Wave response analyses of floating crane structure; Crane sen no jobu kozobutsu no haro oto

Energy Technology Data Exchange (ETDEWEB)

Nobukawa, H.; Takaki, M.; Kitamura, M.; Ahou, G. [Hiroshima University, Hiroshima (Japan). Faculty of Engineering; Higashimura, M. [Fukada Salvage and Marine Works Co. Ltd., Osaka (Japan)

1996-12-31

Identifying a dynamic load acting on a lifted load in a floating crane moving in waves is important for preparing an operation manual for the floating crane. Analyses were made on motions in waves of a floating crane with a lifting load of 3,600 tons, with considerations given to deformation of the crane structure. Discussions were given on a dynamic load acting on a lifted load. If a case that considers elastic deformation in the crane structure is compared with a case that does not consider same in calculating hull motions of the floating crane, the difference between them is small if wave length {lambda} to the ship length L is about 0.5. However, if {lambda}/L is 1.0 and 1.5, the difference grows very large. Therefore, the effect of deformation in the crane structure on hull motions of the floating crane cannot be ignored in these cases. A dynamic load acting on a lifted load that considers deformation in the crane structure is about 5% of lifted weight in a headsea condition in which the wave height is 2 m and {lambda}/L is 1.5. As opposed, an estimated value of a dynamic load when the crane structure is regarded as a rigid body is 13%, which is 2.6 times as great as the case that considers deformation of the crane structure. 3 refs., 17 figs., 1 tab.

Wave response analyses of floating crane structure; Crane sen no jobu kozobutsu no haro oto

Energy Technology Data Exchange (ETDEWEB)

Nobukawa, H; Takaki, M; Kitamura, M; Ahou, G [Hiroshima University, Hiroshima (Japan). Faculty of Engineering; Higashimura, M [Fukada Salvage and Marine Works Co. Ltd., Osaka (Japan)

1997-12-31

Identifying a dynamic load acting on a lifted load in a floating crane moving in waves is important for preparing an operation manual for the floating crane. Analyses were made on motions in waves of a floating crane with a lifting load of 3,600 tons, with considerations given to deformation of the crane structure. Discussions were given on a dynamic load acting on a lifted load. If a case that considers elastic deformation in the crane structure is compared with a case that does not consider same in calculating hull motions of the floating crane, the difference between them is small if wave length {lambda} to the ship length L is about 0.5. However, if {lambda}/L is 1.0 and 1.5, the difference grows very large. Therefore, the effect of deformation in the crane structure on hull motions of the floating crane cannot be ignored in these cases. A dynamic load acting on a lifted load that considers deformation in the crane structure is about 5% of lifted weight in a headsea condition in which the wave height is 2 m and {lambda}/L is 1.5. As opposed, an estimated value of a dynamic load when the crane structure is regarded as a rigid body is 13%, which is 2.6 times as great as the case that considers deformation of the crane structure. 3 refs., 17 figs., 1 tab.

46 CFR 126.130 - Cranes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes. 126.130 Section 126.130 Shipping COAST GUARD... § 126.130 Cranes. (a) Except as provided by paragraph (b) of this section, cranes, if installed, must... chapter. (b) The manufacturer of a crane may have tests and inspections conducted in compliance with § 107...

NECESSITY OF WIRE ROPE REPLACEMENT IN CRANE LIFTING EQUIPMENT AFTER CHANGE OF CRANE OPERATIONAL PARAMETERS

Directory of Open Access Journals (Sweden)

Jozef Kuľka

2017-06-01

Full Text Available This article describes a specific expertise and evaluation process relating to a foundry crane, which is installed in a steel production factory. The main task was to analyse a possibility to increase lifting speed of the crane lifting mechanism in order to improve efficiency of the production process. The steel supporting structure of the given foundry crane was considered by means of the performed experimental measurements and calculations. The presented article describes the special experimental/analytical methodology, which was used for evaluation of the crane steel construction and crane mechanisms, namely the lifting mechanisms and travelling mechanisms. There are also explained the required modifications of the individual crane construction parts.

Haemosporida prevalence and diversity are similar in endangered wild whooping cranes (Grus americana) and sympatric sandhill cranes (Grus canadensis).

Science.gov (United States)

Bertram, Miranda R; Hamer, Gabriel L; Hartup, Barry K; Snowden, Karen F; Medeiros, Matthew C; Hamer, Sarah A

2017-04-01

The population growth of endangered whooping cranes (Grus americana) is not consistent with species recovery goals, and the impact of parasite infection on whooping crane populations is largely unknown. Disease ecology and epidemiology research of endangered species is often hindered by limited ability to conduct invasive sampling on the target taxa. Accordingly, we hypothesized that sandhill cranes (Grus canadensis) would be a useful surrogate species to investigate the health impacts of Haemosporida infection in whooping cranes. Our goal was to compare the prevalence and diversity of Haemosporida infection between whooping cranes and sandhill cranes. We detected an overall infection prevalence of 83·6% (n = 61) in whooping cranes and 59·6% (n = 47) and 63·6 (n = 22) in two sympatric sandhill crane populations captured in Texas. Prevalence was significantly lower in allopatric sandhill cranes captured in New Mexico (12·1%, n = 33). Haemoproteus antigonis was the most abundant haemoparasite in cranes, present in 57·4% of whooping cranes and 39·2% of sandhill cranes; Plasmodium and Leucocytozoon were present at significantly lower levels. The high prevalence of Haemosporida in whooping cranes and sympatric sandhill cranes, with shared parasite lineages between the two species, supports sandhill cranes as a surrogate species for understanding health threats to endangered whooping cranes.

Testing a ground-based canopy model using the wind river canopy crane

Science.gov (United States)

Robert Van Pelt; Malcolm P. North

1999-01-01

A ground-based canopy model that estimates the volume of occupied space in forest canopies was tested using the Wind River Canopy Crane. A total of 126 trees in a 0.25 ha area were measured from the ground and directly from a gondola suspended from the crane. The trees were located in a low elevation, old-growth forest in the southern Washington Cascades. The ground-...

Spiders in dermatology.

Science.gov (United States)

Kang, Jun K; Bhate, Chinmoy; Schwartz, Robert A

2014-09-01

Spider bites represent an unusual and potentially over-represented clinical diagnosis. Despite a common fear of spiders, known as arachnophobia, current knowledge suggests that only a small number of families within the order Araneae are medically relevant. Moreover, most cutaneous spider reactions, including both evenomations and physical trauma, produce mild, local symptoms which may be managed with supportive care alone. The differential diagnosis for spider bites may be broad, especially if the offending arachnid is not seen or found. We describe a series of spiders relevant to the dermatologist in the United States.

Sandhill crane roost selection, human disturbance, and forage resources

Science.gov (United States)

Pearse, Aaron T.; Krapu, Gary; Brandt, David

2017-01-01

Sites used for roosting represent a key habitat requirement for many species of birds because availability and quality of roost sites can influence individual fitness. Birds select roost sites based on numerous factors, requirements, and motivations, and selection of roosts can be dynamic in time and space because of various ecological and environmental influences. For sandhill cranes (Antigone canadensis) at their main spring-staging area along the Platte River in south-central Nebraska, USA, past investigations of roosting cranes focused on physical channel characteristics related to perceived security as motivating roost distribution. We used 6,310 roost sites selected by 313 sandhill cranes over 5 spring migration seasons (2003–2007) to quantify resource selection functions of roost sites on the central Platte River using a discrete choice analysis. Sandhill cranes generally showed stronger selection for wider channels with shorter bank vegetation situated farther from potential human disturbance features such as roads, bridges, and dwellings. Furthermore, selection for roost sites with preferable physical characteristics (wide channels with short bank vegetation) was more resilient to nearby disturbance features than more narrow channels with taller bank vegetation. The amount of cornfields surrounding sandhill crane roost sites positively influenced relative probability of use but only for more narrow channels resource features that sandhill cranes selected at river channels along the Platte River, and after incorporating spatial variation due to human disturbance, our understanding of roost site selection was more robust, providing insights on how disturbance may interact with physical habitat features. Managers can use information on roost-site selection when developing plans to increase probability of crane use at existing roost sites and to identify new areas for potential use if existing sites become limited.

Sandhill crane roost selection, human disturbance, and forage resources

Science.gov (United States)

Pearse, Aaron T.; Krapu, Gary; Brandt, David

2017-01-01

Sites used for roosting represent a key habitat requirement for many species of birds because availability and quality of roost sites can influence individual fitness. Birds select roost sites based on numerous factors, requirements, and motivations, and selection of roosts can be dynamic in time and space because of various ecological and environmental influences. For sandhill cranes (Antigone canadensis) at their main spring-staging area along the Platte River in south-central Nebraska, USA, past investigations of roosting cranes focused on physical channel characteristics related to perceived security as motivating roost distribution. We used 6,310 roost sites selected by 313 sandhill cranes over 5 spring migration seasons (2003–2007) to quantify resource selection functions of roost sites on the central Platte River using a discrete choice analysis. Sandhill cranes generally showed stronger selection for wider channels with shorter bank vegetation situated farther from potential human disturbance features such as roads, bridges, and dwellings. Furthermore, selection for roost sites with preferable physical characteristics (wide channels with short bank vegetation) was more resilient to nearby disturbance features than more narrow channels with taller bank vegetation. The amount of cornfields surrounding sandhill crane roost sites positively influenced relative probability of use but only for more narrow channels < 100 m and those with shorter bank vegetation. We confirmed key resource features that sandhill cranes selected at river channels along the Platte River, and after incorporating spatial variation due to human disturbance, our understanding of roost site selection was more robust, providing insights on how disturbance may interact with physical habitat features. Managers can use information on roost-site selection when developing plans to increase probability of crane use at existing roost sites and to identify new areas for potential use if

Specialised use of working memory by Portia africana, a spider-eating salticid.

Science.gov (United States)

Cross, Fiona R; Jackson, Robert R

2014-03-01

Using expectancy-violation methods, we investigated the role of working memory in the predatory strategy of Portia africana, a salticid spider from Kenya that preys by preference on other spiders. One of this predator's tactics is to launch opportunistic leaping attacks on to other spiders in their webs. Focussing on this particular tactic, our experiments began with a test spider on a ramp facing a lure (dead prey spider mounted on a cork disc) that could be reached by leaping. After the test spider faced the lure for 30 s, we blocked the test spider's view of the lure by lowering an opaque shutter before the spider leapt. When the shutter was raised 90 s later, either the same lure came into view again (control) or a different lure came into view (experimental: different prey type in same orientation or same prey type in different orientation). We recorded attack frequency (number of test spiders that leapt at the lure) and attack latency (time elapsing between shutter being raised and spiders initiating a leap). Attack latencies in control trials were not significantly different from attack latencies in experimental trials, regardless of whether it was prey type or prey orientation that changed in the experimental trials. However, compared with test spiders in the no-change control trials, significantly fewer test spiders leapt when prey type changed. There was no significant effect on attack frequency when prey orientation changed. These findings suggest that this predator represents prey type independently of prey orientation.

46 CFR 109.521 - Cranes: General.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: General. 109.521 Section 109.521 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS OPERATIONS Cranes § 109.521 Cranes: General. The master or person in charge shall ensure that each crane is operated and...

Molecular phylogeny of moth-specialized spider sub-family Cyrtarachninae, which includes bolas spiders.

Science.gov (United States)

Tanikawa, Akio; Shinkai, Akira; Miyashita, Tadashi

2014-11-01

The evolutionary process of the unique web architectures of spiders of the sub-family Cyrtarachninae, which includes the triangular web weaver, bolas spider, and webless spider, is thought to be derived from reduction of orbicular 'spanning-thread webs' resembling ordinal orb webs. A molecular phylogenetic analysis was conducted to explore this hypothesis using orbicular web spiders Cyrtarachne, Paraplectana, Poecilopachys, triangular web spider Pasilobus, bolas spiders Ordgarius and Mastophora, and webless spider Celaenia. The phylogeny inferred from partial sequences of mt-COI, nuclear 18S-rRNA and 28S-rRNA showed that the common ancestor of these spiders diverged into two clades: a spanning-thread web clade and a bolas or webless clade. This finding suggests that the triangular web evolved by reduction of an orbicular spanning web, but that bolas spiders evolved in the early stage, which does not support the gradual web reduction hypothesis.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

Directory of Open Access Journals (Sweden)

Jiang Min

2016-01-01

Full Text Available Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Application of 3 kinds of practical electromagnetic spiders in electromagnetic spider web

OpenAIRE

Jiang Min

2016-01-01

Electromagnetic spider web the launch circuit has introduced a lot, but in the center position of the utility of the spider generally have 3 kinds of circuits respectively, the use of single-chip microcomputer circuit of the low energy consumption spider by multi-channel transmission, single circuit receiver circuit. Direct use of the 3 channels of the spider and the use of PLC circuit spider, depending on the actual situation were placed.

Customized overhead cranes for installation of India's largest 3.6m optical telescope at Devasthal, Nainital, India

Science.gov (United States)

Bangia, Tarun; Yadava, Shobhit; Kumar, Brijesh; Ghanti, A. S.; Hardikar, P. M.

2016-07-01

India's largest 3.6 m aperture optical telescope facility has been recently established at Devasthal site by Aryabhatta Research Institute of Observation Sciences (ARIES), an autonomous Institute under Department of Science and Technology, Government of India. The telescope is equipped with active optics and it is designed to be used for seeinglimited observations at visible and near-infrared wavelengths. A steel building with rotating cylindrical steel Dome was erected to house 3.6m telescope and its accessories at hilltop of Devasthal site. Customized cranes were essentially required inside the building as there were space constraints around the telescope building for operating big external heavy duty cranes from outside, transportation constraints in route for bringing heavy weight cranes, altitude of observatory, and sharp bends etc. to site. To meet the challenge of telescope installation from inside the telescope building by lifting components through its hatch, two Single Girder cranes and two Under Slung cranes of 10 MT capacity each were specifically designed and developed. All the four overhead cranes were custom built to achieve the goal of handling telescope mirror and its various components during installation and assembly. Overhead cranes were installed in limited available space inside the building and tested as per IS 3177. Cranes were equipped with many features like VVVFD compatibility, provision for tandem operation, digital load display, anti-collision mechanism, electrical interlocks, radio remote, low hook height and compact carriage etc. for telescope integration at site.

Spider Vein Removal

Science.gov (United States)

Spider veins: How are they removed? I have spider veins on my legs. What options are available ... M.D. Several options are available to remove spider veins — thin red lines or weblike networks of ...

Design of an overhead crane for the ITER NB cell remote handling maintenance operations

Energy Technology Data Exchange (ETDEWEB)

Taubmann, Gonzalo; Brochet, Laurent [IBERTEF A.I.E., Iberica de Tecnologia de Fusion, C/Magallanes 3, 28015 Madrid (Spain); Liniers, Macarena [Asociacion EURATOM-CIEMAT para la Fusion, Av. Complutense 22, 28040 Madrid (Spain)], E-mail: macarena.liniers@ciemat.es; Medrano, Mercedes; Sarasola, Xabier; Botija, Jose; Alonso, Javier [Asociacion EURATOM-CIEMAT para la Fusion, Av. Complutense 22, 28040 Madrid (Spain); Damiani, Carlo [FUSION FOR ENERGY, Josep Pla 2, Torres Diagonal Litoral Ed B3, 08019 Barcelona (Spain)

2009-06-15

In the neutral beam cell of ITER all the maintenance operations on the neutral beam components (BLC's) must be performed by an overhead crane of large payload capability (30-50 tonnes). A crane system is presented consisting of a monorail, a carriage, and a lifting mechanism. The monorail must give access to the BLC's in the beam line vessel, the front components connecting the NB vessel with the Tokamak, and a storage area at the north end of the NB cell. Rail switching points are required at the intersections between radial and toroidal branches. A translational switching mechanism is proposed. The crane carriage consists of two independent sub-carriages, each composed of four wheels. A set of four secondary wheels attached to the main carriage prevents the crane tilting due to the CoG misalignment of some loads. The elevation system proposed consists of an electromechanical crane of four independent drums and 50 tonnes payload. In parallel with the crane design, a logistics and space availability study has been carried out, leading to the detection of clearance or transport problems that could be taken into account in the final crane design.

Design of an overhead crane for the ITER NB cell remote handling maintenance operations

International Nuclear Information System (INIS)

Taubmann, Gonzalo; Brochet, Laurent; Liniers, Macarena; Medrano, Mercedes; Sarasola, Xabier; Botija, Jose; Alonso, Javier; Damiani, Carlo

2009-01-01

In the neutral beam cell of ITER all the maintenance operations on the neutral beam components (BLC's) must be performed by an overhead crane of large payload capability (30-50 tonnes). A crane system is presented consisting of a monorail, a carriage, and a lifting mechanism. The monorail must give access to the BLC's in the beam line vessel, the front components connecting the NB vessel with the Tokamak, and a storage area at the north end of the NB cell. Rail switching points are required at the intersections between radial and toroidal branches. A translational switching mechanism is proposed. The crane carriage consists of two independent sub-carriages, each composed of four wheels. A set of four secondary wheels attached to the main carriage prevents the crane tilting due to the CoG misalignment of some loads. The elevation system proposed consists of an electromechanical crane of four independent drums and 50 tonnes payload. In parallel with the crane design, a logistics and space availability study has been carried out, leading to the detection of clearance or transport problems that could be taken into account in the final crane design.

Control of Rotary Cranes Using Fuzzy Logic

Directory of Open Access Journals (Sweden)

Amjed A. Al-mousa

2003-01-01

Full Text Available Rotary cranes (tower cranes are common industrial structures that are used in building construction, factories, and harbors. These cranes are usually operated manually. With the size of these cranes becoming larger and the motion expected to be faster, the process of controlling them has become difficult without using automatic control methods. In general, the movement of cranes has no prescribed path. Cranes have to be run under different operating conditions, which makes closed-loop control attractive.

Slewing Port Jib Cranes

OpenAIRE

Boris Visočnik; Stojan Kravanja

2002-01-01

The paper presents slewing port cranes with a luffing jib. The advantages of slewing port jib cranes are high lifting capacities, high speeds of re-loading and excellent mobility since they are capable of load lifting, travelling, luffing and slewing. The paper gives a detailed description of their characteristics such as the highest reached load-carrying capacities, speeds of motion and accelerations. It also presents the crane assembly, driving mechanisms, loads and load cases, transport by...

Silk elasticity as a potential constraint on spider body size.

Science.gov (United States)

Rodríguez-Gironés, Miguel A; Corcobado, Guadalupe; Moya-Laraño, Jordi

2010-10-07

Silk is known for its strength and extensibility and has played a key role in the radiation of spiders. Individual spiders use different glands to produce silk types with unique sets of proteins. Most research has studied the properties of major ampullate and capture spiral silks and their ecological implications, while little is known about minor ampullate silk, the type used by those spider species studied to date for bridging displacements. A biomechanical model parameterised with available data shows that the minimum radius of silk filaments required for efficient bridging grows with the square root of the spider's body mass, faster than the radius of minor ampullate silk filaments actually produced by spiders. Because the morphology of spiders adapted to walking along or under silk threads is ill suited for moving on a solid surface, for these species there is a negative relationship between body mass and displacement ability. As it stands, the model suggests that spiders that use silk for their displacements are prevented from attaining a large body size if they must track their resources in space. In particular, silk elasticity would favour sexual size dimorphism because males that must use bridging lines to search for females cannot grow large. 2010 Elsevier Ltd. All rights reserved.

Development of swing-free / shock free crane

International Nuclear Information System (INIS)

Yoon, J. S.; Park, B. S.; Kim, S. H.; Kwon, D. A.; Kim, D. W.; Kim, J. H.; Jeon, B. K.; Lee, Y. E.; Lee, S. H.

1999-04-01

To develop the automatized crane and to apply the relevant technology to nuclear power plants, in this project and automatized crane control system is developed along with a swing and shock crane. Also, this technology has been transferred to Bando Machinery Co. Ltd. The drive mechanism of crane is designed by adopting vector drives which provide soft acceleration and deceleration characteristics. Also, radio modems and a long-range laser displacement sensor which are commercially available are introduced to accommodate the large scaled crane systems. Also, several devices are developed for the automation of crane system. These are a crane controller, a supervisory controller, a angle measuring device, and laser localizer, a drum grapple device, and crane supervisory program. The performance of developed crane system is revealed to rapidly reduce the residual swing of the transported object and precisely controls the object position in any case. Also, the laser localizer provides he capability of measuring any arbitrary located objects within 3 cm error range

Spider Bites: First Aid

Science.gov (United States)

... care immediately if: You were bitten by a black widow or brown recluse spider You are unsure whether the bite ... in the South. Signs and symptoms of a black widow spider bite may include: At ... fever and nausea Brown recluse spider The brown recluse spider has a ...

Book review: A chorus of cranes: The cranes of North America and the world

Science.gov (United States)

Pearse, Aaron T.

2017-01-01

Cranes (Gruidae) are widely distributed throughout the world, have lived on Earth for several million years, and currently reside on five continents. Archaeological evidence and historical references suggest that humans have interacted with and been captivated by cranes for many thousands of years (e.g., Leslie 1988, Muellner 1990). A glimpse of our reverence for these birds can be found in A Chorus of Cranes by Paul A. Johnsgard, with photographs by Thomas D. Mangelsen. Many species of cranes are currently identified as threatened or endangered, and their future will likely rest in the hands of humans; this book presents their plight and some of the measures that have been taken to conserve them. Dr. Johnsgard, an emeritus professor at the University of Nebraska-Lincoln, is a prolific writer, having written more than 60 books in ornithology and other topics. This book serves as the latest update of previous efforts concerning crane biology, conservation, and management. A review without making comparisons to his past works is difficult, yet this assessment will primarily focus on the content of the current book, with little reference to past endeavors.A Chorus of Cranes: The Cranes of North America and the World by Paul A. Johnsgard. 2015. University Press of Colorado, Boulder, CO, USA. x + 208 pp., 38 color photographs, 41 figures. ISBN 978-1-60732-436-2. $23.95 (Ebook). ISBN 978-1-60732-436-9.

46 CFR 109.525 - Cranes: Working loads.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Working loads. 109.525 Section 109.525 Shipping... Cranes § 109.525 Cranes: Working loads. The master or person in charge shall ensure that tables... working the crane. ...

Spiders in caves.

Science.gov (United States)

Mammola, Stefano; Isaia, Marco

2017-04-26

World experts of different disciplines, from molecular biology to macro-ecology, recognize the value of cave ecosystems as ideal ecological and evolutionary laboratories. Among other subterranean taxa, spiders stand out as intriguing model organisms for their ecological role of top predators, their unique adaptations to the hypogean medium and their sensitivity to anthropogenic disturbance. As the description of the first eyeless spider ( Stalita taenaria ), an array of papers on subterranean spider biology, ecology and evolution has been published, but a comprehensive review on these topics is still lacking. We provide a general overview of the spider families recorded in hypogean habitats worldwide, we review the different adaptations of hypogean spiders to subterranean life, and we summarize the information gathered so far about their origin, population structure, ecology and conservation status. Finally, we point out the limits of the knowledge we currently have regarding hypogean spiders, aiming to stimulate future research. © 2017 The Author(s).

Spider phylogenomics: untangling the Spider Tree of Life

Directory of Open Access Journals (Sweden)

Nicole L. Garrison

2016-02-01

Full Text Available Spiders (Order Araneae are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results

Spider phylogenomics: untangling the Spider Tree of Life

Science.gov (United States)

Garrison, Nicole L.; Rodriguez, Juanita; Agnarsson, Ingi; Coddington, Jonathan A.; Griswold, Charles E.; Hamilton, Christopher A.; Hedin, Marshal; Kocot, Kevin M.; Ledford, Joel M.

2016-01-01

Spiders (Order Araneae) are massively abundant generalist arthropod predators that are found in nearly every ecosystem on the planet and have persisted for over 380 million years. Spiders have long served as evolutionary models for studying complex mating and web spinning behaviors, key innovation and adaptive radiation hypotheses, and have been inspiration for important theories like sexual selection by female choice. Unfortunately, past major attempts to reconstruct spider phylogeny typically employing the “usual suspect” genes have been unable to produce a well-supported phylogenetic framework for the entire order. To further resolve spider evolutionary relationships we have assembled a transcriptome-based data set comprising 70 ingroup spider taxa. Using maximum likelihood and shortcut coalescence-based approaches, we analyze eight data sets, the largest of which contains 3,398 gene regions and 696,652 amino acid sites forming the largest phylogenomic analysis of spider relationships produced to date. Contrary to long held beliefs that the orb web is the crowning achievement of spider evolution, ancestral state reconstructions of web type support a phylogenetically ancient origin of the orb web, and diversification analyses show that the mostly ground-dwelling, web-less RTA clade diversified faster than orb weavers. Consistent with molecular dating estimates we report herein, this may reflect a major increase in biomass of non-flying insects during the Cretaceous Terrestrial Revolution 125–90 million years ago favoring diversification of spiders that feed on cursorial rather than flying prey. Our results also have major implications for our understanding of spider systematics. Phylogenomic analyses corroborate several well-accepted high level groupings: Opisthothele, Mygalomorphae, Atypoidina, Avicularoidea, Theraphosoidina, Araneomorphae, Entelegynae, Araneoidea, the RTA clade, Dionycha and the Lycosoidea. Alternatively, our results challenge the

Human Factors Engineering Guidelines for Overhead Cranes

Science.gov (United States)

Chandler, Faith; Delgado, H. (Technical Monitor)

2001-01-01

This guideline provides standards for overhead crane cabs that can be applied to the design and modification of crane cabs to reduce the potential for human error due to design. This guideline serves as an aid during the development of a specification for purchases of cranes or for an engineering support request for crane design modification. It aids human factors engineers in evaluating existing cranes during accident investigations or safety reviews.

