear energy application where its 80% was occupied by radiation application and remained 20 % was energy application (electricity). Therefore, JAERI established a special group (radiation frontier research group) aiming to investigate economical scale of radiation application in Japan to industrial, agricultural and medical field in general under cooperation of universities and private companies by receiving trust of the Science and Technology Agency. Here were described on basic concept on the investigation, its results, and total image on economical scale of radiation application and its comparison with that of energy application. (G.K.)

  12. Monitoring of congenital anomalies in Japan

    Kuroki, Y.; Konishi, H.


    Birth defects monitoring system is one of the most effective strategies to prevent birth defects mainly caused by environmental factors. Six different monitoring systems are working in Japan. Three of them are population-based and the other three hospital-based, both are widely scattered in Japan. Basic methodological designs of all birth defects monitoring systems are same. Therefore, the combination of them seems to be ideal. Total number of births surveyed in all systems are 283,000 annually. Each system has already accumulated relevant baseline data. Birth defects monitoring has another function to test the safety of widely exposed factors such as smoking, alcohol, low dose radiations, etc. Maternal smoking has some adverse effects on morphogenesis of the fetus. However, low dose radiations during or before pregnancy have no significant teratogenic effects on the fetus. The genetic effects of the Chernobyl nuclear power plant accident was studied. The annual effective dose equivalent to Japanese population due to radioactive fallout from the accident was assessed to be 5 μSv/y. No measurable mutagenic effects were recognized in Kanagawa by the analysis of three sentinel anomalies. (author)

  13. Macroeconomic fluctuations and mortality in postwar Japan.

    Granados, José A Tapia


    Recent research has shown that after long-term declining trends are excluded, mortality rates in industrial countries tend to rise in economic expansions and fall in economic recessions. In the present work, co-movements between economic fluctuations and mortality changes in postwar Japan are investigated by analyzing time series of mortality rates and eight economic indicators. To eliminate spurious associations attributable to trends, series are detrended either via Hodrick-Prescott filtering or through differencing. As previously found in other industrial economies, general mortality and age-specific death rates in Japan tend to increase in expansions and drop in recessions, for both males and females. The effect, which is slightly stronger for males, is particularly noticeable in those aged 45-64. Deaths attributed to heart disease, pneumonia, accidents, liver disease, and senility--making up about 41% of total mortality--tend to fluctuate procyclically, increasing in expansions. Suicides, as well as deaths attributable to diabetes and hypertensive disease, make up about 4% of total mortality and fluctuate countercyclically, increasing in recessions. Deaths attributed to other causes, making up about half of total deaths, don't show a clearly defined relationship with the fluctuations of the economy.

  14. Energy management in Japan. Consequences for RIs

    CERN. Geneva


    Japan is eager to host the ILC, the International Linear Collider Project. One of the issues in realizing such a large accelerator facility in Japan would be assuring a satisfactory supply of electrical power. As is well known, after the Tohoku - Pacific Ocean Earthquake in March 11, 2011, most Japanese nuclear power plants have been off-line. Prior to that, up to 30% of the demand on the electrical grid was supplied by nuclear power. While there is no prospect for resumption of reactor operations, a rapid increase of the generation capacity of fossil fuel plants has allowed Japanese industries and domestic life to survive without major disruption, thought it has worsened the trade imbalance. In any case, we must be realistic in preparing an energy management plan for our Research Institutes where large-scale energy consumers are. Already for many years laboratories such as TRISTAN, KEKB and J-PARC have scheduled their operations so that they could contract to draw minimal power during the summer cooling sea...

  15. Siting Process for HLW Repository in Japan

    Masuda, S.; Kitayama, K.; Umeki, H.; Naito, M.


    In the year 2000, the geological disposal program for high-level radioactive waste in Japan moved from the phase of generic research and development (R and D) into the phase of implementation. Following legislation entitled the ''Specified Radioactive Waste Final Disposal Act'', the Nuclear Waste Management Organization of Japan (NUMO) was established as the implementing organization. The assigned activities of NUMO include selection of the repository site, demonstration of disposal technology at the site, developing relevant licensing applications and construction, operation and closure of the repository. As the first milestone of siting process, NUMO announced to the public an overall procedure for selection of preliminary investigation areas for potential candidate sites on October 29, 2001. The procedure specifies that NUMO will solicit volunteer municipalities for preliminary investigation areas with publishing four documents as an information package. These documents are tentatively entitled ''Instructions for Application'', ''Siting Factors for the Preliminary Investigation Areas'', a ''Repository Concepts'' as well as an ''Site Investigation Community Outreach Scheme''

  16. Health workers' attitudes toward euthanasia in Japan.

    Takeo, K; Satoh, K; Minamisawa, H; Mitoh, T


    Despite impressive life-saving medical advancements, diseases for which there are no cure still exist. In the past doctors and health workers in Japan often preferred not to disclose the diagnosis of an incurable disease--particularly cancer--to patients. A 1980 study revealed that only 17% of the Japanese doctors questioned actually had the experience of informing their patients they had cancer, while reportedly in the US 98% of doctors inform patients they have cancer. This attitude in Japan, however, is changing. And with this change such issues as care of the terminally ill after being informed about their diagnosis, human rights problems and other issues have arisen. In fact, euthanasia, although highly criticized when first introduced, is now being increasingly preferred to medical treatment that prolongs life in the presence of severe pain associated with an incurable disease. After reading a 1982 survey that revealed that 84% of the Japanese people interviewed would prefer to die with dignity rather than prolong life with a machine, four researchers decided to examine terminal care more fully, this time from the viewpoint of the medical staff. Below, their study results.