Respiration in spiders (Araneae).

Science.gov (United States)

Schmitz, Anke

2016-05-01

Spiders (Araneae) are unique regarding their respiratory system: they are the only animal group that breathe simultaneously with lungs and tracheae. Looking at the physiology of respiration the existence of tracheae plays an important role in spiders with a well-developed tracheal system. Other factors as sex, life time, type of prey capture and the high ability to gain energy anaerobically influence the resting and the active metabolic rate intensely. Most spiders have metabolic rates that are much lower than expected from body mass; but especially those with two pairs of lungs. Males normally have higher resting rates than females; spiders that are less evolved and possess a cribellum have lower metabolic rates than higher evolved species. Freely hunting spiders show a higher energy turnover than spiders hunting with a web. Spiders that live longer than 1 year will have lower metabolic rates than those species that die after 1 year in which development and reproduction must be completed. Lower temperatures and starvation, which most spiders can cope with, will decrease the metabolic rate as well.

Tarantula spider

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002855.htm Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

Load reduction test method of similarity theory and BP neural networks of large cranes

Science.gov (United States)

Yang, Ruigang; Duan, Zhibin; Lu, Yi; Wang, Lei; Xu, Gening

2016-01-01

Static load tests are an important means of supervising and detecting a crane's lift capacity. Due to space restrictions, however, there are difficulties and potential danger when testing large bridge cranes. To solve the loading problems of large-tonnage cranes during testing, an equivalency test is proposed based on the similarity theory and BP neural networks. The maximum stress and displacement of a large bridge crane is tested in small loads, combined with the training neural network of a similar structure crane through stress and displacement data which is collected by a physics simulation progressively loaded to a static load test load within the material scope of work. The maximum stress and displacement of a crane under a static load test load can be predicted through the relationship of stress, displacement, and load. By measuring the stress and displacement of small tonnage weights, the stress and displacement of large loads can be predicted, such as the maximum load capacity, which is 1.25 times the rated capacity. Experimental study shows that the load reduction test method can reflect the lift capacity of large bridge cranes. The load shedding predictive analysis for Sanxia 1200 t bridge crane test data indicates that when the load is 1.25 times the rated lifting capacity, the predicted displacement and actual displacement error is zero. The method solves the problem that lifting capacities are difficult to obtain and testing accidents are easily possible when 1.25 times related weight loads are tested for large tonnage cranes.

Almost a spider: a 305-million-year-old fossil arachnid and spider origins.

Science.gov (United States)

Garwood, Russell J; Dunlop, Jason A; Selden, Paul A; Spencer, Alan R T; Atwood, Robert C; Vo, Nghia T; Drakopoulos, Michael

2016-03-30

Spiders are an important animal group, with a long history. Details of their origins remain limited, with little knowledge of their stem group, and no insights into the sequence of character acquisition during spider evolution. We describe a new fossil arachnid, Idmonarachne brasierigen. et sp. nov. from the Late Carboniferous (Stephanian,ca 305-299 Ma) of Montceau-les-Mines, France. It is three-dimensionally preserved within a siderite concretion, allowing both laboratory- and synchrotron-based phase-contrast computed tomography reconstruction. The latter is a first for siderite-hosted fossils and has allowed us to investigate fine anatomical details. Although distinctly spider-like in habitus, this remarkable fossil lacks a key diagnostic character of Araneae: spinnerets on the underside of the opisthosoma. It also lacks a flagelliform telson found in the recently recognized, spider-related, Devonian-Permian Uraraneida. Cladistic analysis resolves our new fossil as sister group to the spiders: the spider stem-group comprises the uraraneids and I. brasieri While we are unable to demonstrate the presence of spigots in this fossil, the recovered phylogeny suggests the earliest character to evolve on the spider stem-group is the secretion of silk. This would have been followed by the loss of a flagelliform telson, and then the ability to spin silk using spinnerets. This last innovation defines the true spiders, significantly post-dates the origins of silk, and may be a key to the group's success. The Montceau-les-Mines locality has previously yielded a mesothele spider (with spinnerets). Evidently, Late Palaeozoic spiders lived alongside Palaeozoic arachnid grades which approached the spider condition, but did not express the full suite of crown-group autapomorphies. © 2016 The Authors.

Reliability Modeling of Double Beam Bridge Crane

Science.gov (United States)

Han, Zhu; Tong, Yifei; Luan, Jiahui; Xiangdong, Li

2018-05-01

This paper briefly described the structure of double beam bridge crane and the basic parameters of double beam bridge crane are defined. According to the structure and system division of double beam bridge crane, the reliability architecture of double beam bridge crane system is proposed, and the reliability mathematical model is constructed.

46 CFR 109.527 - Cranes: Operator designation.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Cranes: Operator designation. 109.527 Section 109.527... OPERATIONS Cranes § 109.527 Cranes: Operator designation. (a) The master or person in charge shall designate, in writing, each crane operator. (b) The master or person in charge shall ensure that only designated...

Verified spider bites in Oregon (USA) with the intent to assess hobo spider venom toxicity.

Science.gov (United States)

McKeown, Nathanael; Vetter, Richard S; Hendrickson, Robert G

2014-06-01

This study compiled 33 verified spider bites from the state of Oregon (USA). The initial goal was to amass a series of bites by the hobo spider to assess whether it possesses toxic venom, a supposition which is currently in a contested state. None of the 33 bites from several spider species developed significant medical symptoms nor did dermonecrosis occur. The most common biters were the yellow sac spider, Cheiracanthium mildei (N = 10) and orb-weavers of the genus Araneus (N = 6). There were 10 bites from three genera of funnel web spiders of the family Agelenidae including one hobo spider bite and one from the congeneric giant house spider which is readily confused as a hobo spider. The hobo spider bite resulted in pain, redness, twitching in the calf muscle and resolved in 12 h. Also generated from this study were possibly the first records of bites from spiders of the genera Callobius (Amaurobiidae) and Antrodiaetus (Antrodiaetidae), both with minor manifestations. Published by Elsevier Ltd.

Vision in the nocturnal wandering spider Leucorchestris arenicola (Araneae: Sparassidae)

DEFF Research Database (Denmark)

Nørgaard, Thomas; Nilsson, Dan-Eric; Henschel, Joh R

2008-01-01

At night the Namib Desert spider Leucorchestris arenicola performs long-distance homing across its sand dune habitat. By disabling all or pairs of the spiders' eight eyes we found that homing ability was severely reduced when vision was fully abolished. Vision, therefore, seems to play a key role...... in the posterior and anteriomedian eyes, and at approximately 540 nm in the anteriolateral eyes. Theoretical calculations of photon catches showed that the eyes are likely to employ a combination of spatial and temporal pooling in order to function at night. Under starlit conditions, the raw spatial and temporal...... resolution of the eyes is insufficient for detecting any visual information on structures in the landscape, and bright stars would be the only objects visible to the spiders. However, by summation in space and time, the spiders can rescue enough vision to detect coarse landscape structures. We show that L...

Funnel-web spider bite

Science.gov (United States)

... page: //medlineplus.gov/ency/article/002844.htm Funnel-web spider bite To use the sharing features on ... the effects of a bite from the funnel-web spider. Male funnel-web spiders are more poisonous ...

The African Crane Database (1978-2014): Records of three threatened crane species (Family: Gruidae) from southern and eastern Africa

Science.gov (United States)

Smith, Tanya; Page-Nicholson, Samantha; Gibbons, Bradley; Jones, M. Genevieve W.; van Niekerk, Mark; Botha, Bronwyn; Oliver, Kirsten; McCann, Kevin

2016-01-01

Abstract Background The International Crane Foundation (ICF) / Endangered Wildlife Trust’s (EWT) African Crane Conservation Programme has recorded 26 403 crane sightings in its database from 1978 to 2014. This sightings collection is currently ongoing and records are continuously added to the database by the EWT field staff, ICF/EWT Partnership staff, various partner organizations and private individuals. The dataset has two peak collection periods: 1994-1996 and 2008-2012. The dataset collection spans five African countries: Kenya, Rwanda, South Africa, Uganda and Zambia; 98% of the data were collected in South Africa. Georeferencing of the dataset was verified before publication of the data. The dataset contains data on three African crane species: Blue Crane Anthropoides paradiseus, Grey Crowned Crane Balearica regulorum and Wattled Crane Bugeranus carunculatus. The Blue and Wattled Cranes are classified by the IUCN Red List of Threatened Species as Vulnerable and the Grey Crowned Crane as Endangered. New information This is the single most comprehensive dataset published on African Crane species that adds new information about the distribution of these three threatened species. We hope this will further aid conservation authorities to monitor and protect these species. The dataset continues to grow and especially to expand in geographic coverage into new countries in Africa and new sites within countries. The dataset can be freely accessed through the Global Biodiversity Information Facility data portal. PMID:27956850

Tests for attraction to prey and predator avoidance by chemical cues in spiders of the beech forest floor

Directory of Open Access Journals (Sweden)

Wetter, Melissa B.

2012-07-01

Full Text Available Spiders leave draglines, faeces and other secretions behind when traveling through their microhabitat. The presence of these secretions may unintentionally inform other animals, prey as well as predators, about a recent and possible current predation risk or food availability. For a wolf spider, other spiders including smaller conspecifics, form a substantial part of their prey, and larger wolf spiders, again including conspecifics, are potential predators. We tested two hypotheses: that large wolf spiders may locate patches of potential spider prey through the presence of silk threads and/or other secretions; and that prey spiders may use secretions from large wolf spiders to avoid patches with high predation risk. We used large (subadult or adult Pardosa saltans to provide predator cues and mixed dwarf spiders or small (juvenile P. saltans to provide prey cues. Subadult wolf spiders were significantly attracted to litter contaminated by dwarf spiders or small conspecifics after 6 hours but no longer after 24 hours. In contrast, neither dwarf spiders nor small P. saltans showed significant avoidance of substrate contaminated by adult P. saltans. However, small P. saltans showed different activity patterns on the two substrates. The results indicate that wolf spiders are able to increase the efficiency of foraging by searching preferentially in patches with the presence of intraguild prey. The lack of a clear patch selection response of the prey in spite of a modified activity pattern may possibly be associated with the vertical stratification of the beech litter habitat: the reduced volume of spaces in the deeper layers could make downward rather than horizontal movement a fast and safe tactic against a large predator that cannot enter these spaces.

Spider Bites (For Parents)

Science.gov (United States)

... Videos for Educators Search English Español First Aid: Spider Bites KidsHealth / For Parents / First Aid: Spider Bites ... rare. Signs and Symptoms Of a brown recluse spider bite: red blister in the center with surrounding ...

Dynamic berth and quay crane allocation for multiple berth positions and quay cranes

NARCIS (Netherlands)

Tri Cahyono, Rully; Flonk, E.J.; Jayawardhana, Bayu

2015-01-01

We study in this paper a dynamic berth and quay cranes allocation strategy in general seaport container terminals. We develop a dynamical model that describes the operation of berthing process with multiple discrete berthing positions and multiple quay cranes. Based on the proposed model, we develop

Head stabilization in whooping cranes

Science.gov (United States)

Kinloch, M.R.; Cronin, T.W.; Olsen, Glenn H.; Chavez-Ramirez, Felipe

2005-01-01

The whooping crane (Grus americana) is the tallest bird in North America, yet not much is known about its visual ecology. How these birds overcome their unusual height to identify, locate, track, and capture prey items is not well understood. There have been many studies on head and eye stabilization in large wading birds (herons and egrets), but the pattern of head movement and stabilization during foraging is unclear. Patterns of head movement and stabilization during walking were examined in whooping cranes at Patuxent Wildlife Research Center, Laurel, Maryland USA. Four whooping cranes (1 male and 3 females) were videotaped for this study. All birds were already acclimated to the presence of people and to food rewards. Whooping cranes were videotaped using both digital and Hi-8 Sony video cameras (Sony Corporation, 7-35 Kitashinagawa, 6-Chome, Shinagawa-ku, Tokyo, Japan), placed on a tripod and set at bird height in the cranes' home pens. The cranes were videotaped repeatedly, at different locations in the pens and while walking (or running) at different speeds. Rewards (meal worms, smelt, crickets and corn) were used to entice the cranes to walk across the camera's view plane. The resulting videotape was analyzed at the University of Maryland at Baltimore County. Briefly, we used a computerized reduced graphic model of a crane superimposed over each frame of analyzed tape segments by means of a custom written program (T. W. Cronin, using C++) with the ability to combine video and computer graphic input. The speed of the birds in analyzed segments ranged from 0.30 m/s to 2.64 m/s, and the proportion of time the head was stabilized ranged from 79% to 0%, respectively. The speed at which the proportion reached 0% was 1.83 m/s. The analyses suggest that the proportion of time the head is stable decreases as speed of the bird increases. In all cases, birds were able to reach their target prey with little difficulty. Thus when cranes are walking searching for food

Flee or fight: ontogenetic changes in the behavior of cobweb spiders in encounters with spider-hunting wasps.

Science.gov (United States)

Uma, Divya B; Weiss, Martha R

2012-12-01

An animal's body size plays a predominant role in shaping its interspecific interactions, and, in encounters between two predators, often determines which shall be predator and which shall be prey. Spiders are top predators of insects, yet can fall prey to mud-dauber wasps that provision their larval nests with paralyzed spiders. Here we examined predator-prey interactions between Chalybion californicum (Saussure) (Sphecidae), a mud-dauber wasp, and Parasteatoda tepidariorum C. L. Koch (Theridiidae), a cobweb spider. We examined whether a spider's size influences its response to an attacking wasp, and report a size-dependent change in spider behavior: small-sized spiders fled, whereas medium- and large-sized spiders fought in response to wasp attacks. From the wasps' perspective, we examined whether spider size influences a wasp's hunting behavior and capture success. We found that wasps commonly approached small spiders, but were much less likely to approach medium and large spiders. However, wasp capture success did not vary with spider size. We also report a strategy used by Chalybion wasps toward cobweb spiders that is consistent with an interpretation of aggressive mimicry.

Crane and Excavator Operator.

Science.gov (United States)

Marine Corps Inst., Washington, DC.

Developed as part of the Marine Corps Institute (MCI) correspondence training program, this course on crane and excavator operation is designed to enable the crane and excavator operator to perform his/her duties more proficiently. Introductory materials include specific information for MCI students, a course introduction, and a study guide…

SPIDER SILK

Directory of Open Access Journals (Sweden)

PORAV Viorica

2014-05-01

Full Text Available The strengthness and toughness of spider fiber and its multifunctional nature is only surpassed in some cases by synthetic high performance fibers. In the world of natural fibers, spider silk has been long time recognized as a wonder fiber for its unique combination of high strength and rupture elongation. Scientists in civil military engineering reveal that the power of biological material (spider silk lies in the geometric configuration of structural protein, and the small cluster of week hydrogen bonds that works together to resist force and dissipate energy. Each spider and each type of silk has a set of mechanical properties optimized for their biological function. Most silks, in particular deagline silk, have exceptional mechanical properties. They exhibit a unique combination of high tensile strength and extensibility (ductility. This enables a silk fiber to absorb a lot of energy before breaking (toughness, the area under a stress- strain curve. A frequent mistake made in the mainstream media is to confuse strength and toughness when comparing silk to other materials. As shown below in detail, weight for weight, silk is stronger than steel, but not as strong as Kevlar. Silk is,however, tougher than both.This paper inform about overview on the today trend in the world of spider silk.

Molecular characterization of crane Coccidia, Eimeria gruis and E. reichenowi, found in feces of migratory cranes.

Science.gov (United States)

Matsubayashi, Makoto; Takami, Kazutoshi; Abe, Niichiro; Kimata, Isao; Tani, Hiroyuki; Sasai, Kazumi; Baba, Eiichiroh

2005-08-01

Eimeria gruis and E. reichenowi have lethal pathogenicity to a number of species of cranes. These parasites develop at multiple organs or tissues in infected cranes, thus lacking the specificity of infection sites shown by other Eimeria spp. in spite of morphologic similarity. To date, there have been many reports of crane Eimeria infections, however, genetic examinations of these parasites have never been published. In the present study, we isolated oocysts of E. gruis and E. reichenowi from crane feces at a wintering area in Japan. By phylogenic analysis, we first demonstrated that partial sequences of the isolates formed their own cluster, located separately from other Eimeria spp.

Cranes and Crops: Investigating Farmer Tolerances toward Crop Damage by Threatened Blue Cranes ( Anthropoides paradiseus) in the Western Cape, South Africa

Science.gov (United States)

van Velden, Julia L.; Smith, Tanya; Ryan, Peter G.

2016-12-01

The Western Cape population of Blue Cranes ( Anthropoides paradiseus) in South Africa is of great importance as the largest population throughout its range. However, Blue Cranes are strongly associated with agricultural lands in the Western Cape, and therefore may come into conflict with farmers who perceive them as damaging to crops. We investigated the viability of this population by exploring farmer attitudes toward crane damage in two regions of the Western Cape, the Swartland and Overberg, using semi-structured interviews. Perceptions of cranes differed widely between regions: farmers in the Swartland perceived crane flocks to be particularly damaging to the feed crop sweet lupin (65 % of farmers reported some level of damage by cranes), and 40 % of these farmers perceived cranes as more problematic than other common bird pests. Farmers in the Overberg did not perceive cranes as highly damaging, although there was concern about cranes eating feed at sheep troughs. Farmers who had experienced large flocks on their farms and farmers who ranked cranes as more problematic than other bird pests more often perceived cranes to be damaging to their livelihoods. Biographical variables and crop profiles could not be related to the perception of damage, indicating the complexity of this human-wildlife conflict. Farmers' need for management alternatives was related to the perceived severity of damage. These results highlight the need for location-specific management solutions to crop damage by cranes, and contribute to the management of this vulnerable species.

Bat Predation by Spiders

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (∼90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed. PMID:23516436

Bat predation by spiders.

Science.gov (United States)

Nyffeler, Martin; Knörnschild, Mirjam

2013-01-01

In this paper more than 50 incidences of bats being captured by spiders are reviewed. Bat-catching spiders have been reported from virtually every continent with the exception of Antarctica (≈ 90% of the incidences occurring in the warmer areas of the globe between latitude 30° N and 30° S). Most reports refer to the Neotropics (42% of observed incidences), Asia (28.8%), and Australia-Papua New Guinea (13.5%). Bat-catching spiders belong to the mygalomorph family Theraphosidae and the araneomorph families Nephilidae, Araneidae, and Sparassidae. In addition to this, an attack attempt by a large araneomorph hunting spider of the family Pisauridae on an immature bat was witnessed. Eighty-eight percent of the reported incidences of bat catches were attributable to web-building spiders and 12% to hunting spiders. Large tropical orb-weavers of the genera Nephila and Eriophora in particular have been observed catching bats in their huge, strong orb-webs (of up to 1.5 m diameter). The majority of identifiable captured bats were small aerial insectivorous bats, belonging to the families Vespertilionidae (64%) and Emballonuridae (22%) and usually being among the most common bat species in their respective geographic area. While in some instances bats entangled in spider webs may have died of exhaustion, starvation, dehydration, and/or hyperthermia (i.e., non-predation death), there were numerous other instances where spiders were seen actively attacking, killing, and eating the captured bats (i.e., predation). This evidence suggests that spider predation on flying vertebrates is more widespread than previously assumed.

Research on Multidisciplinary Optimization Design of Bridge Crane

Directory of Open Access Journals (Sweden)

Tong Yifei

2013-01-01

Full Text Available Bridge crane is one of the most widely used cranes in our country, which is indispensable equipment for material conveying in the modern production. In this paper, the framework of multidisciplinary optimization for bridge crane is proposed. The presented research on crane multidisciplinary design technology for energy saving includes three levels, respectively: metal structures level, transmission design level, and electrical system design level. The shape optimal mathematical model of the crane is established for shape optimization design of metal structure level as well as size optimal mathematical model and topology optimal mathematical model of crane for topology optimization design of metal structure level is established. Finally, system-level multidisciplinary energy-saving optimization design of bridge crane is further carried out with energy-saving transmission design results feedback to energy-saving optimization design of metal structure. The optimization results show that structural optimization design can reduce total mass of crane greatly by using the finite element analysis and multidisciplinary optimization technology premised on the design requirements of cranes such as stiffness and strength; thus, energy-saving design can be achieved.

Contamination Status of Seven Elements in Hooded Cranes Wintering in South-West Kyushu, Japan: Comparison with Red-Crowned Cranes in Hokkaido, Japan.

Science.gov (United States)

Teraoka, Hiroki; Miyagi, Hasumi; Haraguchi, Yuko; Takase, Kozo; Kitazawa, Takio; Noda, Jun

2018-05-31

The hooded crane is designated as an endangered species. The cranes breed primarily in wetlands in southeast Russia and China in summer. Most of the hooded crane population winters in the Izumi plain in Japan. It is difficult to know the contamination status of their habitat because of their vast breeding area. We determined the levels of Cd, Pb, As, (total) Hg, Se, Zn, and Cu in the liver, kidney, and muscle of hooded cranes that were found dead in Izumi in the periods 2003-2006 and 2014-2015 compared with the levels in red-crowned cranes in Hokkaido, Japan, as the only cranes in which these elements had been studied extensively. There were no notable differences between levels of the seven elements in the two periods. Overall, tissue levels of the elements examined in hooded cranes were comparable to those in red-crowned cranes except for Hg and Se. Tissue levels of Hg and Se were clearly lower in hooded cranes than in red-crowned cranes that were found dead from 2000. One lead poisoning case was confirmed. The results suggest that Hooded cranes wintering in Izumi are not extensively contaminated with the seven elements examined.

Stabilizer for seismically exposed bridge cranes

International Nuclear Information System (INIS)

Engelke, M.; Kuhr, H.

1982-01-01

The invention concerns a stabilizer for seismically exposed bridge cranes in reactor buildings. The trolley and the crane bridge are fitted with the stabilizer consisting of a bipartite safety catch which is connected with a joint and able to take up the vertical loads during an earthquake. This stabilizer is suitable for all kinds of bridge cranes operated in seismically active regions

Did You Say Spiders?

Science.gov (United States)

Campbell, Alene

This spider unit focuses on students' development of cooperative learning and inquiry-based skills. Students read "The Very Busy Spider" by Eric Carle, and then work in cooperative groups using the Internet to research and synthesize important information about spiders. Technology is used for vocabulary instruction and to create a…

Crane. Incidental Classroom Instruction 20295

Energy Technology Data Exchange (ETDEWEB)

Reynolds, Richard Jennings [Los Alamos National Laboratory

2016-04-01

The purpose of this course is to introduce safe hoisting and rigging practices to personnel who are attempting to become LANL incidental crane operators and to review and refresh safe hoisting and rigging practices with existing incidental crane operators.

Ant mimicry lessens predation on a North American jumping spider by larger salticid spiders.

Science.gov (United States)

Durkee, Caitlin A; Weiss, Martha R; Uma, Divya B

2011-10-01

Ant-like appearance (myrmecomorphy) has evolved >70 times in insects and spiders, accounting for >2,000 species of myrmecomorphic arthropods. Most myrmecomorphic spiders are considered to be Batesian mimics; that is, a palatable spider avoids predation through resemblance to an unpalatable ant-although this presumption has been tested in relatively few cases. Here we explicitly examined the extent to which Peckhamia picata (Salticidae), a North American ant-mimicking jumping spider, is protected from four species of jumping spider predators, relative to nonmimetic salticids and model ants. In addition, we conducted focused behavioral observations on one salticid predator, Thiodina puerpera, to determine the point at which the predators' behaviors toward model, mimic, and nonmimic diverge. We also examined the behaviors of Peckhamia in the presence of Thiodina. We found that mimetic jumping spiders were consumed less than a third as often as nonmimetic jumping spiders, suggesting that Peckhamia does indeed gain protection as a result of its resemblance to ants, and so can be considered a Batesian mimic. Furthermore, our focal predator did not consume any ant-mimicking spiders, and seemed to categorize Peckhamia with its model ant early in the hunting sequence. Such early determination of prey versus nonprey may be the result of speed-accuracy trade-offs in predator decision-making.