  17. Education Reform and Equal Opportunity in Japan

    Akito Okada


    Full Text Available Recently, there have been concerns that equality of educational opportunity has been lost and that this is leading to the stratification of Japanese society through the widening of income differentials, in a 'gap society'. In such a disparity society, secure full- time jobs are increasingly becoming limited to those who graduate from prestigious universities, and entry into those institutions is becoming connected more clearly with family income and investments. Parental attitudes towards their children taking extra lessons after school, going to cram schools, getting into university, and getting into a relatively highly-ranked university have influenced educational costs. This article examines the historical formation of the concept of equality of opportunity, which has been applied to the educational policy in Japan, particularly from the end of World War II to the new millennium. This paper also expands on the existing literature on educational policies in contemporary Japan by examining how the current educational reform efforts have affected equality of educational opportunity among children from different family backgrounds.

  18. Database and Related Activities in Japan

    Murakami, Izumi; Kato, Daiji; Kato, Masatoshi; Sakaue, Hiroyuki A.; Kato, Takako; Ding, Xiaobin; Morita, Shigeru; Kitajima, Masashi; Koike, Fumihiro; Nakamura, Nobuyuki; Sakamoto, Naoki; Sasaki, Akira; Skobelev, Igor; Tsuchida, Hidetsugu; Ulantsev, Artemiy; Watanabe, Tetsuya; Yamamoto, Norimasa


    We have constructed and made available atomic and molecular (AM) numerical databases on collision processes such as electron-impact excitation and ionization, recombination and charge transfer of atoms and molecules relevant for plasma physics, fusion research, astrophysics, applied-science plasma, and other related areas. The retrievable data is freely accessible via the internet. We also work on atomic data evaluation and constructing collisional-radiative models for spectroscopic plasma diagnostics. Recently we have worked on Fe ions and W ions theoretically and experimentally. The atomic data and collisional-radiative models for these ions are examined and applied to laboratory plasmas. A visible M1 transition of W 26+ ion is identified at 389.41 nm by EBIT experiments and theoretical calculations. We have small non-retrievable databases in addition to our main database. Recently we evaluated photo-absorption cross sections for 9 atoms and 23 molecules and we present them as a new database. We established a new association ''Forum of Atomic and Molecular Data and Their Applications'' to exchange information among AM data producers, data providers and data users in Japan and we hope this will help to encourage AM data activities in Japan.

  19. Historical review of radiation research in Japan

    Yamasaki, F.


    The outline of the history of radiation research in Japan is written in connection with the names of researchers. Yoshio Nishina was a pioneer, who derived the Klein-Nishina formula for the scattering of hard X-ray by free electrons. In 1935, the first nuclear experiment laboratory was constructed in the Institute of Physical and Chemical Research. Two cyclotrons, 26 in and 60 in pole face diameter, and a high voltage Cockcroft-Walton type ion accelerator were installed. Irradiation of insects and plants with fast neutrons was attempted to examine the biological effect. In August, 1945, atomic bombs exploded in Hiroshima and Nagasaki. In 1950, radioisotopes were available. In early March, 1954, Bikini accident occurred. One fishing vessel was contaminated by radioactive fallout, and to investigate the effect of radioactivity, a committee consisted of investigators of physics, chemistry, medicine, biology, fisheries and geophysics was organized. The Japan Atomic Energy Research Institute was established in June, 1956. Several institutions for the peaceful use of atomic energy were established. The hybrid spark chamber to image the distribution of β-emitting isotopes on a plane surface was constructed in Nagoya University. As for the national project on food irradiation, one laboratory has played the role in irradiation techniques. Researches on radiation chemistry in universities, governmental and commercial organizations have been progressing steadily, and the machines for nanosecond to picosecond pulse radiolysis are working. (Yamashita, S.)

  20. Japan's nuclear catastrophe; a shocking calamity

    Shiva, Sonu; Gaur, Madhusudan


    Japan suffered a massive earthquake which was followed by more disastrous tsunami that led to nuclear crises. The Fukushima nuclear plant faced series of explosions and the water cooling system failed. The nuclear reactor is spreading radioactivity in the atmosphere. This has immensely affected the country's economy and the authorities are still struggling to stop the release of radiation from the quake hit nuclear plant. The professors of various universities are tense with regard to dangerous amount of radiation present in the air. The survivors of the calamity are afraid of cancer and other dire illnesses; who have been exposed to Japan's crippled nuclear plant on march 11, 2011. Though the scientists claim that Tokyo is safe from the radiations but the authorities do not have the sufficient data to prove about its safety. There has been much errors and delay in the proper assessment of the crises and the truth may take 5 to 10 years of time to come out, but this would be too late. This paper is an attempt to delve deep into the reasons of this calamity. It intends to suggest some measures that can be helpful in assessing the damage and improvements that can be taken up with regard to location and design of nuclear power plant so that in such situation of emergency the coping becomes easier and damage minimized. (author)

  1. Glucose 6-phosphate dehydrogenase variants in Japan.

    Miwa, S


    Fifty-four cases of glucose 6-phosphate dehydrogenase (G6PD) deficiency have so far been reported in Japan. Among them, 21 G6PD variants have been characterized. Nineteen out of the 21 variants were characterized in our laboratory and G6PD Heian and "Kyoto" by others. G6PD Tokyo, Tokushima, Ogikubo, Kurume, Fukushima, Yokohama, Yamaguchi, Wakayama, Akita, Heian and "Kyoto" were classified as Class 1, because all these cases showed chronic hemolytic anemia and severe enzyme deficiency. All these variants showed thermal instability. G6PD Mediterranean-like, Ogori, Gifu and Fukuoka were classified as Class 2, whereas G6PD Hofu, B(-) Chinese, Ube, Konan, Kamiube and Kiwa belonged to Class 3. All the 6 Class 3 variants were found as the results of the screening tests. The incidence of the deficiency in Japanese seems to be 0.1-0.5% but that of the cases which may slow drug-induced hemolysis would be much less. G6PD Ube and Konan appear to be relatively common in Japan.

  2. Problems of nuclear fuel reprocessing in Japan

    Tanaka, Naojiro


    The reprocessing capacity of the plant No. 1 of Power Reactor and Nuclear Fuel Development Corporation, which is scheduled to start operation in fiscal year 1975, will be insufficient after fiscal year 1978 for the estimated demand for reprocessing based on Japanese nuclear energy development program. Taking into consideration the results examined by JAIF's study team to Europe and the U.S., it is necessary that Japan builds 2nd reprocessing plant. But there will be a gap from 1978 to 1984 during which Japan must rely on overseas reprocessing services. The establishment of a reprocessing system is a task of national scale, and there are many problems to be solved before it can be done. These include the problems of site and environment, the problem of treatment and disposal of radioactive wastes, the raising of huge required funds and so on. Therefore, even if a private enterprise is allowed to undertake the task, it will be impossible to achieve the aim without the cooperation and assistance of the government. (Wakatsuki, Y.)

  3. Asthma Controller Medications for Children in Japan

    Shota Hamada DrPH


    Full Text Available Background. Treatment and management strategies for asthma in children are generally consistent internationally, but prescription of antiasthma drugs differs among countries. The objective of this study was to examine the prescribing patterns of antiasthma drugs, particularly controller medications, in children. Methods. A retrospective cohort study was performed in children with asthma using an administrative claims database in Japan. Results. A total of 1149 preschool-age and 3226 school-age children were identified. Leukotriene receptor antagonists were prescribed for about 80% of the children. Long-acting β-agonists were prescribed for 87.6% and 59.6% of preschool-age and school-age children, respectively, whereas prescriptions of inhaled corticosteroids had lower rates of 8.2% and 16.5%, respectively. In an examination of prescriptions at 1-month intervals, a relatively high number of children were prescribed bronchodilators without anti-inflammatory agents. Conclusion. Our findings suggest that asthma care for children in Japan can be improved through changes in drug prescriptions.

  4. Situation of nuclear industry in Japan


    This document presents the situation of nuclear industry in Japan: cooperation with France in the domain of the fuel cycle (in particular the back-end) and of for the industrial R and D about fast reactors and nuclear safety; present day situation characterized by a series of incidents in the domain of nuclear safety and by an administrative reorganization of the research and safety organizations; power of local representatives, results of April 2003 elections, liberalization of the electric power sector, impact of the TEPCO affair (falsification of safety reports) on the nuclear credibility, re-start up of the Monju reactor delayed by judicial procedures, stopping of the program of MOX fuel loading in Tepco's reactors, discovery of weld defects in the newly built Rokkasho-mura reprocessing plant, an ambitious program of reactors construction, the opportunity of Russian weapons dismantling for the re-launching of sodium-cooled fast reactors; the competition between France and Japan for the setting up of ITER reactor and its impact of the French/Japanese partnership. (J.S.)