Black widow spider

Science.gov (United States)

... medlineplus.gov/ency/article/002858.htm Black widow spider To use the sharing features on this page, please enable JavaScript. The black widow spider (Latrodectus) has a shiny black body with a ...

Slewing Port Jib Cranes

Directory of Open Access Journals (Sweden)

Boris Visočnik

2002-09-01

Full Text Available The paper presents slewing port cra11es with a luffing jib.The advantages of slewing port jib cranes are high lifting capacities,high speeds of re-loading and excellent mobility since theyare capable of load lifting, travelling, luffing and slewing. Thepaper gives a detailed description of their characteristics suchas the highest reached load-canying capacities, speeds of motionand accelerations. It also presents the crane assembly,driving mechanisms, loads and load cases, transport by shipsand testing of lifting capacity. As a practical example the paperpresents the slewing port jib crane with the capacity of25!15!5 tat a 27/37/40 m radius made by the Slovenian companyMetalna Maribor for the shipyard 3. Maj, Rijeka, Croatia.

SPIDER: Probing the Early Universe with a Suborbital Polarimeter

Science.gov (United States)

Fraisse, Aurélien A.; SPIDER Collaboration

2012-01-01

SPIDER is a balloon-borne polarimeter designed to detect a divergence-free polarization pattern ("B-modes") in the Cosmic Microwave Background (CMB). In the inflationary scenario, the spectrum of the tensor perturbations that generate this signal is proportional to that of the primordial scalar perturbations through the tensor-to-scalar ratio r. The expected level of systematic error in the SPIDER instrument is significantly below the amplitude of an interesting cosmological B-mode signal with r=0.03. An optimized scanning strategy enables us to minimize uncertainty in the reconstruction of the Stokes parameters used to characterize the CMB, while providing access to a relatively wide range of angular scales. In the SPIDER field, the polarized emission from interstellar dust is as bright or brighter than the cosmological r=0.03 B-mode signal at all SPIDER frequencies (90, 150, and 280 GHz), a situation similar to that found in the "Southern Hole." Despite this foreground contamination, two 20-day flights of the SPIDER instrument will constrain the amplitude of the B-mode signal to rAPRA-NNX07AL64G), the National Science Foundation (ANT-1043515), the Gordon and Betty Moore Foundation, and the David and Lucile Packard Foundation. Support in Canada is provided by NSERC, the Canadian Space Agency, the Canada Foundation for Innovation, and CIFAR.

Control strategies for crane systems: A comprehensive review

Science.gov (United States)

Ramli, Liyana; Mohamed, Z.; Abdullahi, Auwalu M.; Jaafar, H. I.; Lazim, Izzuddin M.

2017-10-01

Crane systems are tremendously utilised in numerous heavy load transportation industries, and therefore, the control of crane systems is a well-established research field. As the last review paper was published more than a decade ago, there is a lack of collected and organised information regarding the latest and the newest updates on control strategies for crane control systems. Hence, this paper presents a comprehensive review of crane control strategies discussing the latest research works during the years from 2000 to 2016. Various crane types and control issues are highlighted, followed by the main focus of this paper, an extensive review of the control schemes for diverse types of crane systems that have been carried out in the 21st century. A brief review on modelling of single-pendulum and double-pendulum crane systems is also given. In addition, anti-sway control systems for industrial cranes that are available on the market is described. This paper summarises most of the related work and also pays a special focus on research trends regarding the control of crane systems that have been previously published in the literature. It is envisaged that this review paper will be helpful to new researchers when identifying research directions for this particular area of interest.

A mathematical model for optimal tower crane layout planning

Directory of Open Access Journals (Sweden)

Mojtaba Hosseini

2017-09-01

Full Text Available Tower cranes, on today’s typical building construction sites, are the centerpiece of production, hoisting and transporting of a variety of loads. Due to a simple crane limited capacity; there is an urgent need to use high capacity cranes such as tower cranes. However, we have to select an appropriate type of cranes to be utilized to reduce the associated coste as much as possible. In this research, we propose a method to select the suitable type of crane and locate the best place for crane erection based on a minimum radius for requested crane and minimum cost. To fulfill the target, a computer program is designed to numerate these problems, demonstrating an example explaining how to apply the program and the results are discussed.

Crane allocation with stability considerations

NARCIS (Netherlands)

Ursavas, Evrim

Crane planning in a container terminal is a major concern for terminal operators. Crane scheduling has an enormous impact on port efficiency and profitability, and these activities have, therefore, received high priority from terminal managers and researchers. Owing to the complex structure of the

What you fear will appear: detection of schematic spiders in spider fear.

Science.gov (United States)

Peira, Nathalie; Golkar, Armita; Larsson, Maria; Wiens, Stefan

2010-01-01

Various experimental tasks suggest that fear guides attention. However, because these tasks often lack ecological validity, it is unclear to what extent results from these tasks can be generalized to real-life situations. In change detection tasks, a brief interruption of the visual input (i.e., a blank interval or a scene cut) often results in undetected changes in the scene. This setup resembles real-life viewing behavior and is used here to increase ecological validity of the attentional task without compromising control over the stimuli presented. Spider-fearful and nonfearful women detected schematic spiders and flowers that were added to one of two identical background pictures that alternated with a brief blank in between them (i.e., flicker paradigm). Results showed that spider-fearful women detected spiders (but not flowers) faster than did nonfearful women. Because spiders and flowers had similar low-level features, these findings suggest that fear guides attention on the basis of object features rather than simple low-level features.

DEVELOPMENT OF METHODS FOR STABILITY ANALYSIS OF TOWER CRANES

Directory of Open Access Journals (Sweden)

Sinel'shchikov Aleksey Vladimirovich

2018-01-01

Full Text Available Tower cranes are one of the main tools for execution of reloading works during construction. Design of tower cranes is carried out in accordance with RD 22-166-86 “Construction of tower cranes. Rules of analysis”, according to which to ensure stability it is required not to exceed the overturning moment upper limit. The calculation of these moments is carried out with the use of empirical coefficients and quite time-consuming. Moreover, normative methodology only considers the static position of the crane and does not take into account the presence of dynamic transients due to crane functioning (lifting and swinging of the load, boom turning and the presence of the dynamic external load (e.g. from wind for different orientations of the crane. This paper proposes a method of determining the stability coefficient of the crane based on acting reaction forces at the support points - the points of contact of wheels with the crane rail track, which allows us, at the design stage, to investigate stability of tower crane under variable external loads and operating conditions. Subject: the safety of tower cranes operation with regard to compliance with regulatory requirements of ensuring their stability both at the design stage and at the operational stage. Research objectives: increasing the safety of operation of tower cranes on the basis of improving methodology of their design to ensure static and dynamic stability. Materials and methods: analysis and synthesis of the regulatory framework and modern research works on provision of safe operation of tower cranes, the method of numerical simulation. Results: we proposed the formula for analysis of stability of tower cranes using the resulting reaction forces at the supports of the crane at the point of contact of the wheel with the rail track.

Brown Recluse Spider

Science.gov (United States)

... to a group of spiders commonly known as violin spiders or fiddlebacks. The characteristic fiddle-shaped pattern ... 4-19.1mm) • Color: Golden brown • A dark violin/fiddle shape (see top photo) is located on ...

Dynamics three-tier hydraulic crane-manipulators

OpenAIRE

Lagerev I.A.; Lagerev A.V.

2018-01-01

The methods and generalized recommendations for modeling dynamic loading of load-bearing elements of steel structures of three-tier hydraulic cranes-manipulators are considered. Mathematical models have been developed to study the dynamics of moving elements of the crane-manipulator, the movement of the load-lifting machine on a stochastic uneven surface with a suspended load. The presented approaches can be used to calculate other types of jib cranes equipped with hydraulic drive.

Study on earthquake responses of overhead traveling cranes

International Nuclear Information System (INIS)

Komori, A.; Fukuda, T.; Veki, T.; Kirata, M.; Hoshii, T.; Kashiwazaki, A.

1989-01-01

In nuclear power plants, large-size overhead traveling cranes, such as reactor building crane and turbine building crane, are installed. These overhead cranes are used for transporting heavy loads on the operation floor, and call for safety and reliability even during strong earthquake as well as under the normal operational conditions. The seismic behaviors of overhead traveling cranes, which move on the rails, may be different from those of other structures that are anchored to the building: in the case of cranes, traveling wheels and rails can slip relative to each other when the horizontal seismic force reaches the level of frictional force. In Japan, therefore, a practical guide to the seismic design that considers the sliding has been proposed. However, detailed experimental study on sliding between wheels and rails has not been carried out. In this study, the seismic behaviors of traveling overhead cranes accompanied by sliding between wheels and rails in the traveling direction are examined

46 CFR 109.437 - Crane record book.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Crane record book. 109.437 Section 109.437 Shipping... Reports, Notifications, and Records Records § 109.437 Crane record book. The master or person in charge shall ensure that the following are maintained in a crane record book: (a) Descriptive information which...

Stable isotopes of Hawaiian spiders reflect substrate properties along a chronosequence

Science.gov (United States)

Dawson, Todd E.; Gillespie, Rosemary G.

2018-01-01

The Hawaiian Islands offer a unique opportunity to test how changes in the properties of an isolated ecosystem are propagated through the organisms that occur within that ecosystem. The age-structured arrangement of volcanic-derived substrates follows a regular progression over space and, by inference, time. We test how well documented successional changes in soil chemistry and associated vegetation are reflected in organisms at higher trophic levels—specifically, predatory arthropods (spiders)—across a range of functional groups. We focus on three separate spider lineages: one that builds capture webs, one that hunts actively, and one that specializes on eating other spiders. We analyze spiders from three sites across the Hawaiian chronosequence with substrate ages ranging from 200 to 20,000 years. To measure the extent to which chemical signatures of terrestrial substrates are propagated through higher trophic levels, we use standard stable isotope analyses of nitrogen and carbon, with plant leaves included as a baseline. The target taxa show the expected shift in isotope ratios of δ15N with trophic level, from plants to cursorial spiders to web-builders to spider eaters. Remarkably, organisms at all trophic levels also precisely reflect the successional changes in the soil stoichiometry of the island chronosequence, demonstrating how the biogeochemistry of the entire food web is determined by ecosystem succession of the substrates on which the organisms have evolved. PMID:29576984

Host–parasite behavioral interactions in a recently introduced, whooping crane population

Science.gov (United States)

King, Richard S.; McKann, Patrick C.; Gray, Brian R.; Putnam, Michael S.

2015-01-01

The whooping crane Grus americana has a long conservation history, but despite multiple attempts across North America, introduction success is lacking. Recently introduced, captively reared whooping cranes have had periods of poor reproductive performance in central Wisconsin that sometimes coincided with black fly (Diptera: Simuliidae) emergences. Sandhill crane Grus canadensis reproductive performance in central Wisconsin is approximately double that of whooping cranes. We used comfort behaviors as a measure of black fly harassment to infer whether behavioral differences existed between nesting sandhill cranes and nesting whooping cranes and between successful and unsuccessful whooping crane pairs. To further explore the interaction between black flies and incubating whooping cranes, we examined differences in behaviors between incubating birds and their off-nest mates. Compared to their off-nest mates, incubating whooping cranes exhibited elevated comfort behaviors, suggesting a bird at a nest may experience greater harassment from black flies. Sandhill cranes had elevated head-flicks over whooping cranes. Whooping cranes exhibited more head-rubs than sandhill cranes, and successful whooping crane pairs had elevated head-rubs over pairs that deserted their nests. Behavioral differences between sandhill cranes and whooping cranes as well as differences in reproductive performance, could be explained by exposure to local breeding conditions. Whereas sandhill cranes have nested in the area for hundreds, if not thousands, of years, whooping cranes were only recently introduced to the area. Behavioral differences between the species as well as those between successful and unsuccessful whooping crane pairs could also be explained by the effect of captive exposure, which could affect all whooping crane introductions.

Polar crane

International Nuclear Information System (INIS)

Makosinski, S.

1981-01-01

In many applications polar cranes have to be repeatedly positioned with high accuracy. A guidance system is disclosed which has two pairs of guides. Each guide consists of two rollers carried by a sheave rotatable mounted on the crane bridge, the rollers being locatable one on each side of a guideway, e.g. the circular track on which the bridge runs. The pairs of guides are interconnected by respective rope loops which pass around and are locked to the respective pairs of sheaves in such a manner that movement of one guide results in equal movement of the other guide in a sense to maintain the repeatability of positioning of the centre of the bridge. A hydraulically-linked guide system is also described. (author)

Use of ultralight aircraft for introducing migratory crane populations

Science.gov (United States)

Clegg, K.R.; Lewis, J.C.; Ellis, D.H.; Urbanek, Richard P.; Stahlecker, Dale

1997-01-01

Objectives were to determine if captive-reared cranes could be led behind an ultralight aircraft (UL) along a migration route and, if after release on a wintering area, they would integrate with wild cranes and migrate north in spring to their natal area without assistance. Greater sandhill cranes (Grus canadensis tabida) were used as the research surrogate for whooping cranes (Grus americana). In 1995, the senior author raised 15 cranes to fledging and trained them to respond to his vocal imitation of a sandhill crane brood call. Chicks learned to follow him as he walked, drove an all-terrain vehicle (ATV), or piloted an UL. The caretakers were not in crane costumes. Cranes were tame but allowed to roam at will without accompanying humans part of the day and were penned at night. Daily excursions provided exposure to habitats, foods, and predators the birds would encounter after release into the wild. In mid-October 1995, 11 radio-tagged cranes were led in migration from Grade, Idaho to Bosque del Apache National Wildlife Refuge (BdANWR), central New Mexico, and released near wild wintering sandhill cranes. The 1,204km migration took 11 days, including 1 day when the aircraft were grounded due to a winter storm. Hazards encountered enroute included mountainous terrain, turbulent air, and attacks by gold eagles (Aquila chrysaetos). On the wintering ground, hazards included crane hunters and coyotes (Canis latrans). Within 2 days after release at the BdANWR wintering site, the research cranes were associating with and imitating the behavior of wild cranes. The 4 surviving birds migrated north in spring 1996 and at the time of this writing 2 were within 53 km of their natal area in Idaho.

Seismic requalification of a safety class crane

International Nuclear Information System (INIS)

Wu, Ting-shu; Moran, T.J.

1991-01-01

A remotely operated 5-ton crane within a nuclear fuel handling facility was designed and constructed over 25 years ago. At that time, less severe design criteria, particularly on seismic loadings, were in use. This crane is being reactivated and requalified under new design criteria with loads including a site specific design basis earthquake. Detailed analyses of the crane show that the maximum stress coefficient is less than 90% of the code allowable, indicating that this existing crane is able to withstand loadings including those from the design basis earthquake. 3 refs., 8 figs., 2 tabs

THE EXECUTION OF PLANNED DETOURS BY SPIDER-EATING PREDATORS

Science.gov (United States)

Cross, Fiona R.; Jackson, Robert R.

2016-01-01

Many spiders from the salticid subfamily Spartaeinae specialize at preying on other spiders and they adopt complex strategies when targeting these dangerous prey. We tested 15 of these spider-eating spartaeine species for the capacity to plan detours ahead of time. Each trial began with the test subject on top of a tower from which it could view two boxes: one containing prey and the other not containing prey. The distance between the tower and the boxes was too far to reach by leaping and the tower sat on a platform surrounded by water. As the species studied are known to avoid water, the only way they could reach the prey without getting wet was by taking one of two circuitous walkways from the platform: one leading to the prey (‘correct’) and one not leading to the prey (‘incorrect’). After leaving the tower, the test subject could not see the prey and sometimes it had to walk past the incorrect walkway before reaching the correct walkway. Yet all 15 species chose the correct walkway significantly more often than the incorrect walkway. We propose that these findings exemplify genuine cognition based on representation. PMID:26781057

Book review: Sandhill and whooping cranes: Ancient voices over America's wetlands

Science.gov (United States)

Austin, Jane E.

2011-01-01

Paul Johnsgard has long been captivated by wild cranes and their unique vocalizations, courtship dances, and wide-ranging migrations. As a scientist and an admirer, Johnsgard has watched their migrations and behaviors for decades as hundreds of thousands of cranes staged each spring by the central Platte River, not far from his home in Lincoln, Nebraska. As an artist, he has skilfully captured their courtship dances and other behaviours in his exceptional line drawings. And, as an author, he has written extensively on their ecology in three earlier books: Cranes of the World (1983), Those of the Gray Wind: the Sandhill Crane (1986), and Crane Music: a Natural History of Cranes (1991). Much has happened relative to North American cranes in the 20 years since Johnsgard published Crane Music, including increased crane abundance in many areas and the completion of multiple studies on crane ecology and conservation. This new crane book serves as an update to Crane Music and provides the reader with many useful resources for observing and learning about cranes.

On the Colours of Spider Orb-Webs

Science.gov (United States)

Suhr, Wilfried; Schlichting, H. Joachim

2011-01-01

A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for…

A new crane for the LHC magnets

CERN Multimedia

2002-01-01

Last Friday CERN took delivery of the new crane that will be used for handling the LHC magnets. CERN took delivery of its new telescopic mobile crane on Friday, 22 February. It underwent its first operating tests, which consisted of lifting a 37-tonne concrete block. Five drive-steer axles, two engines with a capacity of 544 and 203 hp respectively, a telescopic boom with a 60-metre reach and a lifting capacity of 160 tonnes at 3 metres: these are the impressive characteristics of CERN's new 160-tonne crane. And the handling of the LHC magnets, each weighing a 'trifling' 33 tonnes, demands no less than this. The new crane will be required to load the magnets made in Building SM18 onto a trailer that will take them to the Prévessin site, where they will be put in storage until they can be lowered into the tunnel. The telescopic mobile crane arrived at CERN last Friday and has passed its first operating tests with flying colours. Until now, CERN had two cranes, with a maximum capacity of 40 and 60...

Distribution and migration chronology of Eastern population sandhill cranes

Science.gov (United States)

Fronczak, David L.; Andersen, David; Hanna, Everett E.; Cooper, Thomas R.

2017-01-01

The Eastern Population (EP) of greater sandhill cranes (Antigone canadensis tabida; cranes) is expanding in size and geographic range. Little information exists regarding the geographic extent of breeding, migration, and wintering ranges, migration chronology, or use of staging areas for cranes in the EP. To obtain these data, we attached solar global positioning system (GPS) platform transmitting terminals (PTTs) to 42 sandhill cranes and monitored daily locations from December 2009 through August 2014. On average, tagged cranes settled in summer areas during late‐March in Minnesota (7%), Wisconsin (29%), Michigan, USA (21%), and Ontario, Canada (38%) and arrived at their winter terminus beginning mid‐December in Indiana (15%), Kentucky (3%), Tennessee (45%), Georgia (5%), and Florida (32%). Cranes initiated spring migration beginning mid‐February to their respective summer areas on routes similar to those used during fall migration. Twenty‐five marked cranes returned to the same summer area after a second spring migration, of which 19 (76%) settled cranes in the EP, we estimated that approximately 29–31% of cranes that summered in both Wisconsin and the Lower Peninsula of Michigan were not in areas included in the survey. The information we collected on crane movements provides insight into distribution and migration chronology that will aid in assessment of the current USFWS fall survey. In addition, information on specific use sites can assist state and federal managers to identify and protect key staging and winter areas particularly during current and future recreational harvest seasons.

30 CFR 56.16014 - Operator-carrying overhead cranes.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Operator-carrying overhead cranes. 56.16014 Section 56.16014 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND... Storage and Handling § 56.16014 Operator-carrying overhead cranes. Operator-carrying overhead cranes shall...

30 CFR 57.16014 - Operator-carrying overhead cranes.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Operator-carrying overhead cranes. 57.16014 Section 57.16014 Mineral Resources MINE SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR METAL AND... Storage and Handling § 57.16014 Operator-carrying overhead cranes. Operator-carrying overhead cranes shall...

Nature Study Tips. Spiders.

Science.gov (United States)

Mulaik, Stanley B.

1990-01-01

Different types of spiders, their ranges and habits are discussed. Activities associated with the study of spiders are suggested. Four references are listed which may be of interest to beginners. (CW)

Efficacy of eastern equine encephalitis immunization in whooping cranes.

Science.gov (United States)

Olsen, G H; Turell, M J; Pagac, B B

1997-04-01

An epizootic of eastern equine encephalitis (EEE) at the Patuxent Wildlife Research Center (PWRC), Laurel, Maryland (USA), in 1989 provided an opportunity to determine if EEE immunization protected whooping cranes (Grus americana). Based on seroconversion of 31% of sympatric hatch-year sandhill cranes, Grus canadensis, and a previous 35% case fatality rate in whooping cranes, 17 (37%) of the 46 susceptible whooping cranes should have been exposed to virus and six should have died. As there were no deaths in these birds, the EEE vaccination program appeared to be efficacious in this whooping crane population.

The evolution of sociality in spiders

DEFF Research Database (Denmark)

Lubin, Yael; Bilde, T.

2007-01-01

. Anelosimus (Theridiidae) C. Sociality in Spiders: An Evolutionary Dead End? V. Evolution and Maintenance of Sociality in Spiders: Relevant Models A. Kin Selection 1. Kin Recognition 2. Inbreeding and Kin Selection B. Multilevel Selection (Group Selection) C. Ecological Benefits D. Ecological Constraints E......I. Introducing Social Spiders II. Social and Subsocial Species: A Survey of Behavioral Traits III. Inbred Sociality in Spiders A. Cooperation Versus Competition: A Balancing Act B. Do Social Spiders Have Division of Labor? C. Colony Foundation: Propagule Dispersal Versus Fission D. Female......-Biased Colony Sex Ratios: Primary and Operational Sex Ratios E. Mating System: Inbreeding and Its Population-Genetic Consequences F. "Boom and Bust" Colony Dynamics IV. Phylogenetic Relationships Among Social Spider Species A. Common Features of Social Evolution B. Case Studies 1. Stegodyphus (Eresidae) 2...

The bile acid composition of crane gallbladder bile

Science.gov (United States)

Serafin, J.A.

1983-01-01

1. The biliary bile acids of the whooping crane (Grus americana) and the Florida sandhill crane (G. canadensis pratensis) have been examined.2. Cholic acid (CA), chenodeoxycholic acid (CDOCA) and lithocholic acid were found in bile from both species of these North American cranes.3. CDOCA and CA were the primary bile acids in both species, together constituting 70% or more of the bile acids by weight.4. The primary bile acids of cranes appear to be the same as those that have been identified in other avian species.

Non-webbuilding spiders: prey specialists or generalists?

Science.gov (United States)

Nentwig, Wolfgang

1986-07-01

Feeding experiments were performed with seven species of non-webbuilding spiders and a variety of prey taxa. Some species were generally polyphagous whereas other spiders restricted their prey to a few groups. At one end of the spectrum of prey specialization the thomisid Misumena vatia is limited to a few taxa of possible prey (Table 1). The literature of prey records of non-webbuilding spiders is reviewed (Table 2) with special emphasis on oligophagous or monophagous spiders. Monophagous spiders are generally rare and have specialized on only a few prey taxa: social insects (ants, bees, termites) and spiders.

Timing of spring surveys for midcontinent sandhill cranes

Science.gov (United States)

Pearse, Aaron T.; Krapu, Gary L.; Brandt, David A.; Sargeant, Glen A.

2015-01-01

The U.S. Fish and Wildlife Service has used spring aerial surveys to estimate numbers of migrating sandhill cranes (Grus canadensis) staging in the Platte River Valley of Nebraska, USA. Resulting estimates index the abundance of the midcontinent sandhill crane population and inform harvest management decisions. However, annual changes in the index have exceeded biologically plausible changes in population size (>50% of surveys between 1982 and 2013 indicate >±20% change), raising questions about nuisance variation due to factors such as migration chronology. We used locations of cranes marked with very-high-frequency transmitters to estimate migration chronology (i.e., proportions of cranes present within the Platte River Valley). We also used roadside surveys to determine the percentage of cranes staging at the Platte River Valley but outside of the survey area when surveys occur. During March 2001–2007, an average of 86% (71–94%; SD = 7%) of marked cranes were present along the Platte River during scheduled survey dates, and 0–11% of cranes that were present along the Platte River were not within the survey boundaries. Timing of the annual survey generally corresponded with presence of the greatest proportion of marked cranes and with least inter-annual variation; consequently, accuracy of estimates could not have been improved by surveying on different dates. Conducting the survey earlier would miss birds not yet arriving at the staging site; whereas, a later date would occur at a time when a larger portion of birds may have already departed the staging site and when a greater proportion of birds occurred outside of the surveyed area. Index values used to monitor midcontinent sandhill crane abundance vary annually, in part, due to annual variation in migration chronology and to spatial distribution of cranes in the Platte River Valley; therefore, managers should interpret survey results cautiously, with awareness of a continuing need to identify and

Simulation of fatigue damagesin secondary truss of crane

Directory of Open Access Journals (Sweden)

Eremin Konstantin Ivanovich

2014-02-01

Full Text Available Basing on the damaging statistics obtained during the on-site inspections of industrial multi-span building structures with under-crane secondary trusses which have continuous lower plinth, we simulated the scenario of the most likely damage development of under-crane secondary trusses.The first scenario is the development of cracks along the total cross section of plinth. In the process of calculations we defined a real deformation scheme of plinth of under-crane secondary trusses with damage and its stress condition.The second scenario is the destruction of a support or support mounting unit to the lower plinth of under-crane secondary trusses. The destruction of this kind can occur as a result of a crack in a support or as a result of destruction of high-strength fasteners of a support to plinth. We discovered that a system with such damage is geometrically unchanged; there is no possibility of sudden destruction of both the under-crane secondary trusses and the entire building frame.The third scenario is the upper plinth separation from one of the walls of lower plinth of under-crane secondary trusses.The scenario is developed to define the viability of under-crane secondary trusses as a result of cracks in the area of wall junction with the upper shelf of lower plinth, their further development and the appearance of discrete cracks developing into a backbone along the entire span length of under-crane secondary trusses.Based on the calculations of the stress strain state of under-crane secondary trusses with damages in the emergency nature in a separate span of the lower plinth and a truss member, we estimated the viability of structure. The analysis of viability limits makes it possible to find the measures of collapse preventing and avoid possible victims.

Motion control of a gantry crane with a container

Science.gov (United States)

Shugailo, T. S.; Yushkov, M. P.

2018-05-01

The transportation of a container by a gantry crane in a given time from one point of space to another is considered. The system is at rest at the end of the motion. A maximum admissible speed is taken into account. The control force is found using either the Pontryagin maximum principle or the generalized Gauss principle. The advantages of the second method over the first one is demonstrated.

Remembering the object you fear: brain potentials during recognition of spiders in spider-fearful individuals.

Science.gov (United States)

Michalowski, Jaroslaw M; Weymar, Mathias; Hamm, Alfons O

2014-01-01

In the present study we investigated long-term memory for unpleasant, neutral and spider pictures in 15 spider-fearful and 15 non-fearful control individuals using behavioral and electrophysiological measures. During the initial (incidental) encoding, pictures were passively viewed in three separate blocks and were subsequently rated for valence and arousal. A recognition memory task was performed one week later in which old and new unpleasant, neutral and spider pictures were presented. Replicating previous results, we found enhanced memory performance and higher confidence ratings for unpleasant when compared to neutral materials in both animal fearful individuals and controls. When compared to controls high animal fearful individuals also showed a tendency towards better memory accuracy and significantly higher confidence during recognition of spider pictures, suggesting that memory of objects prompting specific fear is also facilitated in fearful individuals. In line, spider-fearful but not control participants responded with larger ERP positivity for correctly recognized old when compared to correctly rejected new spider pictures, thus showing the same effects in the neural signature of emotional memory for feared objects that were already discovered for other emotional materials. The increased fear memory for phobic materials observed in the present study in spider-fearful individuals might result in an enhanced fear response and reinforce negative beliefs aggravating anxiety symptomatology and hindering recovery.

Science Education Resources on the Web--Spiders.

Science.gov (United States)

Thirunarayanan, M. O.

1997-01-01

Lists Web sites containing information on spiders and offers brief descriptions of the information available at those sites. The 11 sites provide information on taxonomy of spiders, anatomy, different ways spiders use silk, Internet mailing lists, folk literature and art, bibliographies, night collection, and spiders commonly found in the state of…

Isolation of a sex-linked DNA sequence in cranes.

Science.gov (United States)

Duan, W; Fuerst, P A

2001-01-01

A female-specific DNA fragment (CSL-W; crane sex-linked DNA on W chromosome) was cloned from female whooping cranes (Grus americana). From the nucleotide sequence of CSL-W, a set of polymerase chain reaction (PCR) primers was identified which amplify a 227-230 bp female-specific fragment from all existing crane species and some other noncrane species. A duplicated versions of the DNA segment, which is found to have a larger size (231-235 bp) than CSL-W in both sexes, was also identified, and was designated CSL-NW (crane sex-linked DNA on non-W chromosome). The nucleotide similarity between the sequences of CSL-W and CSL-NW from whooping cranes was 86.3%. The CSL primers do not amplify any sequence from mammalian DNA, limiting the potential for contamination from human sources. Using the CSL primers in combination with a quick DNA extraction method allows the noninvasive identification of crane gender in less than 10 h. A test of the methodology was carried out on fully developed body feathers from 18 captive cranes and resulted in 100% successful identification.

Development of remote crane system for use inside small argon hot-cell

Energy Technology Data Exchange (ETDEWEB)

Lee, Jong Kwang; Park, Byung Suk; Yu, Seung-Nam; Kim, Kiho; Cho, Ilje [Nuclear Fuel Cycle Process Technology Development Division, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

2013-07-01

In this paper, we describe the design of a novel crane system for the use in a small argon hot-cell where only a pair of master-slave manipulators (MSM) is available for the remote maintenance of the crane. To increase the remote maintainability in the space-limited environment, we devised a remote actuation mechanism in which electrical parts consisting of a servo-motor, a position sensor, and two limit switches located inside the workspace of the MSM transmit power to the mechanical parts located in the ceiling. Even though the design concept does not provide thoroughly sufficient solution because the mechanical parts are placed out of the MSM's workspace, the durability of mechanical parts can be easily increased if they have a high safety margin. Therefore, the concept may be one of the best solutions for our special crane system. In addition, we developed a servo-control system based on absolute positioning technology; therefore, it is possible for us to perform the given tasks more safely through an automatic operation. (authors)

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

Energy Technology Data Exchange (ETDEWEB)

Akamatsu, Fumikazu, E-mail: f-akamt55@pwri.go.jp [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan); Toda, Hideshige [Department of Environmental Sciences, Shinshu University, 3-1-1 Asahi, Matsumoto, Nagano 390-8621 (Japan)

2011-05-15

Stable nitrogen isotopic composition ({delta}{sup 15}N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in {delta}{sup 15}N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider {delta}{sup 15}N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: > {delta}{sup 15}N of aquatic insects increases downstream with anthropogenic nitrogen inputs. > {delta}{sup 15}N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. > The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Aquatic subsidies transport anthropogenic nitrogen to riparian spiders

International Nuclear Information System (INIS)

Akamatsu, Fumikazu; Toda, Hideshige

2011-01-01

Stable nitrogen isotopic composition (δ 15 N) of aquatic biota increases with anthropogenic N inputs such as sewage and livestock waste downstream. Increase in δ 15 N of riparian spiders downstream may reflect the anthropogenic pollution exposure through predation on aquatic insects. A two-source mixing model based on stable carbon isotopic composition showed the greatest dependence on aquatic insects (84%) by horizontal web-building spiders, followed by intermediate (48%) and low (31%) dependence by cursorial and vertical web-building spiders, respectively. The spider body size was negatively correlated with the dietary proportion of aquatic insects and spider δ 15 N. The aquatic subsidies transported anthropogenic N to smaller riparian spiders downstream. This transport of anthropogenic N was regulated by spider's guild designation and body size. - Highlights: → δ 15 N of aquatic insects increases downstream with anthropogenic nitrogen inputs. → δ 15 N of riparian spiders increases with a high dietary proportion of aquatic insects and smaller spider body size. → The aquatic subsidies transport anthropogenic nitrogen to smaller riparian spiders downstream. - Smaller spiders assimilate anthropogenic nitrogen through the predation on aquatic subsides.

Radiation effect onto biodiversity of spiders

International Nuclear Information System (INIS)

Mehrabova, M.A.; Naghiyev, J.A; Huseynov, N.I; Topchiyeva, Sh.A.; Hasanov, N.H.

2010-01-01

At present time spiders are one of the considerably diverse groups of living organisms in fauna of Azerbayjan Republic. They play an important in environmental chain, being the main group of wild arthropodas in most biocoenoses. Therefore, it's not surprised that recently an increased interest has being observed to the study of spiders as indicators of environmental conditions. Spiders have been collected in polluted areas, their identification and sampling of soil, water and plants has been conducted. The degree of radionuclides' impact on the number and distribution of spiders and their venom in the observed zones of Azerbaijan has been revealed and preliminarily predicted. The number of the collected spiders equals to 292 which has been determined later at an electronic identifier Spinnen Mitteleuropas. The radionuclides in spiders have been determined at Canberra facility. Different natural radioactive elements were revealed in the investigated samples.

Uplifting : mobile cranes and picker trucks get higher, stronger, and safer

Energy Technology Data Exchange (ETDEWEB)

Budd, G.

2008-10-15

New crane and picker truck equipment designed for use in the oil and gas industry was discussed in this article. The longest crane in the North America is due to arrive in Calgary soon. Mobile cranes are often used for maintenance, construction, and shutdowns at natural gas plants, refineries, and oil batteries. Telescopic cranes are also used to service pump jacks and lift rolls of coiled tubing into place on drilling rigs. While cranes carry more weight, picker trucks are more mobile and flexible. Lattice boom crawler cranes were designed to pick up loads and carry them to different positions. Telescopic cranes must remain stationary, and careful planning is needed to ensure that they are used efficiently. Modern telescopic cranes have hydraulically powered booms. Advanced steel alloy technology is used to produce lightweight booms equipped with automated pin-locking mechanisms. The largest telescopic crane in North America will be used by an oil and gas operator in Alberta. The crane will have a combined boom and lattice jib height of 226 meters, and its maximum lifting capacity is 1200 tonnes. Gantry cranes are also increasingly being used by oil and gas operators due to their ability to straddle loads, thereby reducing the risk of tipping. It was concluded that gantry cranes are particularly suitable for rougher terrains. 4 figs.

Crane Scheduling on a Plate Storage

DEFF Research Database (Denmark)

Hansen, Jesper

2002-01-01

OSS produces the worlds largest container ships. The first process of producing the steel ships is handling arrival and storage of steel plates until they are needed in production. Two gantry cranes carry out this task. The planning task is now to create a schedule of movements for the 2 cranes...

Simulation of control drives in a tower crane

Directory of Open Access Journals (Sweden)

Wojciech SOLARZ

2011-01-01

Full Text Available The design of a control system for a tower crane is investigated. Underlying the controller design is the theory of optimal linear control. Computer models of a crane and the control systems for the crane drives are developed. Simulation data reveals that the motion of the load can be effectively controlled so that it should follow a predetermined trajectory.

Energetics, scaling and sexual size dimorphism of spiders.

Science.gov (United States)

Grossi, B; Canals, M

2015-03-01

The extreme sexual size dimorphism in spiders has motivated studies for many years. In many species the male can be very small relative to the female. There are several hypotheses trying to explain this fact, most of them emphasizing the role of energy in determining spider size. The aim of this paper is to review the role of energy in sexual size dimorphism of spiders, even for those spiders that do not necessarily live in high foliage, using physical and allometric principles. Here we propose that the cost of transport or equivalently energy expenditure and the speed are traits under selection pressure in male spiders, favoring those of smaller size to reduce travel costs. The morphology of the spiders responds to these selective forces depending upon the lifestyle of the spiders. Climbing and bridging spiders must overcome the force of gravity. If bridging allows faster dispersal, small males would have a selective advantage by enjoying more mating opportunities. In wandering spiders with low population density and as a consequence few male-male interactions, high speed and low energy expenditure or cost of transport should be favored by natural selection. Pendulum mechanics show the advantages of long legs in spiders and their relationship with high speed, even in climbing and bridging spiders. Thus small size, compensated by long legs should be the expected morphology for a fast and mobile male spider.

Fecal corticosterone reflects serum corticosterone in Florida sandhill cranes.

Science.gov (United States)

Ludders, J W; Langenberg, J A; Czekala, N M; Erb, H N

2001-07-01

Florida sandhill cranes (Grus canadensis pratensis) were conditioned to confinement 6 hr/day for 7 days. On day 8, each bird's jugular vein was catheterized, blood samples were drawn, and each crane was confined for 6 hr. Using a randomized, restricted cross-over design, cranes were injected intravenously with either 0.9% NaCl solution or ACTH (cosyntropin; Cortrosyn; 0.25 mg). During the 6 hr of confinement, fecal samples (feces and urine) were collected from each of five cranes immediately after defecation. Individual fecal samples were collected approximately at hourly intervals and assayed for corticosterone. We showed previously that serum corticosterone did not vary significantly following saline injection, but peaked significantly 60 min after ACTH injection. Maximal fecal corticosterone concentrations (ng/g) were greater (P cranes under controlled conditions, fecal corticosterone concentration reflects serum corticosterone levels, fecal corticosterone, Grus canadensis pratensis, sandhill cranes, serum corticosterone levels.

An input shaping controller enabling cranes to move without sway

International Nuclear Information System (INIS)

Singer, N.; Singhose, W.; Kriikku, E.

1997-01-01

A gantry crane at the Savannah River Technology Center was retrofitted with an Input Shaping controller. The controller intercepts the operator's pendant commands and modifies them in real time so that the crane is moved without residual sway in the suspended load. Mechanical components on the crane were modified to make the crane suitable for the anti-sway algorithm. This paper will describe the required mechanical modifications to the crane, as well as, a new form of Input Shaping that was developed for use on the crane. Experimental results are presented which demonstrate the effectiveness of the new process. Several practical considerations will be discussed including a novel (patent pending) approach for making small, accurate moves without residual oscillations

Spiders do have melanin after all.

Science.gov (United States)

Hsiung, Bor-Kai; Blackledge, Todd A; Shawkey, Matthew D

2015-11-01

Melanin pigments are broadly distributed in nature - from bacteria to fungi to plants and animals. However, many previous attempts to identify melanins in spiders were unsuccessful, suggesting that these otherwise ubiquitous pigments were lost during spider evolution. Yet, spiders exhibit many dark colours similar to those produced by melanins in other organisms, and the low solubility of melanins makes isolation and characterization difficult. Therefore, whether melanins are truly absent or have simply not yet been detected is an open question. Raman spectroscopy provides a reliable way to detect melanins in situ, without the need for isolation. In this study, we document the presence of eumelanin in diverse species of spiders using confocal Raman microspectroscopy. Comparisons of spectra with theoretically calculated data falsify the previous hypothesis that dark colours are produced solely by ommochromes in spiders. Our data indicate that melanins are present in spiders and further supporting that they are present in most living organisms. © 2015. Published by The Company of Biologists Ltd.

Plasma treatment of crane rails

Directory of Open Access Journals (Sweden)

Владислав Олександрович Мазур

2016-07-01

Full Text Available Crane operation results in wear and tear of rails and crane wheels. Renovation and efficiency of these details is therefore relevant. Modern technologies of wheels and rails restoration use surfacing or high-frequency currents treatment. Surface treatment with highly concentrated streams of energy- with a laser beam, plasma jet- is a promising direction.. It is proposed to increase the efficiency of crane rails by means of surface plasma treatment. The modes of treatment have been chosen.. Modelling of plasma jet thermal impact on a solid body of complex shape has been made. Plasma hardening regimes that meet the requirements of production have been defined. Structural transformation of the material in the crane rails on plasma treatment has been investigated. It has been concluded that for carbon and low alloy crane steels the plasma exposure zone is characterized by a high degree of hardened structure dispersion and higher hardness as compared to the hardness after high-frequency quenching. As this takes place phase transformations are both shift (in the upper zone of plasma influence and fluctuation (in the lower zone of the plasma. With high-speed plasma heating granular or lamellar pearlite mainly transforms into austenite. The level of service characteristics of hardened steel, which is achieved in this case is determined by the kinetics and completeness of pearlite → austenite transformation. For carbon and low alloy rail steels plasma hardening can replace bulk hardening, hardening by high-frequency currents, or surfacing. The modes for plasma treatment which make it possible to obtain a surface layer with a certain service characteristics have been defined

Phobic spider fear is associated with enhanced attentional capture by spider pictures: a rapid serial presentation event-related potential study.

Science.gov (United States)

Van Strien, Jan W; Franken, Ingmar H A; Huijding, Jorg

2009-03-04

The early posterior negativity (EPN) reflects early selective visual processing of emotionally significant information. This study explored the association between fear of spiders and the EPN for spider pictures. Fifty women completed a Spider Phobia Questionnaire and watched the random rapid serial presentation of 600 neutral, 600 negatively valenced emotional, and 600 spider pictures (three pictures per second). The EPN was scored as the mean activity in the 225-300-ms time window at lateral occipital electrodes. Participants with higher scores on the phobia questionnaire showed larger (i.e. more negative) EPN amplitudes in response to spider pictures. The results suggest that the attentional capture of spider-related stimuli is an automatic response, which is modulated by the extent of spider fear.

Container crane for sea freight containers

NARCIS (Netherlands)

Luttekes, E.; Rijsenbrij, J.C.

2001-01-01

The invention relates to a container crane for loading and unloading seaborne containers. The container crane comprises a bridge girder (7), a jib (8), at least two crabs (11, 12) which can travel along the said bridge girder and/or jib and are provided with hoist means for lifting and lowering the

Waste Isolation Pilot Plant TruDock crane system analysis

International Nuclear Information System (INIS)

Morris, B.C.; Carter, M.

1996-10-01

The WIPP TruDock crane system located in the Waste Handling Building was identified in the WIPP Safety Analysis Report (SAR), November 1995, as a potential accident concern due to failures which could result in a dropped load. The objective of this analysis is to evaluate the frequency of failure of the TruDock crane system resulting in a dropped load and subsequent loss of primary containment, i.e. drum failure. The frequency of dropped loads was estimated to be 9.81E-03/year or approximately one every 102 years (or, for the 25% contingency, 7.36E-03/year or approximately one every 136 years). The dominant accident contributor was the failure of the cable/hook assemblies, based on failure data obtained from NUREG-0612, as analyzed by PLG, Inc. The WIPP crane system undergoes a rigorous test and maintenance program, crane operation is discontinued following any abnormality, and the crane operator and load spotter are required to be trained in safe crane operation, therefore it is felt that the WIPP crane performance will exceed the data presented in NUREG-0612 and the estimated failure frequency is felt to be conservative

Travelling cranes for heavy reactor component handling

International Nuclear Information System (INIS)

Champeil, M.

1977-01-01

Structure and operating machinery of two travelling cranes (600 t and 450 t) used in the Framatome factory for handling heavy reactor components are described. When coupled, these cranes can lift loads up to 1000 t [fr

Geographic distribution of the mid-continent population of sandhill cranes and related management applications

Science.gov (United States)

Krapu, Gary L.; Brandt, David A.; Jones, Kenneth L.; Johnson, Douglas H.

2011-01-01

primarily in central and western Saskatchewan (69%), North Dakota (16%), southwestern Manitoba (10%), and northwestern Minnesota (3%). Space-use sharing indices showed that except for NC–N and WC–A birds, probability of finding a crane from one breeding affiliation within the home range of another breeding affiliation was low during fall staging. Tagged cranes from WC–A and EC–M breeding affiliations, on average, spent 25 and 20 days, respectively, longer on fall staging areas in the northern plains than did WA–S and NC–N birds. Cranes in the NC–N, WA–S, and WC–A affiliations spent 99%, 74%, and 64%, respectively, of winter in western Texas in Hunting Zone A; EC–M cranes spent 83% of winter along the Texas Gulf Coast in Hunting Zone C. Tagged cranes that settled within the breeding range of the Gulf Coast Subpopulation spent 28% and 42% of fall staging and winter within the range of the Western Subpopulation, indicating sufficient exchange of birds to potentially limit effectiveness of MCP harvest management. Harvests of EC–M and WC–A cranes during 1998–2003 were disproportionately high to their estimated numbers in the MCP, suggesting more conservative harvest strategies may be required for these subpopulations in the future, and for sandhill cranes to occupy major parts of their historical breeding range in the Prairie Pothole Region. Exceptionally high philopatry of MCP cranes of all 4 subpopulations to breeding sites coupled with strong linkages between crane breeding distribution, and fall staging areas and wintering grounds, provide managers guidance for targeting MCP crane harvest to meet management goals. Sufficient temporal or spatial separation exists among the 4 subpopulations on fall staging areas and wintering grounds to allow harvest to be targeted at the subpopulation level in all states and provinces (and most hunting zones within states and provinces) when conditions warrant. Knowledge gained from our study provides decision

Scavenging by spiders (Araneae) and its relationship to pest management of the brown recluse spider.

Science.gov (United States)

Vetter, Richard S

2011-06-01

Experiments reported in Sandidge (2003; Nature 426: 30) indicated that the brown recluse spider, Loxosceles reclusa Gertsch & Mulaik, preferred to scavenge dead prey over live prey and that the spiders were not detrimentally affected when fed insecticide-killed crickets. Extrapolations made in subsequent media coverage disseminating the results of this research made counter-intuitive statements that pesticide treatment in houses would increase brown recluse populations in homes. This information was presented as if the scavenging behavior was specialized in the brown recluse; however, it was more likely that this behavior has not been well studied in other species. To provide a comparison, the current laboratory study examined the likelihood of non-Loxosceles spiders to scavenge dead prey. Of 100 non-Loxosceles spiders that were tested (from 11 families, 24 genera, and at least 29 species from a variety of spider hunting guilds), 99 scavenged dead crickets when offered in petri dishes. Some of the spiders were webspinners in which real-world scavenging of dead prey is virtually impossible, yet they scavenge when given the opportunity. Therefore, scavenging is a flexible opportunistic predatory behavior that is spread across a variety of taxa and is not a unique behavior in brown recluses. These findings are discussed in relation to pest management practices.

Hamiltonian Dynamics of Spider-Type Multirotor Rigid Bodies Systems

International Nuclear Information System (INIS)

Doroshin, Anton V.

2010-01-01

This paper sets out to develop a spider-type multiple-rotor system which can be used for attitude control of spacecraft. The multirotor system contains a large number of rotor-equipped rays, so it was called a 'Spider-type System', also it can be called 'Rotary Hedgehog'. These systems allow using spinups and captures of conjugate rotors to perform compound attitude motion of spacecraft. The paper describes a new method of spacecraft attitude reorientation and new mathematical model of motion in Hamilton form. Hamiltonian dynamics of the system is investigated with the help of Andoyer-Deprit canonical variables. These variables allow obtaining exact solution for hetero- and homoclinic orbits in phase space of the system motion, which are very important for qualitative analysis.

Optimum Tower Crane Selection and Supporting Design Management

Directory of Open Access Journals (Sweden)

Hyo Won Sohn

2014-08-01

Full Text Available To optimize tower crane selection and supporting design, lifting requirements (as well as stability should be examined, followed by a review of economic feasibility. However, construction engineers establish plans based on data provided by equipment suppliers since there are no tools with which to thoroughly examine a support design's suitability for various crane types, and such plans lack the necessary supporting data. In such cases it is impossible to optimize a tower crane selection to satisfy lifting requirements in terms of cost, and to perform lateral support and foundation design. Thus, this study is intended to develop an optimum tower crane selection and supporting design management method based on stability. All cases that are capable of generating an optimization of approximately 3,000 ˜ 15,000 times are calculated to identify the candidate cranes with minimized cost, which are examined. The optimization method developed in the study is expected to support engineers in determining the optimum lifting equipment management.

Passive Control of Attachment in Legged Space Robots

Directory of Open Access Journals (Sweden)

Alessandro Gasparetto

2010-01-01

Full Text Available In the space environment the absence of gravity calls for constant safe attachment of any loose object, but the low-pressure conditions prohibit the use of glue-type adhesives. The attachment system of freely hunting spiders, e.g. Evarcha arcuata, employs van der Waals forces and mechanical interlocking. Furthermore, detachment is achieved passively and requires little force. Hence, the spider serves as a model for a versatile legged robot for space applications, e.g. on the outer surface of a space station. In this paper, we analyse the dry attachment systems of E. arcuata and geckos as well as the kinematics of freely hunting spiders. We generalise the results of biological studies on spider locomotion and mobility, including the major movement and the position constraints set by the dry adhesion system. From these results, we define a simplified spider model and study the overall kinematics of the legs both in flight and in contact with the surface. The kinematic model, the data on spider gait characteristics and the adhesion constraints are implemented in a kinematic simulator. The simulator results confirm the principal functionality of our concept.

305 Building 2 ton bridge crane and monorail assembly analysis

International Nuclear Information System (INIS)

Axup, M.D.

1995-12-01

The analyses in the appendix of this document evaluate the integrity of the existing bridge crane structure, as depicted on drawing H-3-34292, for a bridge crane and monorail assembly with a load rating of 2 tons. This bridge crane and monorail assembly is a modification of a 1 1/2 ton rated manipulator bridge crane which originally existed in the 305 building

33 CFR 150.555 - How must cranes be maintained?

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How must cranes be maintained? 150.555 Section 150.555 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY... Operations § 150.555 How must cranes be maintained? Cranes must be operated, maintained, and tested in...

Seismic behavior with sliding of overhead travelling crane

International Nuclear Information System (INIS)

Komori, Akio; Ueki, Takashi; Hirata, Masami; Hoshii, Tsutomu; Kashiwazaki, Akihiro.