  5. Recurrent Kawasaki disease: USA and Japan.

    Maddox, Ryan A; Holman, Robert C; Uehara, Ritei; Callinan, Laura S; Guest, Jodie L; Schonberger, Lawrence B; Nakamura, Yosikazu; Yashiro, Mayumi; Belay, Ermias D


    Descriptive epidemiologic studies of recurrent and non-recurrent Kawasaki disease (KD) may identify other potentially important differences between these illnesses. Data from the USA and Japan, the Centers for Disease Control and Prevention (CDC) national KD surveillance(1984-2008) and the 17th Japanese nationwide survey (2001-2002), respectively, were analyzed to examine recurrent KD patients <18 years of age meeting the CDC KD case or atypical KD case definition. These patients were compared with non-recurrent KD patients. Of the 5557 US KD patients <18 years of age during 1984-2008, 97 (1.7%) were identified as having had recurrent KD. Among the US Asian/Pacific Islander KD patients, 3.5% had recurrent KD, which was similar to the percentage identified among KD patients (3.5%) in the Japanese survey. Compared with non-recurrent KD patients, KD patients [with recurrent KD] were more likely to be older, fulfill the atypical KD case definition, and have coronary artery abnormalities (CAA) despite i.v. immunoglobulin (IVIG) treatment. Differences in the age, race, and frequency of CAA exist between recurrent and non-recurrent KD patients. The increased association of CAA with recurrent KD suggests that more aggressive treatment strategies in conjunction with IVIG may be indicated for the second episode of KD. © 2015 Japan Pediatric Society.

  6. Confucianism and gender culture of Japan

    I. O. Svyatnenko


    Full Text Available The problem of the definition of Confucianism areas of influence on the gender culture of Japanese society has been studied by the author. It has been found by the author that the influence of Confucianism on the gender culture of Japan supported the formation of a gender-servility’s women morality towards men and women enforcement to the behavioural roles, which are based on child-serving and house-wives scenarios. Confucianism has created the grounds for patriarchal sexism, by which woman is seen as an object of serving to masculine-centric hierarchies and must be formatted for the stereotypes of convenience in order to serve men under ordinary and extraordinary circumstances. The key points of the influence are as follows: legalized promiscuity allowance, porno-latrical behavioural model (especially in the aspect of women’s use as prostitutes, as well as the accentuation of gender roles in the biographies of etalon women which are described in Confucian treatises. It has been stated by the author that it is necessary to admit that the impact on the gender culture of Japan was made and is made not so much by Confucianism in its pure form, but by Shintoism Confucianism, which requires separate research in other publications.

  7. Epidemiological approach to cadmium pollution in Japan

    Shigematsu, I.


    The study of health problems due to cadmium pollution in Japan originated from an endemic episode of Itai-itai disease in a rural area in north-central Japan after World War II. The disease was defined as osteomalacia with tubular changes in the kidney and considered to be associated with excess intake of cadmium. This episode motivated the Japanese Government to conduct health examinations on the general population in cadmium-polluted and non-polluted areas throughout the country since 1969. Although Itai-itai disease-like bone changes were rarely found, these studies revealed a higher prevalence of renal tubular dysfunction among elderly people in the cadmium-polluted areas. No significant difference was noted in cancer mortality, but mortality from cardiovascular diseases and all causes tended to be lower in cadmium-polluted areas. Clinical and pathological studies in man as well as experiments on primates have recently been made to elucidate the pathogenesis of Itai-itai disease and the health effects of cadmium. The lack of knowledge on the ecological and biological complex of cadmium resulted in the impediment of studies on this problem. The lesson from this experience is that basic research is essential for promoting the study of pollutants such as heavy metals, though pollution problems usually require urgent solutions.

  8. The English Language in Japan: History, Attitudes, and Functions. Introduction.

    Kachru, Braj B.; Smith, Larry E.


    Introduces this special issue on the English language in Japan, which focuses on the historical phases of the introduction of English, the role of English in the educational system and the media, the contact and convergence of Japanese and English, the functions of English in Japan, and Japanese attitudes toward English. (three references) (MDM)

  9. From sword to chrysanthemum: Japan's culture of anti-miltarism

    Berger, T.U.


    The end of the Cold War and the phenomenal increase in Japan's economic and technological power put Japan today in the position to become, if it chooses, a military as well as economic superpower. The diminution of the Soviet threat and the increasing US preoccupation with domestic problems give Japan a latitude for independent action it has not had since the end of World War II. At the same time the US-Japanese security alliance, which has enabled Japan to adopt a minimalist approach to defense and national security, is being weakened by ideologically charged trade and other economic frictions and a growing American perception of Japan as a threat to its interests. Moreover, in the long run Japan faces the prospect of having to deal with other rising regional powers, most notably the People's Republic of China. This changing international security environment thus raises question whether Japan, having become an economic rival of the United States, may not in the future become a military competitor as well; whether, after having adopted a pacifist stance for half a century, Japan may choose to unsheathe its sword once again

  10. Over-Education and Its Opportunity Cost in Japan

    Kucel, Aleksander; Molina, Ivette Fuentes; Raya, Josep Maria


    In this paper, we investigate the determinants of over-education in Japan and evaluate its opportunity costs for university graduates. To this end, we use the REFLEX data. Results reveal that over-education level in Japan is high and it brings an important wage penalty for Japanese workers. Large firm and high occupations point toward a…