1989-01-01

In this study, the seismic behavior of an overhead travelling crane with the sliding between travelling wheels and rails is examined. First, the dynamic characteristic test of the actual crane installed in a reactor building and the sliding test of the rigid-element model to observe the basic sliding characteristic were performed. Next, to examine the dynamic response with sliding, shaking tests using the scaled model of an actual crane were conducted. From these results, useful design information about seismic behavior of an overhead travelling crane was obtained. It was also observed that numerical predictions considering sliding behavior have good agreement with the experimental results and are applicable to seismic design. (author)

Study on an Interactive Truck Crane Simulation Platform Based on Virtual Reality Technology

Science.gov (United States)

Sang, Yong; Zhu, Yu; Zhao, Honghua; Tang, Mingyan

2016-01-01

The modern web-based distance education overcomes space-time restriction of the traditional teaching forms. However, being short of specifically observable and operable experimental equipment makes the web-based education lack advantages in the knowledge learning progress, which needs strong stereoscopic effect and operability. Truck crane is the…

Cooperative control system of the floating cranes for the dual lifting

Directory of Open Access Journals (Sweden)

Mihee Nam

2018-01-01

Full Text Available This paper proposes a dual lifting and its cooperative control system with two different kinds of floating cranes. The Mega-erection and Giga-erection in the ship building are used to handle heavier and wider blocks and modules as ships and off-shore platforms are enlarged. However, there is no equipment to handle such Tera-blocks. In order to overcome the limit on performance of existing floating cranes, the dual lifting is proposed in this research. In the dual lifting, two floating cranes are well-coordinated to add up the lift capabilities of both cranes without any loss such that virtually a single crane is lifting, maneuvering and unloading. Two main constraints for the dual lifting are as follows: First, two barges of floating cranes should be constrained as a rigid body not to cause a relative motion between two barges and main hooks of the two cranes should be controlled as main hooks of a single crane. In order words, it is necessary to develop the cooperative control of two floating cranes in order to sustain a center of gravity of the module and minimize the tilting angle during the lifting and unloading by the two floating cranes. Two floating cranes are handled as a master-slave system. The master crane is able to gather information about all working conditions and make a decision to control the individual hook speed, which communicates the slave crane by TCP/IP. The developed control system has been embedded in the real floating crane systems and the dual lifting has been demonstrated five times at SHI shipyard in 2015. The moving angles of the lifting module are analyzed and verified to be suitable for hoisting control. It is verified that the dual lifting can be applied for many heavier and wider blocks and modules to shorten the construction time of ships and off-shore platforms.

Spider and burnable poison rod combinations

International Nuclear Information System (INIS)

Edwards, G.T.; Schluderberg, D.C.

1980-01-01

An improved design of burnable poison rods and associated spiders used in fuel assemblies of pressurized water power reactor cores, is described. The rods are joined to the spider arms in a manner which is proof against the reactor core environment and yet allows the removal of the rods from the spider simply, swiftly and delicately. (U.K.)

Are temperate canopy spiders tree-species specific?

Science.gov (United States)

Mupepele, Anne-Christine; Müller, Tobias; Dittrich, Marcus; Floren, Andreas

2014-01-01

Arboreal spiders in deciduous and coniferous trees were investigated on their distribution and diversity. Insecticidal knock-down was used to comprehensively sample spiders from 175 trees from 2001 to 2003 in the Białowieża forest and three remote forests in Poland. We identified 140 species from 9273 adult spiders. Spider communities were distinguished between deciduous and coniferous trees. The richest fauna was collected from Quercus where beta diversity was also highest. A tree-species-specific pattern was clearly observed for Alnus, Carpinus, Picea and Pinus trees and also for those tree species that were fogged in only four or three replicates, namely Betula and Populus. This hitherto unrecognised association was mainly due to the community composition of common species identified in a Dufrene-Legendre indicator species analysis. It was not caused by spatial or temporal autocorrelation. Explaining tree-species specificity for generalist predators like spiders is difficult and has to involve physical and ecological tree parameters like linkage with the abundance of prey species. However, neither did we find a consistent correlation of prey group abundances with spiders nor could differences in spider guild composition explain the observed pattern. Our results hint towards the importance of deterministic mechanisms structuring communities of generalist canopy spiders although the casual relationship is not yet understood.

Clinical pathology results from cranes with experimental West Nile Virus infection

Science.gov (United States)

Olsen, Glenn H.

2011-01-01

Sandhill cranes (Grus canadensis) were vaccinated for and then challenged with West Nile virus. Resulting titers demonstrated protection in the vaccinated-challenged cranes as compared to the unvaccinated-challenged cranes. Clinical pathology results showed challenged cranes, whether vaccinated or not, had a decrease in their hematocrits and an elevation of 2.5-fold in their white blood cell counts as compared to unchallenged control sandhill cranes. No differences were apparent in the differential counts of heterophils and lymphocytes.

46 CFR 107.258 - Crane certification.

Science.gov (United States)

2010-10-01

... West 44th Street, New York, NY 10036, on the Internet at http://www.icgb.com. (b) Crane certification must be based upon— (1) A review of plans submitted under § 107.309; and (2) The continuing program of... be recorded in the unit's Crane Record Book required in § 109.437. [CGD 73-251, 43 FR 56802, Dec. 4...

46 CFR 107.260 - Rated load test for cranes.

Science.gov (United States)

2010-10-01

... 46 Shipping 4 2010-10-01 2010-10-01 false Rated load test for cranes. 107.260 Section 107.260... INSPECTION AND CERTIFICATION Inspection and Certification § 107.260 Rated load test for cranes. (a) To meet the requirements in § 107.231(l), each crane must meet the following rated load test at both the...

ST-HM not only cranes

CERN Document Server

Bertone, C

2002-01-01

This period of LEP dismantling and LHC installation is a real challenge for the ST-HM group. The group is now following several projects to cope with the diversity of requests. Although crane design and procurement still constitutes the majority of the workload, more and more of our time is nowadays dedicated to providing alternative handling solutions. In 2001/2002, our main studies concern cranes for LHC, industrial and shielded motorised doors, the upgrade/replacement of 32 lifts and mobile cranes. The years 2002/2003 will concern mainly the study of LHC handling systems such as trailers and heavy-duty tractors, specifically tailored containers and tools. In parallel, the monorail will be extended in the injection tunnel and CNGS tunnels and a new monorail system for TOF will be installed. Since the tunnel monorail infrastructure will be used for power feed and guidance purposes only, this requires that other transport systems be studied, such as forklift trucks, industrial and telescopic hoists.

Fish predation by semi-aquatic spiders: a global pattern.

Directory of Open Access Journals (Sweden)

Martin Nyffeler

Full Text Available More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil. Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae, in two species of the superfamily Ctenoidea (family Ctenidae, and in one species of the superfamily Corinnoidea (family Liocranidae. The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences. There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae] predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders. Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Fish predation by semi-aquatic spiders: a global pattern.

Science.gov (United States)

Nyffeler, Martin; Pusey, Bradley J

2014-01-01

More than 80 incidences of fish predation by semi-aquatic spiders--observed at the fringes of shallow freshwater streams, rivers, lakes, ponds, swamps, and fens--are reviewed. We provide evidence that fish predation by semi-aquatic spiders is geographically widespread, occurring on all continents except Antarctica. Fish predation by spiders appears to be more common in warmer areas between 40° S and 40° N. The fish captured by spiders, usually ranging from 2-6 cm in length, are among the most common fish taxa occurring in their respective geographic area (e.g., mosquitofish [Gambusia spp.] in the southeastern USA, fish of the order Characiformes in the Neotropics, killifish [Aphyosemion spp.] in Central and West Africa, as well as Australian native fish of the genera Galaxias, Melanotaenia, and Pseudomugil). Naturally occurring fish predation has been witnessed in more than a dozen spider species from the superfamily Lycosoidea (families Pisauridae, Trechaleidae, and Lycosidae), in two species of the superfamily Ctenoidea (family Ctenidae), and in one species of the superfamily Corinnoidea (family Liocranidae). The majority of reports on fish predation by spiders referred to pisaurid spiders of the genera Dolomedes and Nilus (>75% of observed incidences). There is laboratory evidence that spiders from several more families (e.g., the water spider Argyroneta aquatica [Cybaeidae], the intertidal spider Desis marina [Desidae], and the 'swimming' huntsman spider Heteropoda natans [Sparassidae]) predate fish as well. Our finding of such a large diversity of spider families being engaged in fish predation is novel. Semi-aquatic spiders captured fish whose body length exceeded the spiders' body length (the captured fish being, on average, 2.2 times as long as the spiders). Evidence suggests that fish prey might be an occasional prey item of substantial nutritional importance.

Causes of Fatal Accidents Involving Cranes in the Australian Construction Industry

Directory of Open Access Journals (Sweden)

Ehsan Gharaie

2015-05-01

Full Text Available In ten years from 2004 to 2013, 359 workers died in the Australian construction industry because of work related causes. This paper investigates crane-related fatalities in order to find the upstream causation of such accidents. The National Coroners’ Information System (NCIS database was searched to identify fatal accidents in the construction industry involving the use of a crane.  The narrative description of the cases provided in the coroners’ findings and associated documents were content analysed to identify the contributing causal factors within the context of each case. The findings show that the most frequent crane-related accident types were those that were struck by load, and electrocution. The most prevalent immediate circumstance causes were layout of the site and restricted space. The two most commonly identified shaping factors were physical site constraints and design of construction process. Inadequate risk management system was identified as the main originating influence on the accidents. This paper demonstrates that a systemic causation model can provide considerable insight into how originating influences, shaping factors, and immediate circumstances combine to produce accidents. This information is extremely useful in informing the development of prevention strategies, particularly in the case of commonly occurring accident types.

Evidence for competition between carnivorous plants and spiders.

Science.gov (United States)

Jennings, David E; Krupa, James J; Raffel, Thomas R; Rohr, Jason R

2010-10-07

Several studies have demonstrated that competition between disparate taxa can be important in determining community structure, yet surprisingly, to our knowledge, no quantitative studies have been conducted on competition between carnivorous plants and animals. To examine potential competition between these taxa, we studied dietary and microhabitat overlap between pink sundews (Drosera capillaris) and wolf spiders (Lycosidae) in the field, and conducted a laboratory experiment examining the effects of wolf spiders on sundew fitness. In the field, we found that sundews and spiders had a high dietary overlap with each other and with the available arthropod prey. Associations between sundews and spiders depended on spatial scale: both sundews and spiders were found more frequently in quadrats with more abundant prey, but within quadrats, spiders constructed larger webs and located them further away from sundews as the total sundew trapping area increased, presumably to reduce competition. Spiders also constructed larger webs when fewer prey were available. In the laboratory, our experiment revealed that spiders can significantly reduce sundew fitness. Our findings suggest that members of the plant and animal kingdoms can and do compete.

29 CFR 1919.71 - Unit proof test and examination of cranes.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Unit proof test and examination of cranes. 1919.71 Section... § 1919.71 Unit proof test and examination of cranes. (a) Unit proof tests of cranes shall be carried out at the following times: (1) In the cases of new cranes, before initial use and every 4 years...

Genus-specificity of araneophagy of linyphiid spiders and spiders of other families (Arachnida, Araneae)

NARCIS (Netherlands)

Heuts, B.; Brunt, T.

2009-01-01

We found genus specificity of predation by spiders on other spiders in captivity which surpass them in body size (araneophagy). Adult specimens of three species of the linyphiid genus Walckenaeria which were successively tested for araneophagy (in the laboratory) in the order of first species

Approach and avoidance in fear of spiders

NARCIS (Netherlands)

Rinck, M.; Becker, E.S.

2007-01-01

We examined attitudes towards spiders by employing an Approach-Avoidance Task, in which participants respond to pictures by pulling a joystick towards themselves or by pushing it away from themselves. For spider fearfuls, this stimulus–response assignment is either compatible (push spiders away) or

Learning to avoid spiders: fear predicts performance, not competence.

Science.gov (United States)

Luo, Xijia; Becker, Eni S; Rinck, Mike

2018-01-05

We used an immersive virtual environment to examine avoidance learning in spider-fearful participants. In 3 experiments, participants were asked to repeatedly lift one of 3 virtual boxes, under which either a toy car or a spider appeared and then approached the participant. Participants were not told that the probability of encountering a spider differed across boxes. When the difference was large (Exps. 1 and 2), spider-fearfuls learned to avoid spiders by lifting the few-spiders-box more often and the many-spiders-box less often than non-fearful controls did. However, they hardly managed to do so when the probability differences were small (Exp. 3), and they did not escape from threat more quickly (Exp. 2). In contrast to the observed performance differences, spider-fearfuls and non-fearfuls showed equal competence, that is comparable post-experimental knowledge about the probability to encounter spiders under the 3 boxes. The limitations and implications of the present study are discussed.

Attention and amygdala activity: an fMRI study with spider pictures in spider phobia.

Science.gov (United States)

Alpers, Georg W; Gerdes, Antje B M; Lagarie, Bernadette; Tabbert, Katharina; Vaitl, Dieter; Stark, Rudolf

2009-06-01

Facilitated detection of threatening visual cues is thought to be adaptive. In theory, detection of threat cues should activate the amygdala independently from allocation of attention. However, previous studies using emotional facial expressions as well as phobic cues yielded contradictory results. We used fMRI to examine whether the allocation of attention to components of superimposed spider and bird displays modulates amygdala activation. Nineteen spider-phobic women were instructed to identify either a moving or a stationary animal in briefly presented double-exposure displays. Amygdala activation followed a dose-response relationship: Compared to congruent neutral displays (two birds), amygdala activation was most pronounced in response to congruent phobic displays (two spiders) and less but still significant in response to mixed displays (spider and bird) when attention was focused on the phobic component. When attention was focused on the neutral component, mixed displays did not result in significant amygdala activation. This was confirmed in a significant parametric graduation of the amygdala activation in the order of congruent phobic displays, mixed displays with attention focus on the spider, mixed displays with focus on the bird and congruent neutral displays. These results challenge the notion that amygdala activation in response to briefly presented phobic cues is independent from attention.

A fuzzy-logic antiswing controller for three-dimensional overhead cranes.

Science.gov (United States)

Cho, Sung-Kun; Lee, Ho-Hoon

2002-04-01

In this paper, a new fuzzy antiswing control scheme is proposed for a three-dimensional overhead crane. The proposed control consists of a position servo control and a fuzzy-logic control. The position servo control is used to control crane position and rope length, and the fuzzy-logic control is used to suppress load swing. The proposed control guarantees not only prompt suppression of load swing but also accurate control of crane position and rope length for simultaneous travel, traverse, and hoisting motions of the crane. Furthermore, the proposed control provides practical gain tuning criteria for easy application. The effectiveness of the proposed control is shown by experiments with a three-dimensional prototype overhead crane.

Autumn crane migration and climate change in the Carpathian Basin

Directory of Open Access Journals (Sweden)

Végvári Zsolt

2015-12-01

Full Text Available Weekly counts of roosting cranes were conducted between 2006–2014 in all significant stopover sites of Common Cranes (Grus grus in Hungary, as an extension of the survey programme performed in Hortobágy National Park since 1994. As a result, I detected consistently asymmetrical migration phenologies in Hortobágy, indicating a superposition of several migration waves. Cranes used nearly 60 roost sites in Hortobágy with the largest ones situated in extensive fishponds. In contrast, cranes migrating in Körös-Maros National Park started to overwinter regularly, increasingly roosting in dry wetlands. In Kiskunság cranes tended to stage for shorter periods than in Körös-Maros, with the largest flocks to be observed in Lake Fehér of Szeged fishponds and additionally in a number of alkali lakes. Cranes observed in the Borsodi Mezőség region are considered satellite flocks staging in Hortobágy, as shown by irregular fluctuations.

Whooping crane recovery plan

Science.gov (United States)

Olsen, David L.; Blankenship, David R.; Irby, Harold D.; Erickson, Ray C.; Lock, Ross; Drewien, Roderick C.; Smith, Lawrence S.; Derrickson, Scott R.

1980-01-01

This plan has been prepared under the authority of the Endangered Species Act of 1973 and subsequent amendments. The Plan is designed to provide decision makers with an orderly set of events which, if carried out to a successful completion, will result in changing the status of the species from the endangered to the threatened level. It must be recognized that this Plan has been prepared 40 years after attempts to preserve the species began. As such, it covers events that have taken place, that are taking place, and that need to take place. The Plan, therefore, not only compiles in one place all whooping crane management and research efforts which are underway, but also proposes additional efforts needed for the recovery of the whooping crane. The Plan also establishes funding evels, time schedules, and priorities for each management and research effort.The Plan is organized into three parts. the first part includes an account of the whooping crane's history, biology, present status, and the factors believed to have resulted in its endangered status. Also included in this part is a synopsis of research and management activities that have taken place through 1978.The second part is a step-down pan wherein all existing and needed research and management efforts are organized into an orderly set of events. The prime objective is to move the whooping crane to non-endangered status. Minimum requirements for the attainment of this objective are the increase of the historical Wood Buffalo-Aransas population to at least 40 nesting pairs and the establishment of at least two additional, separate, and self-sustaining populations consisting of at least 20 nesting pairs each.the third part identifies the responsibility, time schedule, and cost for each element of the step-down plan.

Gantry cranes

NARCIS (Netherlands)

Luttekes, E.; Rijsenbrij, J.C.

2003-01-01

Portal crane (1) for loading and/or unloading a ship having a multiplicity of bays for containers (10) comprising a gantry (2) with travelling gear (5) for supporting the gantry on a quay (13), a boom supported by the gantry made up of a horizontal beam (6) and a jib (7) that during loading and/or

Uncovering the structure-function relationship in spider silk

Science.gov (United States)

Yarger, Jeffery L.; Cherry, Brian R.; van der Vaart, Arjan

2018-03-01

All spiders produce protein-based biopolymer fibres that we call silk. The most studied of these silks is spider dragline silk, which is very tough and relatively abundant compared with other types of spider silks. Considerable research has been devoted to understanding the relationship between the molecular structure and mechanical properties of spider dragline silks. In this Review, we overview experimental and computational studies that have provided a wealth of detail at the molecular level on the highly conserved repetitive core and terminal regions of spider dragline silk. We also discuss the role of the nanocrystalline β-sheets and amorphous regions in determining the properties of spider silk fibres, endowing them with strength and elasticity. Additionally, we outline imaging techniques and modelling studies that elucidate the importance of the hierarchical structure of silk fibres at the molecular level. These insights into structure-function relationships can guide the reverse engineering of spider silk to enable the production of superior synthetic fibres.

Local and Landscape Correlates of Spider Activity Density and Species Richness in Urban Gardens.

Science.gov (United States)

Otoshi, Michelle D; Bichier, Peter; Philpott, Stacy M

2015-08-01

Urbanization is a major threat to arthropod biodiversity and abundance due to reduction and loss of suitable natural habitat. Green spaces and small-scale agricultural areas may provide habitat and resources for arthropods within densely developed cities. We studied spider activity density (a measure of both abundance and degree of movement) and diversity in urban gardens in Santa Cruz, Santa Clara, and Monterey counties in central California, USA. We sampled for spiders with pitfall traps and sampled 38 local site characteristics for 5 mo in 19 garden sites to determine the relative importance of individual local factors. We also analyzed 16 landscape variables at 500-m and 1-km buffers surrounding each garden to determine the significance of landscape factors. We identified individuals from the most common families to species and identified individuals from other families to morphospecies. Species from the families Lycosidae and Gnaphosidae composed 81% of total adult spider individuals. Most of the significant factors that correlated with spider activity density and richness were local rather than landscape factors. Spider activity density and richness increased with mulch cover and flowering plant species, and decreased with bare soil. Thus, changes in local garden management have the potential to promote diversity of functionally important spiders in urban environments. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

The Speed Control of Constant Tension Motor of Marine Crane

Directory of Open Access Journals (Sweden)

Chen Xinyang

2016-01-01

Full Text Available This article describes the working principle of the marine beacon crane hanging disc mechanical anti-sway device, and establish mathematical model on the rope controlling hanging disc of mechanical anti-sway device; Through matlab simulation analysis, this article obtains the relation curve between the velocity of traction rope of hanging disc and output frequency of the crane motor, combining rotary crane scaled model, this article carries out anti-sway experiment for the rotary crane to examine the crane’s anti-sway effects.

Animal coloration: sexy spider scales.

Science.gov (United States)

Taylor, Lisa A; McGraw, Kevin J

2007-08-07

Many male jumping spiders display vibrant colors that are used in visual communication. A recent microscopic study on a jumping spider from Singapore shows that three-layered 'scale sandwiches' of chitin and air are responsible for producing their brilliant iridescent body coloration.

Time-dependent motor properties of multipedal molecular spiders.

Science.gov (United States)

Samii, Laleh; Blab, Gerhard A; Bromley, Elizabeth H C; Linke, Heiner; Curmi, Paul M G; Zuckermann, Martin J; Forde, Nancy R

2011-09-01

Molecular spiders are synthetic biomolecular walkers that use the asymmetry resulting from cleavage of their tracks to bias the direction of their stepping motion. Using Monte Carlo simulations that implement the Gillespie algorithm, we investigate the dependence of the biased motion of molecular spiders, along with binding time and processivity, on tunable experimental parameters, such as number of legs, span between the legs, and unbinding rate of a leg from a substrate site. We find that an increase in the number of legs increases the spiders' processivity and binding time but not their mean velocity. However, we can increase the mean velocity of spiders with simultaneous tuning of the span and the unbinding rate of a spider leg from a substrate site. To study the efficiency of molecular spiders, we introduce a time-dependent expression for the thermodynamic efficiency of a molecular motor, allowing us to account for the behavior of spider populations as a function of time. Based on this definition, we find that spiders exhibit transient motor function over time scales of many hours and have a maximum efficiency on the order of 1%, weak compared to other types of molecular motors.

The Crane Robust Control

Directory of Open Access Journals (Sweden)

Marek Hicar

2004-01-01

Full Text Available The article is about a control design for complete structure of the crane: crab, bridge and crane uplift.The most important unknown parameters for simulations are burden weight and length of hanging rope. We will use robustcontrol for crab and bridge control to ensure adaptivity for burden weight and rope length. Robust control will be designed for current control of the crab and bridge, necessary is to know the range of unknown parameters. Whole robust will be splitto subintervals and after correct identification of unknown parameters the most suitable robust controllers will be chosen.The most important condition at the crab and bridge motion is avoiding from burden swinging in the final position. Crab and bridge drive is designed by asynchronous motor fed from frequency converter. We will use crane uplift with burden weightobserver in combination for uplift, crab and bridge drive with cooperation of their parameters: burden weight, rope length and crab and bridge position. Controllers are designed by state control method. We will use preferably a disturbance observerwhich will identify burden weight as a disturbance. The system will be working in both modes at empty hook as well asat maximum load: burden uplifting and dropping down.

Development of a training simulator for offshore crane operators

Energy Technology Data Exchange (ETDEWEB)

Cooper, S.J.

2003-01-01

The crane simulator, trade name KraneSIM-6000, underpins an integrated training package developed to provide crane operator exposure to simulated normal and dangerous conditions in a safe training environment. The prototype simulator is significantly more sophisticated than the system initially envisaged: a number of conceptual changes incorporated during its development ensured that the very latest in simulation computer technology was incorporate unique in that it offers the opportunity to practice the lifting and laying down of loads between a moving (floating) rig and moving supply vessels, together with the possibility of benchmarking crane operator competency. Concludes that there is great scope for expansion of the simulator facilities so far developed. In particular, it is recognised that training and competency testing of teams of personnel such as banksman and supply ship's master could be integrated into crane simulator training scenarios, and that this approach offers great potential for reducing the number of crane related accidents. (Author)

Golden Eagle predation on experimental Sandhill and Whooping Cranes

Science.gov (United States)

Ellis, D.H.; Clegg, K.R.; Lewis, J.C.; Spaulding, E.

1999-01-01

There are very few published records of Golden Eagles preying upon cranes, especially in North America. During our experiments to lead cranes on migration behind motorized craft in the western United States, we experienced 15 attacks (four fatal) and believe many more attacks would have occurred (and more would have been fatal) without human intervention. We recognize eagle predation as an important risk to cranes especially during migration.

Cognitive bias in spider-phobic children: Comparison of a pictorial and a linguistic spider Stroop.

NARCIS (Netherlands)

Kindt, M.; Brosschot, J.F.

1999-01-01

Examined the relation between spider fear in children and cognitive processing bias toward threatening information. It was investigated whether spider fear in children is related to a cognitive bias for threatening pictures and words. Pictorial and linguistic Stroop stimuli were administered to 28

Seismic response analysis for hinged-leg type port crane

Energy Technology Data Exchange (ETDEWEB)

Kashiwazaki, A.; Kanayama, T.; Arai, K. [Ishikawajima-Harima Heavy Industries Co. Ltd., Tokyo (Japan)

2000-04-01

Container cranes and unloaders in Kobe Pont were severely damaged during the Southern Hyogo Prefecture Earthquake in 1995. Notably, some of the hinged-leg type of cranes with hinges at the end of sea-or land-side of legs were overturned. These damages were derived from the uplifting of their legs. To explain the uplifting and overturning behavior, we carried out nonlinear analyses and shaking table tests using a 1/8-scale model of the container crane. The results of nonlinear response analyses of hinged-leg type of crane, which are in an agreement with the state of damages in the Southern Hyogo Prefecture Earthquake and the result of shaking table tests, are described. (author)

Closed-circuit television and remote crane control for vitrification facilities

International Nuclear Information System (INIS)

Bennett, P.R.; Morrison, J.E.

1986-01-01

The Defense Waste Processing Facility is currently under construction at the Savannah River Plant. Within the main process cell (MPC), a 117-ton capacity bridge crane is to be installed to facilitate remote handling and processing operations. E. I. du Pont de Nemours and Company defined and PRC designed and built an operational prototype closed-circuit television (CCTV) and remote control system. Phase I of the program developed the CCTV system to prove the feasibility of a remote viewing system. The phase II program added full crane functional remote control and installed it on an existing hot canyon crane. This prototype system established the criteria for the development of the MPC crane and future crane systems. Parameters were: (a) failsafe assurance, (b) high liability, (c) ease of maintenance for dressed-out personnel, (d) rapid malfunction diagnosis, (e) ergonomics, (f) known picture orientation, and (g) audio system to monitor operational sounds. The complete system has undergone a total demonstration of its operational capabilities using simulator circuits for crane functions and is now being integrated with the crane for a full operational demonstration. The system will then be mothballed pending installation by construction personnel ready for cold startup of the plant in 1988

Recent advances in the understanding of brown spider venoms: From the biology of spiders to the molecular mechanisms of toxins.

Science.gov (United States)

Gremski, Luiza Helena; Trevisan-Silva, Dilza; Ferrer, Valéria Pereira; Matsubara, Fernando Hitomi; Meissner, Gabriel Otto; Wille, Ana Carolina Martins; Vuitika, Larissa; Dias-Lopes, Camila; Ullah, Anwar; de Moraes, Fábio Rogério; Chávez-Olórtegui, Carlos; Barbaro, Katia Cristina; Murakami, Mario Tyago; Arni, Raghuvir Krishnaswamy; Senff-Ribeiro, Andrea; Chaim, Olga Meiri; Veiga, Silvio Sanches

2014-06-01

The Loxosceles genus spiders (the brown spiders) are encountered in all the continents, and the clinical manifestations following spider bites include skin necrosis with gravitational lesion spreading and occasional systemic manifestations, such as intravascular hemolysis, thrombocytopenia and acute renal failure. Brown spider venoms are complex mixtures of toxins especially enriched in three molecular families: the phospholipases D, astacin-like metalloproteases and Inhibitor Cystine Knot (ICK) peptides. Other toxins with low level of expression also present in the venom include the serine proteases, serine protease inhibitors, hyaluronidases, allergen factors and translationally controlled tumor protein (TCTP). The mechanisms by which the Loxosceles venoms act and exert their noxious effects are not fully understood. Except for the brown spider venom phospholipase D, which causes dermonecrosis, hemolysis, thrombocytopenia and renal failure, the pathological activities of the other venom toxins remain unclear. The objective of the present review is to provide insights into the brown spider venoms and loxoscelism based on recent results. These insights include the biology of brown spiders, the clinical features of loxoscelism and the diagnosis and therapy of brown spider bites. Regarding the brown spider venom, this review includes a description of the novel toxins revealed by molecular biology and proteomics techniques, the data regarding three-dimensional toxin structures, and the mechanism of action of these molecules. Finally, the biotechnological applications of the venom components, especially for those toxins reported as recombinant molecules, and the challenges for future study are discussed. Copyright © 2014 Elsevier Ltd. All rights reserved.

Analysis of Production Funds Efficiency in the Country’s Crane Sector

Directory of Open Access Journals (Sweden)

Edita Valėnaitė

2012-07-01

Full Text Available The article deals with methodological aspects of the production funds analysis. In this work the study of literature which examines the basic and transferable funds is presented. Much attention is paid to the analysis of basic production funds in the crane sector. Analysis of the basic production funds in the country’s crane sector is presented. Special attention is paid to the structure of the cranes park and crane utilization efficiency. In the analysis of basic production funds, the factors that impede the efficiency of production funds were established as follows: the greatest negative impact on basic production funds efficiency of businesses was in small tower crane fleet; a small range of tower cranes in the park is reducing the technical possibilities of the lease. Basing on the analysis and observation of tower cranes installation and dismantling, the poor supply of the parts for the work place, lack of competence and motivation of the support staff have been ascertained. After elimination of these factors it is possible to raise the efficiency of the main production funds.Article in Lithuanian

The Motion Planning of Overhead Crane Based on Suppressing Payload Residual Swing

Directory of Open Access Journals (Sweden)

Liu Hua-sen

2016-01-01

Full Text Available Since the overhead crane system is subject to under actuation system due to that overhead crane and payload are connected by flexibility wire rope. The payload generates residual swing when the overhead crane is accelerating/ decelerating the motions. This may cause trouble for the payload precise positioning and motion planning. Hence, an optimization input shaping control method is presented to reduce the under actuated overhead crane’s payload swing caused via the inertia force. The dynamic model of the overhead crane is proposed according to the physics structure of the crane. The input shaper based on the motion planning of the crane is used as the feed forward input to suppress payload residual swing. Simulation and experiment results indicate that the ZV input shaper and ZVD input shaper can reduce the payload swing of the overhead crane.

Global patterns of guild composition and functional diversity of spiders.

Directory of Open Access Journals (Sweden)

Pedro Cardoso

Full Text Available The objectives of this work are: (1 to define spider guilds for all extant families worldwide; (2 test if guilds defined at family level are good surrogates of species guilds; (3 compare the taxonomic and guild composition of spider assemblages from different parts of the world; (4 compare the taxonomic and functional diversity of spider assemblages and; (5 relate functional diversity with habitat structure. Data on foraging strategy, prey range, vertical stratification and circadian activity was collected for 108 families. Spider guilds were defined by hierarchical clustering. We searched for inconsistencies between family guild placement and the known guild of each species. Richness and abundance per guild before and after correcting guild placement were compared, as were the proportions of each guild and family between all possible pairs of sites. Functional diversity per site was calculated based on hierarchical clustering. Eight guilds were discriminated: (1 sensing, (2 sheet, (3 space, and (4 orb web weavers; (5 specialists; (6 ambush, (7 ground, and (8 other hunters. Sixteen percent of the species richness corresponding to 11% of all captured individuals was incorrectly attributed to a guild by family surrogacy; however, the correlation of uncorrected vs. corrected guilds was invariably high. The correlation of guild richness or abundances was generally higher than the correlation of family richness or abundances. Functional diversity was not always higher in the tropics than in temperate regions. Families may potentially serve as ecological surrogates for species. Different families may present similar roles in the ecosystems, with replacement of some taxa by other within the same guild. Spiders in tropical regions seem to have higher redundancy of functional roles and/or finer resource partitioning than in temperate regions. Although species and family diversity were higher in the tropics, functional diversity seems to be also

29 CFR 1918.55 - Cranes (See also § 1918.11).

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Cranes (See also § 1918.11). 1918.55 Section 1918.55 Labor... (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR LONGSHORING Vessel's Cargo Handling Gear § 1918.55 Cranes (See also § 1918.11). The following requirements shall apply to the use of cranes forming part of a vessel's...

CALCULATION ALGORITHM TRUSS UNDER CRANE BEAMS

Directory of Open Access Journals (Sweden)

N. K. Akaev1

2016-01-01

Full Text Available Aim.The task of reducing the deflection and increase the rigidity of single-span beams are made. In the article the calculation algorithm for truss crane girders is determined.Methods. To identify the internal effort required for the selection of cross section elements the design uses the Green's function.Results. It was found that the simplest truss system reduces deflection and increases the strength of design. The upper crossbar is subjected not only to bending and shear and compression work due to tightening tension. Preliminary determination of the geometrical characteristics of the crane farms elements are offered to make a comparison with previous similar configuration of his farms, using a simple approximate calculation methods.Conclusion.The method of sequential movements (incrementally the two bridge cranes along the length of the upper crossbar truss beams is suggested. We give the corresponding formulas and conditions of safety.

Maternal care and subsocial behaviour in spiders.

Science.gov (United States)

Yip, Eric C; Rayor, Linda S

2014-05-01

While most spiders are solitary and opportunistically cannibalistic, a variety of social organisations has evolved in a minority of spider species. One form of social organisation is subsociality, in which siblings remain together with their parent for some period of time but disperse prior to independent reproduction. We review the literature on subsocial and maternal behaviour in spiders to highlight areas in which subsocial spiders have informed our understanding of social evolution and to identify promising areas of future research. We show that subsocial behaviour has evolved independently at least 18 times in spiders, across a wide phylogenetic distribution. Subsocial behaviour is diverse in terms of the form of care provided by the mother, the duration of care and sibling association, the degree of interaction and cooperation among siblings, and the use of vibratory and chemical communication. Subsocial spiders are useful model organisms to study various topics in ecology, such as kin recognition and the evolution of cheating and its impact on societies. Further, why social behaviour evolved in some lineages and not others is currently a topic of debate in behavioural ecology, and we argue that spiders offer an opportunity to untangle the ecological causes of parental care, which forms the basis of many other animal societies. © 2013 The Authors. Biological Reviews © 2013 Cambridge Philosophical Society.

Checklist of spider fauna of FR Peshawar, FATA, Pakistan

Directory of Open Access Journals (Sweden)

F. Perveen

2012-03-01

Full Text Available The spiders are known as poisonous arthropods, but they also act as the predator or biological pests control agent. Their 23 species belonging to 15 genera and 09 families were reported during 2009-2010 from FR Peshawar, FATA, Pakistan. The reported families Clubionidae, Scytodidae and Sprassidae covered each 4%, Araneidae, Gnaphosidae, Pholicidae and Salticidae each 9%, Thomisidae 13% and Lycosidae 43% biodiversity of spiders of FATA. However, the largest spider collected was huntsman, Isopoda tuhodnigra (Barrion with total body length 15.80+-0.83 mm. Moreover, the smallest spider was wolf spider, Pardosa birmanica (Simon with total body length 4.20+-1.30 mm. Further, the crab spiders, Thomisus pugilis (Stoliczka, T. spectabilis (Doleschall and Diaea evanida (Thorell were the most colorful species belonging to family Thomisidae. A detail study is required for further exploration of spider fauna of FATA.

Inbreeding avoidance in spiders: evidence for rescue effect in fecundity of female spiders with outbreeding opportunity

DEFF Research Database (Denmark)

Bilde, T.; Maklakov, A.A.; Schilling, Nadia

2007-01-01

avoidance can be because of low risk of inbreeding, variation in tolerance to inbreeding or high costs of outbreeding. We examined the relationship between inbreeding depression and inbreeding avoidance adaptations under two levels of inbreeding in the spider Oedothorax apicatus, asking whether preference...... for unrelated sperm via pre- and/or post-copulatory mechanisms could restore female fitness when inbreeding depression increases. Using inbred isofemale lines we provided female spiders with one or two male spiders of different relatedness in five combinations: one male sib; one male nonsib; two male sibs; two...

Understanding Spider-Man: Your Everyday Superhero

OpenAIRE

Falk, Nicklas; Blomsterberg, Sofie Amalie; Suciu, Alice Sabrina; Pedersen, Mads Peter; Lucas, Vilhelm

2014-01-01

This project focuses on the understanding of Spider-Man, and the morals and ethics that lie behind the choices he makes. Through the Dimensions Philosophy & Science/Text & Sign, this understanding is concluded by looking at ethical theories and comic book analysis. Based on the Ultimate Spider-Man comic book series, the aim is to clarify who Spider-Man is and what causes him to act in certain ways; before and after his realization of power. Some theories used to investigate these area...

[Genetic passportization and identification of Siberian cranes (Grus leucogeranus Pallas) in captivity].

Science.gov (United States)

Mudrik, E A; Kashentseva, T A; Gamburg, E A; Politov, D V

2014-01-01

The genetic diversity of the founders of an artificial population of the Siberian crane Grus leucogeranus Pallas (rare species of cranes) was characterized using 10 microsatellite loci. It was established that the allelic diversity (on average, 5.9 alleles per locus) and genic (H(o) = 0.739) diversity of the Siberian crane is rather high and comparable with the estimations for natural populations of different crane species. Genetic passportization of the birds (119 individuals) from the register of the Siberian crane International Studbook was carried out at the initial stage. The efficiency of genetic passportization for individual identification, identification of the origin, paternity analysis, and exclusion of inbreeding was demonstrated in Siberian cranes under natural mating and artificial insemination. Cases of natural reproduction in pairs of Siberian cranes imprinted to the human and continuous storage of spermatozoa in the female reproductive ducts were registered.

On the colours of spider orb-webs

Energy Technology Data Exchange (ETDEWEB)

Suhr, Wilfried; Schlichting, H Joachim, E-mail: wilfried.suhr@uni-muenster.de, E-mail: schlichting@uni-muenster.de [Institut fuer Didaktik der Physik, University of Muenster, 48149 Muenster (Germany)

2011-03-15

A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

On the colours of spider orb-webs

International Nuclear Information System (INIS)

Suhr, Wilfried; Schlichting, H Joachim

2011-01-01

A sticky capture thread from the spiral element of spider orb-webs is formed of almost regularly spaced droplets that surround a supporting axial fibre. From the perspective of physical optics it represents a periodic linear array of scattering elements that acts as a diffraction grating. This is a novel aspect, which is of vital importance for the understanding of the overall scattering pattern. To demonstrate its significance, we present our experimental findings and compare them with results of a simplified model.

VIPR III VADR SPIDER Structural Design and Analysis

Science.gov (United States)

Li, Wesley; Chen, Tony

2016-01-01

In support of the National Aeronautics and Space Administration (NASA) Vehicle Integrated Propulsion Research (VIPR) Phase III team to evaluate the volcanic ash environment effects on the Pratt & Whitney F117-PW-100 turbofan engine, NASA Armstrong Flight Research Center has successfully performed structural design and analysis on the Volcanic Ash Distribution Rig (VADR) and the Structural Particulate Integration Device for Engine Research (SPIDER) for the ash ingestion test. Static and dynamic load analyses were performed to ensure no structural failure would occur during the test. Modal analysis was conducted, and the results were used to develop engine power setting avoidance zones. These engine power setting avoidance zones were defined to minimize the dwell time when the natural frequencies of the VADR/SPIDER system coincided with the excitation frequencies of the engine which was operating at various revolutions per minute. Vortex-induced vibration due to engine suction air flow during the ingestion test was also evaluated, but was not a concern.

Observation of sandhill cranes' (Grus canadensis) flight behavior in heavy fog

Science.gov (United States)

Kirsch, Eileen M.; Wellik, Mike J.; Suarez, Manuel J.; Diehl, Robert H.; Lutes, Jim; Woyczik, Wendy; Krapfl, Jon; Sojda, Richard S.

2015-01-01

The behaviors of birds flying in low visibility conditions remain poorly understood. We had the opportunity to monitor Sandhill Cranes (Grus canadensis) flying in heavy fog with very low visibility during a comprehensive landscape use study of refuging cranes in the Horicon Marsh in southeastern Wisconsin. As part of the study, we recorded flight patterns of cranes with a portable marine radar at various locations and times of day, and visually counted cranes as they departed the roost in the morning. We compared flight patterns during a fog event with those recorded during clear conditions. In good visibility, cranes usually departed the night roost shortly after sunrise and flew in relatively straight paths toward foraging areas. In fog, cranes departed the roost later in the day, did not venture far from the roost, engaged in significantly more circling flight, and returned to the roost site rather than proceeding to foraging areas. We also noted that compared to mornings with good visibility, cranes flying in fog called more frequently than usual. The only time in this 2-year study that observers heard young of the year calling was during the fog event. The observed behavior of cranes circling and lingering in an area while flying in poor visibility conditions suggests that such situations may increase chances of colliding with natural or anthropogenic obstacles in the vicinity.

The design of in-cell crane handling systems for nuclear plants

International Nuclear Information System (INIS)

Hansford, S.M.; Scott, R.

1992-01-01

The reprocessing and waste management facilities at (BNFL's) British Nuclear Fuels Limited's Sellafield site make extensive use of crane handling systems. These range from conventional mechanical handling operations as used generally in industry to high integrity applications through to remote robotic handling operations in radiation environments. This paper describes the design methodologies developed for the design of crane systems for remote handling operations - in-cell crane systems. In most applications the in-cell crane systems are an integral part of the plant process equipment and reliable and safe operations are a key design parameter. Outlined are the techniques developed to achieve high levels of crane system availability for operations in hazardous radiation environments. These techniques are now well established and proven through many years of successful plant operation. A recent application of in-cell crane handling systems design for process duty application is described. The benefits of a systematic design approach and a functionally-based engineering organization are also highlighted. (author)

Learned predation risk management by spider mites

Directory of Open Access Journals (Sweden)

Thomas eHackl

2014-09-01

Full Text Available Predation is a prime selective force shaping prey behavior. Investment in anti-predator behavior is traded-off against time and energy for other fitness-enhancing activities such as foraging or reproduction. To optimize this benefit/cost trade-off, prey should be able to innately and/or by experience modulate their behavior to the level of predation risk. Here, we assessed learned predation risk management in the herbivorous two-spotted spider mite Tetranychus urticae. We exposed spider mites coming from benign (naïve or high immediate predation risk (experienced environments to latent and/or no risk and assessed their site choice, activity and oviposition. Benign environments were characterized by the absence of any predator cues, high immediate risk environments by killed spider mites, physical presence of the predatory mite Phytoseiulus persimilis and associated chemosensory traces left on the surface, and latent risk environments by only predator traces. In the no-choice experiment both naïve and experienced spider mites laid their first egg later on leaves with than without predator traces. Irrespective of predator traces presence/absence, experienced mites laid their first egg earlier than naïve ones did. Naïve spider mites were more active, indicating higher restlessness, and laid fewer eggs on leaves with predator traces, whereas experienced mites were less active and laid similar numbers of eggs on leaves with and without predator traces. In the choice experiment both naïve and experienced spider mites preferentially resided and oviposited on leaves without predator traces but experienced mites were less active than naïve ones. Overall, our study suggests that spider mites experienced with high predation risk behave bolder under latent risk than naïve spider mites. Since predator traces alone do not indicate immediate risk, we argue that the attenuated anti-predator response of experienced spider mites represents adaptive learned

The influence of diet composition upon growth and development of sandhill cranes

Science.gov (United States)

Serafin, J.A.

1982-01-01

Experiments were conducted to evaluate the effect of protein, metabolizable energy, and sulfur amino acid content of five diets upon growth and development of captive Florida Sandhill Crane (Grus canadensis pratensis) and Greater Sandhill Crane (G. c. tabida) chicks raised under controlled conditions. A high protein (32%) diet resulted in faster growth than that obtained when a lower protein (24%) ration was supplied. Florida Sandhill Crane chicks fed a diet containing 2,160 kcal/kg grew significantly slower than chicks fed a ration containing 2,830 kcal/kg. Reducing the sulfur amino acid content of a ration containing 24% protein from 0.88% to 0.73% significantly slowed the growth of young cranes. A 17% incidence of leg disorders and a 25% incidence of wing abnormalities occurred between 7 and 28 days of age among Greater Sandhill Cranes fed a high protein diet. Florida Sandhill Cranes grew slower than Greater Sandhill Cranes irrespective of the type of ration they were provided and did not develop leg or wing abnormalities. Abnormalities invariably developed only in the most rapidly growing Greater Sandhill Cranes. Diets that promoted slower growth reduced the incidence of abnormalities. A ration formulated to contain a low (0.73%) sulfur amino acid level appeared to be the most suitable for slowing growth rates of captive-reared Sandhill Cranes and reducing the risk of abnormaiwing or leg development.

Development of sensorless easy-to-use overhead crane system via simulation based control

Science.gov (United States)

Tagawa, Yasutaka; Mori, Yoshihito; Wada, Masaomi; Kawajiri, Eisaku; Nouzuka, Kazuma

2016-09-01

This paper describes the newly developed overhead crane which has a sensorless vibration control system. Generally, loads which are carried by the overhead cranes are easy to vibrate and only skilled people can operate the cranes. Therefore, a lot of studies have been done to solve this problem by using feedback control with vibration sensors. However vibration sensors often break down in severe industrial environment and more reliable control systems are required. For this reason, we have been developing sensorless control system for overhead cranes. In this paper, we firstly introduce basic idea of simulation based control which is called IDCS, then overview and modeling of the overhead crane is presented. Next, the control system design of the overhead crane is discussed, and experimental results are shown for real overhead crane with 2 axes.

29 CFR 1919.72 - Annual examination of cranes.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Annual examination of cranes. 1919.72 Section 1919.72 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... examination of cranes. (a) In any year in which no quadrennial unit proof test is required, an examination...

Crane Scheduling for a Plate Storage

DEFF Research Database (Denmark)

Hansen, Jesper; Clausen, Jens

2002-01-01

Odense Steel Shipyard produces the worlds largest container ships. The first process of producing the steel ships is handling arrival and storage of steel plates until they are needed in production. This paper considers the problem of scheduling two cranes that carry out the movements of plates...... into, around and out of the storage. The system is required to create a daily schedule for the cranes, but also handle possible disruptions during the execution of the plan. The problem is solved with a Simulated Annealing algorithm....

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders.

Science.gov (United States)

Gan, Wenjin; Liu, Shengjie; Yang, Xiaodong; Li, Daiqin; Lei, Chaoliang

2015-09-24

A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders. © 2015. Published by The Company of Biologists Ltd.

Prey interception drives web invasion and spider size determines successful web takeover in nocturnal orb-web spiders

Directory of Open Access Journals (Sweden)

Wenjin Gan

2015-10-01

Full Text Available A striking feature of web-building spiders is the use of silk to make webs, mainly for prey capture. However, building a web is energetically expensive and increases the risk of predation. To reduce such costs and still have access to abundant prey, some web-building spiders have evolved web invasion behaviour. In general, no consistent patterns of web invasion have emerged and the factors determining web invasion remain largely unexplored. Here we report web invasion among conspecifics in seven nocturnal species of orb-web spiders, and examined the factors determining the probability of webs that could be invaded and taken over by conspecifics. About 36% of webs were invaded by conspecifics, and 25% of invaded webs were taken over by the invaders. A web that was built higher and intercepted more prey was more likely to be invaded. Once a web was invaded, the smaller the size of the resident spider, the more likely its web would be taken over by the invader. This study suggests that web invasion, as a possible way of reducing costs, may be widespread in nocturnal orb-web spiders.

First report of clinical presentation of a bite by a running spider, Philodromus sp. (Araneae: Philodromidae), with recommendations for spider bite management.

Science.gov (United States)

Coetzee, Maureen; Dippenaar, Ansie; Frean, John; Hunt, Richard H

2017-06-30

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders showing cytotoxic envenomation. Management of the bites should be as recommended for other cytotoxic spider bites.

Suspected fusariomycotoxicosis in sandhill cranes (Grus canadensis): clinical and pathological findings.

Science.gov (United States)

Roffe, Thomas J.; Stroud, Richard K.; Windingstad, Ronald M.

1989-01-01

In 1985 and 1986, large-scale natural die-offs of sandhill cranes in Texas were attributed to fusariomycotoxicosis. These birds demonstrated a progressive loss of motor control to the neck, wings, and legs. Based on necropsy and/or histopathology of 31 cranes, the most common lesions involved skeletal muscle and included hemorrhages, granulomatous myositis, thrombosis, and vascular degeneration. Serum chemistry results revealed that levels of creatinine kinase, aspartate aminotransferase, and alanine aminotransferase were above published normals. However, only alanine aminotransferase was higher in clinically affected cranes than in normal cranes collected from the same area.

Biomechanics of Spider Silks

Science.gov (United States)

2006-03-02

water and deformation conditions. Such fibres [Nexia ’ biosteel ’ silk ] were spun from recombinant silk ’cloned’ from Spidroin II and indeed show 67...SUBTITLE 5. FUNDING NUMBERS Biomechanics of Spider Silks F49620-03-1-0111 6. AUTHOR(S) Fritz Vollrath 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Perform Pro, WHSIDIOR, Oct 94 COVER SHEET FINAL (3rd Year) Report to AFOSR on: BIOMECHANICS OF SPIDER SILKS Fritz Vollrath, Oxford University, England

Mannesmann Demag crawler cranes give plants a big lift

International Nuclear Information System (INIS)

Anon.