  11. Japan: Super-Aging Society Preparing for the Future

    Muramatsu, Naoko; Akiyama, Hiroko


    Japan has the highest proportion of older adults in the world. Aging is not only an immediate personal issue but also a salient factor in crucial public policies, such as pensions, health, and long-term care. The Great East Japan Earthquake, tsunami, and nuclear power plant disaster of March 2011 has highlighted current and emerging issues of a…

  12. 76 FR 8773 - Superalloy Degassed Chromium From Japan


    ... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-1090 (Review)] Superalloy Degassed Chromium From Japan AGENCY: United States International Trade Commission. ACTION: Termination of five-year... revocation of the antidumping duty order on superalloy degassed chromium from Japan would be likely to lead...

  13. Licensing and decommissioning of nuclear installations in Japan

    Shimoyama, Shunji.


    The present report discusses the current status of Japan's licensing system and legislation concerning reactor decommissioning operations. Besides Japan is working to promote worldwide nuclear safety research. However, developing nuclear safety regulations that are uniformely applicable is a difficult job due to big differences in geographical, political, economical, and technological conditions. (CW) [de

  14. Attitudes toward the Homeless: A U.S.-Japan Comparison.

    Guzewicz, Tony D.; Takooshian, Harold


    Compares attitudes toward the homeless in Japan and the United States through a survey of 268 Japanese and 254 U.S. adults and adolescents interviewed in public places. In Japan, homelessness is seldom discussed, and poverty, which may be as widespread as in the United States, is often not recognized. (SLD)

  15. Japan's regulatory and safety issues regarding nuclear materials transport

    Saito, T.; Yamanaka, T.


    This paper focuses on the regulatory and safety issues on nuclear materials transport which the Government of Japan (GOJ) faces and needs to well handle. Background information about the status of nuclear power plants (NPP) and nuclear fuel cycle (NFC) facilities in Japan will promote a better understanding of what this paper addresses

  16. Radiation curing technology progress and its industrial applications in Japan

    Ukachi, Takashi


    Optics, electronics and display industries are now the driving forces for the Japanese radiation curing technology. The purpose of this paper is to overview the newly developed radiation curing technology in Japan, in particular, its industrial applications, and to present the market figures in radiation curing applications, which were surveyed by RadTech Japan in 2002 afresh. (author)

  17. The Issue of Diversity and Multiculturalism in Japan

    Qi, Jie; Zhang, Sheng Ping


    The purpose of this paper is to problematize that which has been taken for granted about the notion of multiculturalism in Japan. Multiculturalism is a "hot" issue in Japan. As the Japanese government started to promote "internationalization" since 1980s, slogans such as "international exchange," "cultural…

  18. Continuity and Change in Disaster Education in Japan

    Kitagawa, Kaori


    This article aims to describe post-war continuity and change in disaster education in Japan. Preparedness for natural disasters has been a continuous agenda in Japan for geographical and meteorological reasons, and disaster education has been practised in both formal and informal settings. Post-war disaster management and education have taken a…

  19. Delphi survey of issues after the Great East Japan Earthquake

    Maeda, Yasunobu; Seo, Kami; Motoyoshi, Tadahiro; Okada, Shinya


    The Great East Japan Earthquake on March 11, 2011 has catastrophic impacts on Japan. Japan is currently on the way to recovery. However, as the damage on the country as well as society is so serious, Japanese society is urged to change some systems including hazard management, energy policy, information systems and city planning. These changes are accompanied with social group realignments, thus necessarily followed by various risks. To cope with these risk issues, SRA-Japan established the special research committee for the Great East Japan Earthquake. The aim of the committee is, from viewpoints of risk analysts, to create and relate messages about risk issues in 2-3 years, in ten years and in thirty years from the earthquake. To do this, the committee garners SRA-Japan member's opinions about possible risks in Japan by using Delphi method. In SRA-Japan, there are over 600 members in interdisciplinary fields from various backgrounds, thus the messages are expected to be helpful for Japanese society to lower its risks and to optimize the resource allocation. The research is now underway. An interim report will be presented. (author)

  20. Media Education in Japan (Retrospect and Present Trends).

    Takakuwa, Yasuo

    This overview of the development of media education in Japan begins with a discussion of the motion picture as entertainment and the public attitude toward film in Japan during the early years of the century. The introduction of film education into the schools in the 1920s--both teaching by film and teaching about film--is then described together…

  1. Koreans in Japan: Their Influence on Korean-Japanese Relations.


    1963. 31. The Republic of Korea National Red Cross, The Dispersed Families in Korea, Seoul, 1977. 32. Sato , Shoki, Koreans in Japan - The...1975. 34. Sumiya, Mikio , Kankoku no Keizai (The Korean Economy), Iwanami Shoten, Tokyo, Japan, 1974. 35. U.S. Government Printing Office, U.S. Army Area