1987-01-01

Preassembly of large reactor components reduces construction costs, but creates the need for cranes with larger lifting capacities. A German company is extending its range with a new crawler crane which will lift up to 1600t. (author)

135 tf climbing crane for the construction of large scale plants

International Nuclear Information System (INIS)

1981-01-01

Development of a larger capacity, wider working radius and higher lift climbing crane was in demand since the large block construction method become common in plant construction. At first, scaling up of the conventional climbing crane was planned. But, it turned out that the deflection at the top of the jib would cause the load to drift at takeoff in crane operation. Therefore, the crane was newly designed to solve the problem. Some of its advantage are as follows. (1) This crane can be used as either a climbing or a nonclimbing type depending on installation locations and objective plants. (2) Accurate and easy operation is achieved because of little deflection at the top of the jib. (3) Efficient crane operation is possible through high speed hoisting and slewing motions in frequent auxiliary hoisting operations. (4) The construction time can be shortened by adopting pin joints between the blocks and by reducing the number of assembling parts at the site. A nonclimbing type crane is now in operation at the nuclear power plant in Kashiwazaki and a climbing type will be in operation at the nuclear power plant in Fukushima this year. The report presents an outline of the specifications, structures and advantages. (author)

75 FR 42598 - Modification of Restricted Area R-3404; Crane, IN

Science.gov (United States)

2010-07-22

...-28632; Airspace Docket No. 07-ASW-3] RIN 2120-AA66 Modification of Restricted Area R-3404; Crane, IN... Restricted Area R-3404 at Crane, IN, in support of U.S. Navy ordnance demolition activities. The FAA is...) Crane's Demolition Range. DATES: Effective date 0901 UTC, September 23, 2010. FOR FURTHER INFORMATION...

Sex-specific kleptoparasitic foraging in ant-eating spiders

DEFF Research Database (Denmark)

Martisová, Martina; Bilde, T.; Pekar, Stano

2009-01-01

. To investigate this hypothesis, we studied the effect of sex and life history stage on the frequency of kleptoparasitism in ant-eating spiders of the genus Zodarion in the field. These spiders use a special capture technique involving a quick attack on an ant that is left unguarded by spiders for several minutes......, providing ample opportunities for kleptoparasitism. We found that adult females consistently hunted actively, while adult males ceased active prey capture and instead engaged in kleptoparasitism. Juvenile spiders were active hunters irrespective of sex. Consistent with an ontogenetic shift in foraging...

Pendulation control system and method for rotary boom cranes

Science.gov (United States)

Robinett, III, Rush D.; Groom, Kenneth N.; Feddema, John T.; Parker, Gordon G.

2002-01-01

A command shaping control system and method for rotary boom cranes provides a way to reduce payload pendulation caused by real-time input signals, from either operator command or automated crane maneuvers. The method can take input commands and can apply a command shaping filter to reduce contributors to payload pendulation due to rotation, elevation, and hoisting movements in order to control crane response and reduce tangential and radial payload pendulation. A filter can be applied to a pendulation excitation frequency to reduce residual radial pendulation and tangential pendulation amplitudes.

Specific predictive power of automatic spider-related affective associations for controllable and uncontrollable fear responses toward spiders

NARCIS (Netherlands)

Huijdlng, J; de Jong, PJ; Huijding, J.

This study examined the predictive power of automatically activated spider-related affective associations for automatic and controllable fear responses. The Extrinsic Affective Simon Task (EAST; De Houwer, 2003) was used to indirectly assess automatic spider fear-related associations. The EAST and

Control Strategy for Automatic Gantry Crane Systems: A Practical and Intelligent Approach

Directory of Open Access Journals (Sweden)

Wahyudi

2007-12-01

Full Text Available The use of gantry crane systems for transporting payload is very common in building constructions. However, moving the payload using the crane is not an easy task especially when strict specifications on the swing angle and on the transfer time need to be satisfied. Various attempts in controlling gantry cranes system based on open- loop and closed-loop control systems were proposed. However, most of the proposed controllers were designed based on the model and parameter of the crane system. In general, modeling and parameter identifications are troublesome and time consuming task. To overcome this problem, in this paper, a practical and intelligent control method for automatic gantry crane is introduced and evaluated experimentally. The results show that the proposed method is not only effective for controlling the crane but also robust to parameter variation.

Control Strategy for Automatic Gantry Crane Systems: A Practical and Intelligent Approach

Directory of Open Access Journals (Sweden)

Wahyudi

2008-11-01

Full Text Available The use of gantry crane systems for transporting payload is very common in building constructions. However, moving the payload using the crane is not an easy task especially when strict specifications on the swing angle and on the transfer time need to be satisfied. Various attempts in controlling gantry cranes system based on open- loop and closed-loop control systems were proposed. However, most of the proposed controllers were designed based on the model and parameter of the crane system. In general, modeling and parameter identifications are troublesome and time consuming task. To overcome this problem, in this paper, a practical and intelligent control method for automatic gantry crane is introduced and evaluated experimentally. The results show that the proposed method is not only effective for controlling the crane but also robust to parameter variation.

Distinct spinning patterns gain differentiated loading tolerance of silk thread anchorages in spiders with different ecology.

Science.gov (United States)

Wolff, Jonas O; van der Meijden, Arie; Herberstein, Marie E

2017-07-26

Building behaviour in animals extends biological functions beyond bodies. Many studies have emphasized the role of behavioural programmes, physiology and extrinsic factors for the structure and function of buildings. Structure attachments associated with animal constructions offer yet unrealized research opportunities. Spiders build a variety of one- to three-dimensional structures from silk fibres. The evolution of economic web shapes as a key for ecological success in spiders has been related to the emergence of high performance silks and thread coating glues. However, the role of thread anchorages has been widely neglected in those models. Here, we show that orb-web (Araneidae) and hunting spiders (Sparassidae) use different silk application patterns that determine the structure and robustness of the joint in silk thread anchorages. Silk anchorages of orb-web spiders show a greater robustness against different loading situations, whereas the silk anchorages of hunting spiders have their highest pull-off resistance when loaded parallel to the substrate along the direction of dragline spinning. This suggests that the behavioural 'printing' of silk into attachment discs along with spinneret morphology was a prerequisite for the evolution of extended silk use in a three-dimensional space. This highlights the ecological role of attachments in the evolution of animal architectures. © 2017 The Author(s).

Fuzzy Controllers for a Gantry Crane System with Experimental Verifications

Directory of Open Access Journals (Sweden)

Naif B. Almutairi

2016-01-01

Full Text Available The control problem of gantry cranes has attracted the attention of many researchers because of the various applications of these cranes in the industry. In this paper we propose two fuzzy controllers to control the position of the cart of a gantry crane while suppressing the swing angle of the payload. Firstly, we propose a dual PD fuzzy controller where the parameters of each PD controller change as the cart moves toward its desired position, while maintaining a small swing angle of the payload. This controller uses two fuzzy subsystems. Then, we propose a fuzzy controller which is based on heuristics. The rules of this controller are obtained taking into account the knowledge of an experienced crane operator. This controller is unique in that it uses only one fuzzy system to achieve the control objective. The validity of the designed controllers is tested through extensive MATLAB simulations as well as experimental results on a laboratory gantry crane apparatus. The simulation results as well as the experimental results indicate that the proposed fuzzy controllers work well. Moreover, the simulation and the experimental results demonstrate the robustness of the proposed control schemes against output disturbances as well as against uncertainty in some of the parameters of the crane.

Population structure, behavior, and current threats to the sarus crane (Grus antigone antigone in Nepal

Directory of Open Access Journals (Sweden)

Kamal Raj Gosai

2016-09-01

Full Text Available The sarus crane (Grus antigone antigone is listed as “vulnerable” in the International Union for Conservation of Nature (IUCN Red List of Threatened Species. Sarus cranes are distributed in the lowlands, but most live outside protected areas, especially in agricultural areas and wetlands of Nepal. The continuous expansion of agricultural land and the reduction of wetland habitats pose the greatest threats to the conservation of the species. We studied the sarus crane in the Rupandehi District of Nepal to understand their population structure, behavior, and current threats. We used the line (i.e., road transect method from August 2013 to February 2014. The study area contained 147 sarus cranes. Agricultural land and wetland areas contained the highest number of sarus cranes. Our analysis showed that the population of sarus crane in the area has declined since 2007. Most sarus cranes lived in pairs. A single flock contained 13 cranes at maximum. Sarus crane behavior was not significantly different before and after the breeding seasons. Human–sarus crane conflict began when cranes started utilizing agricultural areas. The main threats to the hatching success and survival of sarus cranes in the Rupendehi District are egg theft and the hunting of cranes for meat. The findings of this study establish baseline information on the overall conservation status, habitat availability, and ecological behavior of sarus cranes in the district. We propose regular surveys to monitor sarus crane population levels in the face of multiple anthropogenic threats to their survival.

30 CFR 56.16015 - Work or travel on overhead crane bridges.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Work or travel on overhead crane bridges. 56... Materials Storage and Handling § 56.16015 Work or travel on overhead crane bridges. No person shall work from or travel on the bridge of an overhead crane unless the bridge is provided with substantial...

30 CFR 57.16015 - Work or travel on overhead crane bridges.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Work or travel on overhead crane bridges. 57... MINES Materials Storage and Handling § 57.16015 Work or travel on overhead crane bridges. No person shall work from or travel on the bridge of an overhead crane unless the bridge is provided with...

Comparative assessment of anti-sway control strategy for tower crane system

Science.gov (United States)

Samin, Reza Ezuan; Mohamed, Zaharuddin

2017-09-01

Tower crane is also known as rotary crane and widely used in constructions due to limited human capability to carry the various types of load at the construction site. In general crane is used for the purpose of loading and unloading heavy material from one place to another. However, in order to transfer the material in minimum time from one location to another, swaying of the payload will occur. Hence, this research presents the investigation of tower crane system which mainly focusing on the swaying angle of the payload by implementing conventional and intelligent controllers. Its mathematical modeling is developed using the Newton's Second Law and simulation is done within the MATLAB/Simulink environment. Simulation results are presented in cart trajectory capability and payload sway angle reduction. A comparative assessment between conventional controller and intelligent controller for the tower crane system are presented and discussed. Furthermore, the effect of various rope length and payload mass of the tower crane system to the performance of trajectory capability and sway angle reduction are also presented and discussed.

Cold Vacuum Drying facility crane and hoist system design description

International Nuclear Information System (INIS)

PITKOFF, C.C.

1999-01-01

This document describes the Cold Vacuum Drying Facility (CVDF) crane and hoist system. The overhead crane and hoist system is located in the process bays of the CVDF. It supports the processes required to drain the water and dry the spent nuclear fuel contained in the multi-canister overpacks after they have been removed from the K-Basins. The cranes will also be used to assist maintenance activities within the bays, as required

Pathology and pathogenesis of disseminated visceral coccidiosis in cranes.

Science.gov (United States)

Novilla, Meliton N; Carpenter, James W

2004-06-01

Disseminated visceral coccidiosis (DVC) caused by Eimeria spp. was recognized as a disease entity in captive sandhill cranes (Grus canadensis) and whooping cranes (Grus americana) in the late 1970s. While most avian species of Eimeria inhabit the intestinal tract of its host, the crane eimerians, Eimeria reichenowi and Eimeria gruis, invade and multiply systemically and complete their development in both digestive and respiratory tracts. In DVC, cranes, especially chicks, may succumb to acute infections resulting in hepatitis, bronchopneumonia, myocarditis, splenitis, and enteritis. Cranes may also develop chronic, subclinical infections characterized by granulomatous nodules in various organs and tissues. This paper reviews the pathology and pathogenicity of natural and experimental DVC in sandhill and whooping cranes. Naturally infected birds appeared clinically normal, but progressive weakness, emaciation, greenish diarrhea, and recumbency before death were observed in birds administered doses > or = 10 x 10(3) sporulated oocysts per os. At necropsy, naturally infected birds had nodules in the mucosa of the oral cavity and the esophagus, and in thoracic and abdominal viscera. Experimentally infected birds necropsied less than 7 days after infection (a.i.) had no gross lesions. Birds examined later had hepatosplenomegaly, liver mottling, lung congestion and consolidation with frothy fluid in airways, and turgid intestinal tracts with hyperemic mucosa. From 28 days a.i., grossly visible granulomatous nodules were seen in the esophagus, heart, liver, cloaca, and eyelids. By light microscopy, the basic host response was a granulomatous inflammation with non-suppurative vasculitis affecting many organs and tissues. With time, multifocal aggregates of mononuclear cells, many laden with asexual coccidial stages, increased in size and number. Widespread merogony resulted in morbidity and death, particularly in birds administered 20 x 10(3) sporulated oocysts

Annual survival rate estimate of satellite transmitter–marked eastern population greater sandhill cranes

Science.gov (United States)

Fronczak, David L.; Andersen, David E.; Hanna, Everett E.; Cooper, Thomas R.

2015-01-01

Several surveys have documented the increasing population size and geographic distribution of Eastern Population greater sandhill cranes Grus canadensis tabida since the 1960s. Sport hunting of this population of sandhill cranes started in 2012 following the provisions of the Eastern Population Sandhill Crane Management Plan. However, there are currently no published estimates of Eastern Population sandhill crane survival rate that can be used to inform harvest management. As part of two studies of Eastern Population sandhill crane migration, we deployed solar-powered global positioning system platform transmitting terminals on Eastern Population sandhill cranes (n  =  42) at key concentration areas from 2009 to 2012. We estimated an annual survival rate for Eastern Population sandhill cranes from data resulting from monitoring these cranes by using the known-fates model in the MARK program. Estimated annual survival rate for adult Eastern Population sandhill cranes was 0.950 (95% confidence interval  =  0.885–0.979) during December 2009–August 2014. All fatalities (n  =  5) occurred after spring migration in late spring and early summer. We were unable to determine cause of death for crane fatalities in our study. Our survival rate estimate will be useful when combined with other population parameters such as the population index derived from the U.S. Fish and Wildlife Service fall survey, harvest, and recruitment rates to assess the effects of harvest on population size and trend and evaluate the effectiveness of management strategies.

Disentangling the phylogenetic and ecological components of spider phenotypic variation.

Science.gov (United States)

Gonçalves-Souza, Thiago; Diniz-Filho, José Alexandre Felizola; Romero, Gustavo Quevedo

2014-01-01

An understanding of how the degree of phylogenetic relatedness influences the ecological similarity among species is crucial to inferring the mechanisms governing the assembly of communities. We evaluated the relative importance of spider phylogenetic relationships and ecological niche (plant morphological variables) to the variation in spider body size and shape by comparing spiders at different scales: (i) between bromeliads and dicot plants (i.e., habitat scale) and (ii) among bromeliads with distinct architectural features (i.e., microhabitat scale). We partitioned the interspecific variation in body size and shape into phylogenetic (that express trait values as expected by phylogenetic relationships among species) and ecological components (that express trait values independent of phylogenetic relationships). At the habitat scale, bromeliad spiders were larger and flatter than spiders associated with the surrounding dicots. At this scale, plant morphology sorted out close related spiders. Our results showed that spider flatness is phylogenetically clustered at the habitat scale, whereas it is phylogenetically overdispersed at the microhabitat scale, although phylogenic signal is present in both scales. Taken together, these results suggest that whereas at the habitat scale selective colonization affect spider body size and shape, at fine scales both selective colonization and adaptive evolution determine spider body shape. By partitioning the phylogenetic and ecological components of phenotypic variation, we were able to disentangle the evolutionary history of distinct spider traits and show that plant architecture plays a role in the evolution of spider body size and shape. We also discussed the relevance in considering multiple scales when studying phylogenetic community structure.

[Transcatheter embolization for huge pulmonary arteriovenous fistula using metallic "spider" and spring embolus--application of hand-made metallic "spider" using partial monorail technique].

Science.gov (United States)

Hirota, S; Sako, M; Fujita, Y; Hasegawa, Y; Sugimoto, K; Suzuki, Y; Kono, M

1992-07-25

We performed transcatheter embolization in two cases with huge pulmonary arteriovenous fistula (AVF) using a metallic "spider" and spring embolus. Conventional spring embolus or detachable balloon could not be used in these cases. Metallic spider was indicated for pulmonary AVF with a feeding artery diameter of more than 16 mm to prevent embolus passing through the AVF. In the first case, we used large handmade metallic spiders of 25 mm in diameter followed by embolization by numerous spring coils. At that time, a partial monorail technique was newly devised to carry the large metallic spider into the feeding artery, otherwise the spider could not pass into a 9F catheter. After embolization, symptoms and PaO2 in arterial blood improved remarkably in both cases. In the second case, a spring coil migrated into the normal pulmonary artery, but no infarction resulted. In conclusion, the metallic spider was very useful for embolization of hugee pulmonary AVF to avoid the embolus passing through and to tangle spring coils together with it. If commercially available "spiders" are too small, ones can be made easily.

Second-order nonlinear optical microscopy of spider silk

Science.gov (United States)

Zhao, Yue; Hien, Khuat Thi Thu; Mizutani, Goro; Rutt, Harvey N.

2017-06-01

Asymmetric β-sheet protein structures in spider silk should induce nonlinear optical interaction such as second harmonic generation (SHG) which is experimentally observed for a radial line and dragline spider silk using an imaging femtosecond laser SHG microscope. By comparing different spider silks, we found that the SHG signal correlates with the existence of the protein β-sheets. Measurements of the polarization dependence of SHG from the dragline indicated that the β-sheet has a nonlinear response depending on the direction of the incident electric field. We propose a model of what orientation the β-sheet takes in spider silk.

Habitat preferences and conservation threats to Black-necked Cranes wintering in Bhutan.

Science.gov (United States)

Namgay, Rinchen; Wangchuk, Sangay

2016-01-01

Black-necked Crane (Grus nigricollis) is a vulnerable Red list species whose populations are declining. However, little is known about Black-necked Cranes' habitat requirements or the causes of their population decline. We identified Black-necked Cranes' winter roost and foraging preferences of Black-necked Cranes in Bhutan during the winter of 2013-2014. Black-necked Cranes' roosts were recorded using Garmin GPSmap 60CSx, while foraging preferences and threats to the birds were identified based on a survey of household heads (n = 107) residing within a 3 km radius of roost sites. We grouped the threats identified by the communities into four major categories, viz. biological, social, political and natural threats based on the relevance. Of the four major threats, communities residing within the roosting and foraging habitat of the Black-necked Crane reported biological threat as major. Biological threats as reported by communities include loss of habitat, food shortage and competition from other animals. We recommend the present roosting areas be designated as part of the conservation areas for Black-necked Crane wintering in Bumthang district. In addition to preserving these areas, government should also encourage farming in foraging habitats of Black-necked Crane, because they mainly feed on barley, wheat, paddy, potatoes and buckwheat, besides roots, tubers and insects in the wetlands.

New Types of Behavioral Manipulation of Host Spiders by a Parasitoid Wasp

Directory of Open Access Journals (Sweden)

William G. Eberhard

2010-01-01

Full Text Available The larva of the parasitic wasp Zatypota sp. nr. solanoi induces its host spiders Anelosimus spp. to modify its web in ways not seen in normal webs of this species or in any other species, providing apparent protection and support for the wasp's cocoon by covering the entire web with a protective sheet and adding a central platform and opening a space below in the enclosed tangle, where the larva suspends its cocoon. These modifications differ qualitatively from those induced by a congeneric wasp. Parasitized spiders appeared to adjust modified web construction behavior to local conditions, implying that larval manipulations may occur at higher rather than lower levels of behavioral control (e.g., eliciting overall design decisions, rather than particular motor patterns.

Analysis of frame structure of medium and small truck crane

Science.gov (United States)

Cao, Fuyi; Li, Jinlong; Cui, Mengkai

2018-03-01

Truck crane is an important part of hoisting machinery. Frame, as the support component of the quality of truck crane, determines the safety of crane jib load and the rationality of structural design. In this paper, the truck crane frame is a box structure, the three-dimensional model is established in CATIA software, and imported into Hyperworks software for finite element analysis. On the base of doing constraints and loads for the finite element model of the frame, the finite element static analysis is carried out. And the static stress test verifies whether the finite element model and the frame structure design are reasonable; then the free modal analysis of the frame and the analysis of the first 8 - order modal vibration deformation are carried out. The analysis results show that the maximum stress value of the frame is greater than the yield limit value of the material, and the low-order modal value is close to the excitation frequency value, which needs to be improved to provide theoretical reference for the structural design of the truck crane frame.

Tangled in a sparse spider web

DEFF Research Database (Denmark)

Dimitrov, Dimitar Stefanov; Lopardo, Lara; Giribet, Gonzalo

2012-01-01

In order to study the tempo and the mode of spider orb web evolution and diversification, we conducted a phylogenetic analysis using six genetic markers along with a comprehensive taxon sample. The present analyses are the first to recover the monophyly of orb-weaving spiders based solely on DNA ...

Fatal injuries in the United States construction industry involving cranes 1984-1994.

Science.gov (United States)

Suruda, A; Liu, D; Egger, M; Lillquist, D

1999-12-01

There is little published information concerning the epidemiology of injuries in the construction industry involving cranes other than for electrical injury from power line contact. For the 11-year period of 1984 through 1994, the US Occupational Safety and Health Administration (OSHA) investigated 502 deaths in 479 incidents involving cranes in the construction industry. Electrocution was the largest category, with 198 deaths (39%) reported. Other major categories were assembly/dismantling (58 deaths, 12%), boom buckling (41 deaths, 8%), crane upset/overturn (37 deaths, 7%), and rigging failure (36 deaths, 7%). The majority of the deaths during assembly/dismantling involved removal of the boom pins from lattice boom cranes. Only 34% of the construction firms employing the fatally injured workers had ever been inspected by OSHA. OSHA cited the employer for safety violations in 436 deaths (83%). Additional worker training, increased OSHA inspections, and crane inspection programs could prevent many crane-related deaths.

Sandhill cranes browse for food near VAB

Science.gov (United States)

2000-01-01

A family of sandhill cranes searches for food on the grounds near the Vehicle Assembly Building. The cranes have been a constant sight in the Launch Complex 39 area during the month of May. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Sclerotherapy of Varicose Veins and Spider Veins

Science.gov (United States)

... Index A-Z Sclerotherapy of Varicose Veins and Spider Veins Sclerotherapy uses injections from a very fine, ... Sclerotherapy? What is Sclerotherapy of Varicose Veins and Spider Veins? Sclerotherapy is a minimally invasive treatment used ...

Structure to function: Spider silk and human collagen

Science.gov (United States)

Rabotyagova, Olena S.

Nature has the ability to assemble a variety of simple molecules into complex functional structures with diverse properties. Collagens, silks and muscles fibers are some examples of fibrous proteins with self-assembling properties. One of the great challenges facing Science is to mimic these designs in Nature to find a way to construct molecules that are capable of organizing into functional supra-structures by self-assembly. In order to do so, a construction kit consisting of molecular building blocks along with a complete understanding on how to form functional materials is required. In this current research, the focus is on spider silk and collagen as fibrous protein-based biopolymers that can shed light on how to generate nanostructures through the complex process of self-assembly. Spider silk in fiber form offers a unique combination of high elasticity, toughness, and mechanical strength, along with biological compatibility and biodegrability. Spider silk is an example of a natural block copolymer, in which hydrophobic and hydrophilic blocks are linked together generating polymers that organize into functional materials with extraordinary properties. Since silks resemble synthetic block copolymer systems, we adopted the principles of block copolymer design from the synthetic polymer literature to build block copolymers based on spider silk sequences. Moreover, we consider spider silk to be an important model with which to study the relationships between structure and properties in our system. Thus, the first part of this work was dedicated to a novel family of spider silk block copolymers, where we generated a new family of functional spider silk-like block copolymers through recombinant DNA technology. To provide fundamental insight into relationships between peptide primary sequence, block composition, and block length and observed morphological and structural features, we used these bioengineered spider silk block copolymers to study secondary structure

Una red transmedia para el hombre araña: a propósito de Spider-Man Noir

Directory of Open Access Journals (Sweden)

Santiago García Sanz

2014-06-01

Full Text Available An almost one-century old genre, comic books have tried to find their space as a means of artistic expression since the very beginning. Emerging from Stan Lee’s creative genius in 1962 in a complete break with the hero archetype that prevailed for over two decades, and based on a pulp-literature vigilante, the Spider-Man is an atypical teenage hero that became an icon, not only of its publishing house, but of 20th-century Western popular culture. Throughout its history, the myth of the Spider-Man has undergone several revisions that fall within the American uchronic tradition in different media. Spider-Man Noir re-interprets the character as a crime detective and has eventually swung from paper to screens in order to thrive in the new century.

Characterization of gizzards and grits of wild cranes found dead at Izumi Plain in Japan.