  2. Perceptions of Aging and Disability among College Students in Japan

    Warren, Nicholas J.; Kamimura, Akiko; Trinh, Ha Ngoc; Stephens, Emily; Omi, Keita; Kanaoka, Ana; Ishikawa, Ai; Yamanaka, Katsuo


    Japan launched the Long-term Care Insurance program in 2000, and ratified the United Nations' Convention on the Rights of Persons with Disabilities in 2014. Japan has been taking significant steps to support their elderly population and individuals with disabilities. However, information is lacking on the understanding and opinions of either of…

  3. Textbook Development and Selection in Japan and the United States.

    Tani, Masaru; And Others


    Reports on a study trip by 13 U.S. social studies educators and publishers to Japan. Compares development, marketing, and selection of textbooks in the United States and Japan. Concludes that both nations should improve textbooks and textbook selection processes. (CFR)

  4. High-level manpower movement and Japan's foreign aid.

    Furuya, K


    "Japan's technical assistance programs to Asian countries are summarized. Movements of high-level manpower accompanying direct foreign investments by private enterprise are also reviewed. Proposals for increased human resources development include education and training of foreigners in Japan as well as the training of Japanese aid experts and the development of networks for information exchange." excerpt

  5. Ethics Education for Professionals in Japan: A Critical Review

    Maruyama, Yasushi; Ueno, Tetsu


    Ethics education for professionals has become popular in Japan over the last two decades. Many professional schools now require students to take an applied ethics or professional ethics course. In contrast, very few courses of professional ethics for teaching exist or have been taught in Japan. In order to obtain suggestions for teacher education,…

  6. The UK-Japan Young Scientist Workshop Programme...

    Albone, Eric; Okano, Toru


    The authors have been running UK-Japan Young Scientist Workshops at universities in Britain and Japan since 2001: for the past three years in England with Cambridge University and, last year, also with Kyoto University and Kyoto University of Education. For many years they have worked jointly with colleagues in a group of Super Science High…

  7. Tokugawa Japan and Industrial Revolution Britain: Two Misunderstood Societies

    Ellington, Lucien


    In this article, the author presents a truer picture than economic historians have previously had of the economies of Tokugawa Japan, and Britain during the Industrial Revolution. Though substantially different, both societies were prosperous compared to most of the rest of the world. Japan's economic success began in the Tokugawa period…

  8. Beyond the Limitations of Environmental Education in Japan

    Imamura, Mitsuyuki


    Environmental education has not spread as widely in Japan as expected and therefore has not had any significant impact on environmental problems, even though many educators and researchers have devoted themselves to environmental educational practice. Why is environmental education not popular in Japan, and what does this tell us? The purpose of…

  9. English, Language Shift and Values Shift in Japan and Singapore

    Morita, Liang


    This is a comparative study of English language education in Japan and Singapore and the role English plays in both countries. English language education in Japan has not been very effective. Although the communicative approach to teaching English was introduced in the 1980s, schools still use the grammar-translation method and most Japanese do…

  10. The Rise and Fall of Chosen Soren: It's Effect on Japan's Relations on the Korean Peninsula

    Creamer, Dewayne


    The Korean Diaspora in Japan is a legacy of Japan's colonization of Korea in the first half of the 20th century and has always been the largest group of foreign residents in an otherwise ethnically homogenous Japan...

  11. NASDA and the Space Industry in Japan

    Takamatsu, Hideo


    With over 30 years of history in space activities, Japan is now recognized as one of space powers in the world. Compared to other countries though, the features of Japanese space development are unique in several aspects. At first, its efforts are directed solely toward peaceful purposes and strictly separated from military uses. Secondly, there are many space related governmental agencies and institutes which are under supervision of different ministries. Thirdly, although the government budget is moderate and sales revenue of space industries is not so large, many large companies in aerospace or electronics industries see the importance of this business and compete each other mainly in the domestic market. NASDA, founded in 1969, is the largest governmental space organization and has played an important role in realizing practical applications of space activities. It has rapidly caught up the technology gap behind leading countries and has achieved remarkable successes with its own launch vehicles and satellites. Space industries, under the guidance of NASDA, have learned much from the U.S. companies and improved their technology levels and enjoyed steady growth during the early stage of Japanese space development. But before they became competitive enough in the world space business, the trade conflict between Japan and the U.S. made the procurement of Japanese non-R&D satellites open to the foreign satellite companies. Furthermore, interruptions of space activities due to recent successive failures of launch vehicles as well as Japanese economic slump have made space industries face hard situations. Under these circumstances, M&A of launch vehicle companies as well as satellite makers took place for the first time in Japanese aero-space history. Also at the government level, reorganization of space agencies is now under process. It is expected as a natural consequence of the merge of the Ministry of Education and the Science an Technology Agency, three space

  12. Pediatric allergy and immunology in Japan.

    Ebisawa, Motohiro; Nishima, Sankei; Ohnishi, Hidenori; Kondo, Naomi


    The Japanese Society of Pediatric Allergy and Clinical Immunology (JSPACI) was started in 1966 and currently has 3613 members as of August 1, 2012. The number of pediatricians specializing in allergies who have been certified by the Japanese Society of Allergology is 817. Among these, there are 125 training directors and training facilities for allergy and clinical immunology. The JSPACI first published an asthma guideline specific for children in 2000, and this has been revised every 3 yrs, contributing to better control of pediatric asthma. Food allergy management guidelines were first developed in 2005, which have helped to improve the care of food allergy patients. Among 514 pediatric training programs by the Japanese Society of Pediatrics, there are 312 facilities routinely performing oral food challenges. Among these, there were already 53 facilities performing oral immunotherapy at the end of 2011, treating 1400 cases of food allergy. The prevalence of pediatric allergic diseases has increased in Japan over the past 50 yrs. A number of International Study of Asthma and Allergies in Childhood surveys have been conducted in the past at specific times. The prevalence of wheezing among children aged 13-14 yrs in 2002 was 13.0%. Multi-year surveys found a 1.5- to 2-fold increase every 10 yrs until 2002. However, according to the latest data in 2012, asthma prevalence seems to have slightly decreased in Japan. Food allergy mainly associated with infantile atopic eczema among infants younger than 1 yr of age is the most common form as with other developed countries. The estimated food allergy prevalence based on data from several surveys is 5-10% among infants (0-6 yrs) and 1-2% among schoolchildren (6-15 yrs). A variety of patients suffering from primary deficiency syndrome have been actively analyzed. Previously, antibody defects and well-defined syndromes with immunodeficiency were analyzed, but recent research is focusing on not only acquired immune

  13. Establishment of 'Japan Atomic Energy Agency'. Its role and expectation

    Nakahara, Toru; Itakura, Shuichiro; Shiozawa, Shusaku; Hino, Ryutaro; Fujii, Yasuhiko; Sakurada, Michio; Kimura, Itsuro; Kikuyama, Kaoru


    In October 2005, the Japan Atomic Energy Agency (JAEA) was established as an independent administrative institution with the integration of the Japan Atomic Energy Research Institute (JAERI) and the Japan Nuclear Cycle Development Institute (JNC). JAEA is the only institute in Japan dedicated to comprehensive research and development in the field of nuclear energy. This paper put together a special article on its role and expectation. Firstly the essentials of comprehensive nuclear research and its future perspective were discussed mainly based on 'Framework for Nuclear Energy Policy' of the Atomic Energy Commission of Japan. Eight articles were followed on specific items such as quantum beams utilization, hydrogen production with nuclear heat, neutron science and ITER project, and put stress on joint works and smooth transfer of related technology to the private sector. (T. Tanaka)

  14. Groundwater flow analyses in Japan. 1. Case studies in Hokkaido and Northeast Japan

    Inaba, Hideo; Maekawa, Keisuke; Koide, Kaoru; Yanagizawa, Koichi


    An extensive study program has been carried out to estimate hydrogeological characteristics of deep underground in Japan. As a part of this program, groundwater flow analysis in Hokkaido and Northeast Japan were conducted. For the analyses of these area, hydrogeological models representing topography, geology, distribution of hydraulic conductivity were developed using available informations from open literature. By use of these models, steady state three-dimensional groundwater flow under a saturated/unsaturated condition was calculated by means of finite element method. The results are as follows: (1) Distribution of piezometric head corresponds with topography in the study area. (2) Piezometric head distribution is hydrostatic below E.L.-1000m in the study area. (3) Hydraulic gradient in the study area is less than 0.04 below E.L.-500m. (4) Difference of boundary conditions at the shore side of these models does not affect the results of the analyses. (author)

  15. Obscenity and homosexual depiction in Japan.

    Helms, U


    This essay serves as an historical introduction to the problem of film censorship in Japan, a country which, despite an often liberal sexual history, continues to impose baffling and even irrational censorship standards on both its domestic and imported cinema. However, whereas sexual censorship in the West is often the result of religious dogmatism, Japanese film censorship may in fact revolve around political struggles whose import is not the censoring of offensiveness per se, but is rather authoritarianism's basic yet desperate desire to assert itself in an increasingly liberal political climate. Furthermore, Japanese censorship has had the unique side effect of creating safe spaces of sexual fantasy (for children, for example) that most countries, in what is in fact a greater form of censorship, refuse to create at all.

  16. Atmospheric emission of BDE-209 in Japan

    Hirai, Y.; Sakai, Shin-ichi [National Institute for Environmental Studies, Tsukuba (Japan)


    Polybrominated diphenyl ethers (PBDEs) are a class of brominated flame retardants used in a variety of products. Among the three commercial PBDE products, the deca-BDE product has the largest production volume. The deca-BDE product is dominated by the BDE-209 congener, which is widely detected in the environment. Knowledge of their sources and emission inventories is important for the risk management of these compounds. Previous studies on the sources of PBDEs are based on expert judgments and laboratory experiments rather than field measurements. Few studies have examined their estimated inventories by comparing the observed concentrations and the concentrations predicted in their inventory. The aim of this study is to estimate the emission inventory of BDE-209 in Japan and to compare the predicted and observed concentrations.

  17. Experience with nuclear desalination in Japan

    Shiota, Y.


    In Japan, the seawater desalination facilities were used mainly for potable water in remote islands and industrial water such as boiler feedwater. In order to produce potable water, distillation processes, Electrical Dialysis (ED) and Reverse Osmosis (RO) were used in the past. The distillation facilities were used to produce boiler feedwater, however, RO facilities are now used for this purpose, such as the nuclear desalination facilities with capacities of 2600 m 3 /d, 2000 m 3 /d and 1000 m 3 /d, in Kansai Electric Power Co., Ltd., Shikoku Electric Power Co., Inc. and Kyuhshu Electric Power Co., Inc., respectively. The RO process is becoming a main stream of desalination because the process has a low energy consumption. 6 tabs

  18. The burden of insomnia in Japan

    Mishima K


    Full Text Available Kazuo Mishima,1 Marco daCosta DiBonaventura,2 Hillary Gross2 1Department of Psychophysiology, National Institute of Mental Health, National Center of Neurology and Psychiatry, Kodaira, Tokyo, Japan; 2Kantar Health, New York, NY, USA Objectives: Several studies have suggested that patients who experience insomnia report a number of significant impairments. However, despite this literature, fewer studies have focused on the burden of insomnia among patients in Japan. The objective of the current study is to extend this work in Japan to further understand the effect of insomnia on health-related quality of life (hrQOL. Further, another objective is to understand general predictors of hrQOL among patients with insomnia. Methods: Data from the 2012 Japan National Health and Wellness Survey, an annual, cross-sectional study of adults aged 18 years or older, were used (N=30,000. All National Health and Wellness Survey respondents were categorized based on the incidence of self-reported insomnia diagnosis and prescription medication usage (clinical insomniacs under treatment versus [vs] good sleepers without insomnia or insomnia symptoms. Comparisons among different groups were made using multiple regression models controlling for demographics and health history. Results: Clinical insomniacs (n=1,018; 3.4% reported significantly worse hrQOL compared with good sleepers (n=20,542 (mental component summary: 34.2 vs 48.0; physical component summary: 48.0 vs 52.8; health utilities: 0.61 vs 0.76; all P<0.05. Health behaviors (smoking, exercise, alcohol use and comorbidities were the strongest predictors of health utilities for clinical insomniacs. For all three clinical insomniac subgroups of interest, those with a physical comorbidity but not a psychiatric one, those with a psychiatric comorbidity but not a physical one, and those without either a physical or psychiatric comorbidity, large decrements in health utilities were observed for respondents who did

  19. Cultural influences on suicide in Japan.

    Russell, Roxanne; Metraux, Daniel; Tohen, Mauricio


    Following the economic crash of the late 1990s, the suicide rate in Japan increased to a rate of over 30 000 people per year and has been one of the highest in the world. Cultural factors have influenced this high suicide rate, such as a tradition of honorable suicide as well as permissive attitudes towards suicide that remain in modern times. Additionally, the economic downturn, particularly the trend of unemployment in middle-aged men, also played a significant role in the high suicide rate. The suicide rate has started to decrease in recent years perhaps in part due to suicide prevention measures undertaken by the government. © 2016 The Authors. Psychiatry and Clinical Neurosciences © 2016 Japanese Society of Psychiatry and Neurology.

  20. Medical applications with synchrotron radiation in Japan

    Takeda, T.; Itai, Y. [Univ. of Tsukuba, Inst. of Clinical Medicine, Tsukuba (Japan); Hyodo, K.; Ando, M. [KEK, Tsukuba (Japan); Akatsuka, T. [Yamagata Univ., Faculty of Engineering, Yamagata (Japan); Uyama, C. [National Cardiovascular Centre, Suita (Japan)


    In Japan, various medical applications of synchrotron X-ray imaging, such as angiography, monochromatic X-ray computed tomography (CT), radiography and radiation therapy, are being developed. In particular, coronary arteriography (CAG) is quite an important clinical application of synchrotron radiation. Using a two-dimensional imaging method, the first human intravenous CAG was carried out at KEK in May 1996; however, further improvements of image quality are required in clinical practice. On the other hand, two-dimensional aortographic CAG revealed canine coronary arteries as clearly as those on selective CAG, and coronary arteries less than 0.2 mm in diameter. Among applications of synchrotron radiation to X-ray CT, phase-contrast X-ray CT and fluorescent X-ray CT are expected to be very interesting future applications of synchrotron radiation. For actual clinical applications of synchrotron radiation, a medical beamline and a laboratory are now being constructed at SPring-8 in Harima. 55 refs.