Science.gov (United States)

Uegomori, Mima; Haraguchi, Yuko; Obi, Takeshi; Takase, Kozo

2018-04-18

We analyzed the gizzards, and grits retained in the gizzards of 41 cranes that migrated to the Izumi Plain during the winter of 2015/2016 and died there, either due to accident or disease. These included 31 Hooded Cranes (Grus monacha) and 10 White-naped Cranes (G. vipio). We determined body weight, gizzard weight, total grit weight and number per gizzard, and size, shape, and surface roundness of the grits. Average gizzard weights were 92.4 g for Hooded Cranes and 97.1 g for White-naped Cranes, and gizzard weight positively correlated with body weight in both species. Average total grit weights per gizzard were 19.7 g in Hooded Cranes and 25.7 g in White-naped Cranes, and were significantly higher in the latter. Average percentages of body weight to grit weight were 0.8% in Hooded Cranes and 0.5% in White-naped Cranes. Average grit number per gizzard was 693.5 in Hooded Cranes and 924.2 in White-naped Cranes, and were significantly higher in the latter. The average grit size was 2.8 mm in both species. No differences were found in the shape and surface roundness of grits between the two species. To the best of our knowledge, this is the first study on the grits retained in the gizzards of Hooded and White-naped Cranes.

Solid Modeling and Finite Element Analysis of an Overhead Crane Bridge

Directory of Open Access Journals (Sweden)

C. Alkin

2005-01-01

Full Text Available The design of an overhead crane bridge with a double box girder has been investigated and a case study of a crane with 35 ton capacity and 13 m span length has been conducted. In the initial phase of the case study, conventional design calculations proposed by F. E. M. Rules and DIN standards were performed to verify the stress and deflection levels. The crane design was modeled using both solids and surfaces. Finite element meshes with 4-node tetrahedral and 4-node quadrilateral shell elements were generated from the solid and shell models, respectively. After a comparison of the finite element analyses, the conventional calculations and performance of the existing crane, the analysis with quadratic shell elements was found to give the most realistic results. As a result of this study, a design optimization method for an overhead crane is proposed. 

Assassin bug uses aggressive mimicry to lure spider prey.

Science.gov (United States)

Wignall, Anne E; Taylor, Phillip W

2011-05-07

Assassin bugs (Stenolemus bituberus) hunt web-building spiders by invading the web and plucking the silk to generate vibrations that lure the resident spider into striking range. To test whether vibrations generated by bugs aggressively mimic the vibrations generated by insect prey, we compared the responses of spiders to bugs with how they responded to prey, courting male spiders and leaves falling into the web. We also analysed the associated vibrations. Similar spider orientation and approach behaviours were observed in response to vibrations from bugs and prey, whereas different behaviours were observed in response to vibrations from male spiders and leaves. Peak frequency and duration of vibrations generated by bugs were similar to those generated by prey and courting males. Further, vibrations from bugs had a temporal structure and amplitude that were similar to vibrations generated by leg and body movements of prey and distinctly different to vibrations from courting males or leaves, or prey beating their wings. To be an effective predator, bugs do not need to mimic the full range of prey vibrations. Instead bugs are general mimics of a subset of prey vibrations that fall within the range of vibrations classified by spiders as 'prey'.

Fusarium spp. recovered from waste peanuts associated with sandhill crane mortality

Science.gov (United States)

Nelson, P.E.; Cole, R.J.; Tousson, T.A.; Dorner, J.W.; Windingstad, R.M.

1990-01-01

Approximately 5000 sandhill cranes (Grus canadensis ) died from undetermined causes in Gains County, Texas, 1985, and an additional 200 died in 1986. Prominent clinical signs were the inability of many sick cranes to hold their necks horizontal and the neck, head, and legs sometimes drooped perpendicularly during flight. Approximately 95% of the dead cranes' gizzards contained peanuts. Culturing of peanuts, shells, soil and soil debris from fields in which sandhill cranes died showed that Fusarium species were the fungi most frequently isolated and eight species were recovered from these substrates. Fusarium compactum, F. solani , and F. equiseti were the only species recovered from all substrates cultured from both fields.

50 CFR 20.106 - Seasons, limits, and shooting hours for sandhill cranes.

Science.gov (United States)

2010-10-01

... sandhill cranes. 20.106 Section 20.106 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE..., and Shooting Hours Schedules § 20.106 Seasons, limits, and shooting hours for sandhill cranes. This section provides for the annual hunting of sandhill cranes in designated portions of the 48 contiguous...

Visual fields and eye morphology support color vision in a color-changing crab-spider.

Science.gov (United States)

Insausti, Teresita C; Defrize, Jérémy; Lazzari, Claudio R; Casas, Jérôme

2012-03-01

Vision plays a major role in many spiders, being involved in prey hunting, orientation or substrate choice, among others. In Misumena vatia, which experiences morphological color changes, vision has been reported to be involved in substrate color matching. Electrophysiological evidence reveals that at least two types of photoreceptors are present in this species, but these data are not backed up by morphological evidence. This work analyzes the functional structure of the eyes of this spider and relates it to its color-changing abilities. A broad superposition of the visual field of the different eyes was observed, even between binocular regions of principal and secondary eyes. The frontal space is simultaneously analyzed by four eyes. This superposition supports the integration of the visual information provided by the different eye types. The mobile retina of the principal eyes of this spider is organized in three layers of three different types of rhabdoms. The third and deepest layer is composed by just one large rhabdom surrounded by dark screening pigments that limit the light entry. The three pairs of secondary eyes have all a single layer of rhabdoms. Our findings provide strong support for an involvement of the visual system in color matching in this spider. Copyright © 2011 Elsevier Ltd. All rights reserved.

29 CFR 1910.180 - Crawler locomotive and truck cranes.

Science.gov (United States)

2010-07-01

... the shaft or spindle with which or about which a wheel rotates. On truck- and wheel-mounted cranes it... and ropes. Cranes designed for railway and automobile wreck clearances are excepted. The requirements..., 1971, shall meet the design specifications of the American National Standard Safety Code for Crawler...

Comprehensive and Highly Accurate Measurements of Crane Runways, Profiles and Fastenings.

Science.gov (United States)

Dennig, Dirk; Bureick, Johannes; Link, Johannes; Diener, Dmitri; Hesse, Christian; Neumann, Ingo

2017-05-13

The process of surveying crane runways has been continually refined due to the competitive situation, modern surveying instruments, additional sensors, accessories and evaluation procedures. Guidelines, such as the International Organization for Standardization (ISO) 12488-1, define target values that must be determined by survey. For a crane runway these are for example the span, the position and height of the rails. The process has to be objective and reproducible. However, common processes of surveying crane runways do not meet these requirements sufficiently. The evaluation of the protocols, ideally by an expert, requires many years of experience. Additionally, the recording of crucial parameters, e.g., the wear of the rail, or the condition of the rail fastening and rail joints, is not regulated and for that reason are often not considered during the measurement. To solve this deficit the Advanced Rail Track Inspection System (ARTIS) was developed. ARTIS is used to measure the 3D position of crane rails, the cross-section of the crane rails, joints and, for the first time, the (crane-rail) fastenings. The system consists of a monitoring vehicle and an external tracking sensor. It makes kinematic observations with the tracking sensor from outside the rail run, e.g., the floor of an overhead crane runway, possible. In this paper we present stages of the development process of ARTIS, new target values, calibration of sensors and results of a test measurement.

Assessment of the possibility of increasing a load - carrying strength of truss bridges of overhead travelling cranes

Directory of Open Access Journals (Sweden)

Michał MUSIOŁ

2012-01-01

Full Text Available A possibility of increasing the load-carrying strength of truss bridges of overhead travelling cranes by transferring a part of a useful load from the main truss (which transfers directly the load originated from road wheels of the crane carriage on the parallel auxiliary truss by means of increasing rigidity of truss members joining both trusses - was presented in the paper. The verification of a static relief of the main truss by the auxiliary one as a function of rigidity of transverse and skew space trusses was performed. The A. Blum method was used in analytical calculations. The obtained results were verified by means of the ANSYS 12.1 program utilising the finite element method (FEM.

Cuticular antifungals in spiders: density- and condition dependence.

Directory of Open Access Journals (Sweden)

Daniel González-Tokman

Full Text Available Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities. For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Cuticular antifungals in spiders: density- and condition dependence.

Science.gov (United States)

González-Tokman, Daniel; Ruch, Jasmin; Pulpitel, Tamara; Ponton, Fleur

2014-01-01

Animals living in groups face a high risk of disease contagion. In many arthropod species, cuticular antimicrobials constitute the first protective barrier that prevents infections. Here we report that group-living spiders produce cuticular chemicals which inhibit fungal growth. Given that cuticular antifungals may be costly to produce, we explored whether they can be modulated according to the risk of contagion (i.e. under high densities). For this purpose, we quantified cuticular antifungal activity in the subsocial crab spider Diaea ergandros in both natural nests and experimentally manipulated nests of varying density. We quantified the body-condition of spiders to test whether antifungal activity is condition dependent, as well as the effect of spider density on body-condition. We predicted cuticular antifungal activity to increase and body-condition to decrease with high spider densities, and that antifungal activity would be inversely related to body-condition. Contrary to our predictions, antifungal activity was neither density- nor condition-dependent. However, body-condition decreased with density in natural nests, but increased in experimental nests. We suggest that pathogen pressure is so important in nature that it maintains high levels of cuticular antifungal activity in spiders, impacting negatively on individual energetic condition. Future studies should identify the chemical structure of the isolated antifungal compounds in order to understand the physiological basis of a trade-off between disease prevention and energetic condition caused by group living, and its consequences in the evolution of sociality in spiders.

Cost-effectiveness analysis of sandhill crane habitat management

Science.gov (United States)

Kessler, Andrew C.; Merchant, James W.; Shultz, Steven D.; Allen, Craig R.

2013-01-01

Invasive species often threaten native wildlife populations and strain the budgets of agencies charged with wildlife management. We demonstrate the potential of cost-effectiveness analysis to improve the efficiency and value of efforts to enhance sandhill crane (Grus canadensis) roosting habitat. We focus on the central Platte River in Nebraska (USA), a region of international ecological importance for migrating avian species including sandhill cranes. Cost-effectiveness analysis is a valuation process designed to compare alternative actions based on the cost of achieving a pre-determined objective. We estimated costs for removal of invasive vegetation using geographic information system simulations and calculated benefits as the increase in area of sandhill crane roosting habitat. We generated cost effectiveness values for removing invasive vegetation on 7 land parcels and for the entire central Platte River to compare the cost-effectiveness of management at specific sites and for the central Platte River landscape. Median cost effectiveness values for the 7 land parcels evaluated suggest that costs for creating 1 additional hectare of sandhill crane roosting habitat totaled US $1,595. By contrast, we found that creating an additional hectare of sandhill crane roosting habitat could cost as much as US $12,010 for some areas in the central Platte River, indicating substantial cost savings can be achieved by using a cost effectiveness analysis to target specific land parcels for management. Cost-effectiveness analysis, used in conjunction with geographic information systems, can provide decision-makers with a new tool for identifying the most economically efficient allocation of resources to achieve habitat management goals.

29 CFR 1919.28 - Unit proof tests-cranes and gear accessory thereto.

Science.gov (United States)

2010-07-01

... 29 Labor 7 2010-07-01 2010-07-01 false Unit proof tests-cranes and gear accessory thereto. 1919.28... Loads; Heat Treatment; Competent Persons § 1919.28 Unit proof tests—cranes and gear accessory thereto. (a) Except as noted in paragraph (e) of this section, cranes and other hoisting machines, together...

Crane Safety Assessment Method Based on Entropy and Cumulative Prospect Theory

Directory of Open Access Journals (Sweden)

Aihua Li

2017-01-01

Full Text Available Assessing the safety status of cranes is an important problem. To overcome the inaccuracies and misjudgments in such assessments, this work describes a safety assessment method for cranes that combines entropy and cumulative prospect theory. Firstly, the proposed method transforms the set of evaluation indices into an evaluation vector. Secondly, a decision matrix is then constructed from the evaluation vectors and evaluation standards, and an entropy-based technique is applied to calculate the index weights. Thirdly, positive and negative prospect value matrices are established from reference points based on the positive and negative ideal solutions. Thus, this enables the crane safety grade to be determined according to the ranked comprehensive prospect values. Finally, the safety status of four general overhead traveling crane samples is evaluated to verify the rationality and feasibility of the proposed method. The results demonstrate that the method described in this paper can precisely and reasonably reflect the safety status of a crane.

Brain systems underlying encounter expectancy bias in spider phobia.

Science.gov (United States)

Aue, Tatjana; Hoeppli, Marie-Eve; Piguet, Camille; Hofstetter, Christoph; Rieger, Sebastian W; Vuilleumier, Patrik

2015-06-01

Spider-phobic individuals are characterized by exaggerated expectancies to be faced with spiders (so-called encounter expectancy bias). Whereas phobic responses have been linked to brain systems mediating fear, little is known about how the recruitment of these systems relates to exaggerated expectancies of threat. We used fMRI to examine spider-phobic and control participants while they imagined visiting different locations in a forest after having received background information about the likelihood of encountering different animals (spiders, snakes, and birds) at these locations. Critically, imagined encounter expectancies modulated brain responses differently in phobics as compared with controls. Phobics displayed stronger negative modulation of activity in the lateral prefrontal cortex, precuneus, and visual cortex by encounter expectancies for spiders, relative to snakes or birds (within-participants analysis); these effects were not seen in controls. Between-participants correlation analyses within the phobic group further corroborated the hypothesis that these phobia-specific modulations may underlie irrationality in encounter expectancies (deviations of encounter expectancies from objective background information) in spider phobia; the greater the negative modulation a phobic participant displayed in the lateral prefrontal cortex, precuneus, and visual cortex, the stronger was her bias in encounter expectancies for spiders. Interestingly, irrationality in expectancies reflected in frontal areas relied on right rather than left hemispheric deactivations. Our data accord with the idea that expectancy biases in spider phobia may reflect deficiencies in cognitive control and contextual integration that are mediated by right frontal and parietal areas.

An influence of technological contraflexure of crane bridges on its durability

Directory of Open Access Journals (Sweden)

Artur BLUM

2010-01-01

Full Text Available Standard requirements till 1996 year during bridge crane manufacturing demanded a positive technological contraflexure. As a result of this process were implemented technological compressive stress into tensile zone from inertial and operational loads and tensile stress into compressive zone. This way there were redistributed resultant stress which have increased fatigue strength of exploited crane bridges. Actually valid standard PN-ISO 7363 has removed this obligatory requirement. Its use depends of crane buyer demands. Reduction of initial positive deflection can be seen after few years of crane operations. It is a case of girders permanent deflections increment. Article presents method of technological prestressing of bridge girders with its practical application to obtain positive contrafexure.

Changes of mercury contamination in red-crowned cranes, Grus japonensis, in East Hokkaido, Japan.

Science.gov (United States)

Teraoka, Hiroki; Tagami, Yukari; Kudo, Moe; Miura, Yoshiaki; Okamoto, Erika; Matsumoto, Fumio; Koga, Kimiya; Uebayashi, Akiko; Shimura, Ryoji; Inoue, Masako; Momose, Kunikazu; Masatomi, Hiroyuki; Kitazawa, Takio; Hiraga, Takeo; Subramanian, Annamalai

2012-07-01

Red-crowned cranes (Grus japonensis) are native to eastern Hokkaido (island population), in contrast to the mainland, which migrates between the Amur River basin and eastern China-Korea peninsula. During the 1990s we found that Red-crowned cranes in Hokkaido were highly contaminated with mercury: however, the source was unknown. We investigated the time trend of mercury contamination in Red-crowned cranes. Total mercury levels in the livers and kidneys from cranes dead in the 2000s were lower than those dead in the 1990s. Feather is a major pathway of mercury excretion for many bird species and is used as an indicator of blood mercury level during feather growth. As internal organs from the specimens collected before 1988 were not available, we analyzed the flight feather shavings from stuffed Red-crowned cranes dead in 1959-1987 and found that the mercury level of feathers from cranes dead in the 1960s and 1970s was not more than those from the cranes dead in the 2000s. These results suggest that mercury contamination in Red-crowned cranes in Hokkaido decreased temporally during the 1990s-2000s. This indicates the possible occurrence of some mercury pollution in Red-crowned cranes' habitat in this region in the 1990s or before.

Habitat-dependent changes in vigilance behaviour of Red-crowned Crane influenced by wildlife tourism.

Science.gov (United States)

Li, Donglai; Liu, Yu; Sun, Xinghai; Lloyd, Huw; Zhu, Shuyu; Zhang, Shuyan; Wan, Dongmei; Zhang, Zhengwang

2017-11-30

The Endangered Red-crowned Crane (Grus japonensis) is one of the most culturally iconic and sought-after species by wildlife tourists. Here we investigate how the presence of tourists influence the vigilance behaviour of cranes foraging in Suaeda salsa salt marshes and S. salsa/Phragmites australis mosaic habitat in the Yellow River Delta, China. We found that both the frequency and duration of crane vigilance significantly increased in the presence of wildlife tourists. Increased frequency in crane vigilance only occurred in the much taller S. salsa/P. australis mosaic vegetation whereas the duration of vigilance showed no significant difference between the two habitats. Crane vigilance declined with increasing distance from wildlife tourists in the two habitats, with a minimum distance of disturbance triggering a high degree of vigilance by cranes identified at 300 m. The presence of wildlife tourists may represent a form of disturbance to foraging cranes but is habitat dependent. Taller P. australis vegetation serves primarily as a visual obstruction for cranes, causing them to increase the frequency of vigilance behaviour. Our findings have important implications for the conservation of the migratory red-crowned crane population that winters in the Yellow River Delta and can help inform visitor management.

The aerodynamic signature of running spiders.

Directory of Open Access Journals (Sweden)

Jérôme Casas

Full Text Available Many predators display two foraging modes, an ambush strategy and a cruising mode. These foraging strategies have been classically studied in energetic, biomechanical and ecological terms, without considering the role of signals produced by predators and perceived by prey. Wolf spiders are a typical example; they hunt in leaf litter either using an ambush strategy or by moving at high speed, taking over unwary prey. Air flow upstream of running spiders is a source of information for escaping prey, such as crickets and cockroaches. However, air displacement by running arthropods has not been previously examined. Here we show, using digital particle image velocimetry, that running spiders are highly conspicuous aerodynamically, due to substantial air displacement detectable up to several centimetres in front of them. This study explains the bimodal distribution of spider's foraging modes in terms of sensory ecology and is consistent with the escape distances and speeds of cricket prey. These findings may be relevant to the large and diverse array of arthropod prey-predator interactions in leaf litter.

Biotechnological Trends in Spider and Scorpion Antivenom Development

DEFF Research Database (Denmark)

Laustsen, Andreas Hougaard; Solà, Mireia; Jappe, Emma Christine

2016-01-01

in using bioactive toxins from spiders and scorpions for drug discovery purposes and for solving crystal structures of membrane-embedded receptors. Additionally, the identification and isolation of a myriad of spider and scorpion toxins has allowed research within next generation antivenoms to progress...... at an increasingly faster pace. In this review, the current knowledge of spider and scorpion venoms is presented, followed by a discussion of all published biotechnological efforts within development of spider and scorpion antitoxins based on small molecules, antibodies and fragments thereof, and next generation...... immunization strategies. The increasing number of discovery and development efforts within this field may point towards an upcoming transition from serum-based antivenoms towards therapeutic solutions based on modern biotechnology....

An Agent-Based Solution Framework for Inter-Block Yard Crane Scheduling Problems

Directory of Open Access Journals (Sweden)

Omor Sharif

2012-06-01

Full Text Available The efficiency of yard operations is critical to the overall productivity of a container terminal because the yard serves as the interface between the landside and waterside operations. Most container terminals use yard cranes to transfer containers between the yard and trucks (both external and internal. To facilitate vessel operations, an efficient work schedule for the yard cranes is necessary given varying work volumes among yard blocks with different planning periods. This paper investigated an agent-based approach to assign and relocate yard cranes among yard blocks based on the forecasted work volumes. The goal of our study is to reduce the work volume that remains incomplete at the end of a planning period. We offered several preference functions for yard cranes and blocks which are modeled as agents. These preference functions are designed to find effective schedules for yard cranes. In addition, we examined various rules for the initial assignment of yard cranes to blocks. Our analysis demonstrated that our model can effectively and efficiently reduce the percentage of incomplete work volume for any real-world sized problem.

Rope NDT as means to raise safety of crane and elevator use

Energy Technology Data Exchange (ETDEWEB)

Kotelnikov, V. [Gosgortechnadzor, Moscow (Russian Federation); Sukhorukov, V. [Intron Plus, Ltd., Moscow (Russian Federation)

2006-03-15

Steel rope NDT by magnetic flaw detectors is usual for mine hoist inspection through the world. But it is no ordinary by crane and especially by elevator inspection. However, magnetic NDT statistic data of 60 crane and 227 elevator ropes in use shows that about 23% of crane and 9% of elevator ropes should be discarded in accordance with actual discarding criterion in Russia. Russian State Rules for crane safe exploitation require the magnetic NDT while periodically inspection. But not all the inspecting companies meet it in Russia, contenting themselves by visual inspection only. This is not objective and does not provide rope inner faults detection. That is a reason of rope break rather high percentage in general statistics of crane accidents and damages. Investigation of accidents with crane ropes in Moscow region in 2001 shows that they would de prevented by the magnetic NDT fulfilled timely. The elevator rope NDT problem is not so sharp but attention should de attracted to it to raise safety of elevators. (author)

Rope NDT as means to raise safety of crane and elevator use

International Nuclear Information System (INIS)

Kotelnikov, V.; Sukhorukov, V.

2006-01-01

Steel rope NDT by magnetic flaw detectors is usual for mine hoist inspection through the world. But it is no ordinary by crane and especially by elevator inspection. However, magnetic NDT statistic data of 60 crane and 227 elevator ropes in use shows that about 23% of crane and 9% of elevator ropes should be discarded in accordance with actual discarding criterion in Russia. Russian State Rules for crane safe exploitation require the magnetic NDT while periodically inspection. But not all the inspecting companies meet it in Russia, contenting themselves by visual inspection only. This is not objective and does not provide rope inner faults detection. That is a reason of rope break rather high percentage in general statistics of crane accidents and damages. Investigation of accidents with crane ropes in Moscow region in 2001 shows that they would de prevented by the magnetic NDT fulfilled timely. The elevator rope NDT problem is not so sharp but attention should de attracted to it to raise safety of elevators. (author)

Modelling and Simulation of Mobile Hydraulic Crane with Telescopic Arm

DEFF Research Database (Denmark)

Nielsen, Brian; Pedersen, Henrik Clemmensen; Andersen, Torben Ole

2005-01-01

For loader crane applications resolved motion control is assumed to be one of the areas for development in the future. To develop and evaluate different control strategies for a resolved motion control system, information about the dynamic behaviour of these cranes is necessary. In the current...... paper a model of a loader crane with a flexible telescopic arm is presented, which may be used for evaluating control strategies. The telescopic arm is operated by four actuators connected hydraulically by a parallel circuit. The operating sequences of the individual actuators is therefore...

Wattled Crane ( Grus carunculatus ) research and monitoring in the ...

African Journals Online (AJOL)

This shows that the Okavango Delta holds the largest single population of Wattled Cranes in the world, containing over 16% of the global population estimate of <7 700 individuals. The main distribution of Wattled Cranes was the Jao/Boro, Nqoga and Khwai/Muanachira River systems, coinciding with the wettest and most ...

Biased interpretation and memory in children with varying levels of spider fear.

Science.gov (United States)

Klein, Anke M; Titulaer, Geraldine; Simons, Carlijn; Allart, Esther; de Gier, Erwin; Bögels, Susan M; Becker, Eni S; Rinck, Mike

2014-01-01

This study investigated multiple cognitive biases in children simultaneously, to investigate whether spider-fearful children display an interpretation bias, a recall bias, and source monitoring errors, and whether these biases are specific for spider-related materials. Furthermore, the independent ability of these biases to predict spider fear was investigated. A total of 121 children filled out the Spider Anxiety and Disgust Screening for Children (SADS-C), and they performed an interpretation task, a memory task, and a Behavioural Assessment Test (BAT). As expected, a specific interpretation bias was found: Spider-fearful children showed more negative interpretations of ambiguous spider-related scenarios, but not of other scenarios. We also found specific source monitoring errors: Spider-fearful children made more fear-related source monitoring errors for the spider-related scenarios, but not for the other scenarios. Only limited support was found for a recall bias. Finally, interpretation bias, recall bias, and source monitoring errors predicted unique variance components of spider fear.

Competitive interactions between a native spider (Frontinella communis, Araneae: Linyphiidae) and an invasive spider (Linyphia triangularis, Araneae: Linyphiidae)

Science.gov (United States)

Bednarski, Julie V.; Ginsberg, Howard S.; Jakob, Elizabeth M.

2010-01-01

There are numerous reports of spiders that have become established outside of their native ranges, but few studies examine their impact on native spiders. We examined the effect of the European hammock spider Linyphia triangularis (Araneae, Linyphiidae) on the native bowl-and-doily spider Frontinella communis (Araneae, Linyphiidae) in Acadia National Park, Maine, USA. First, we added L. triangularis to established plots of F. communis. Significantly more F. communis abandoned their webs when L. triangularis were added compared to control plots. Second, we tested whether F. communis were deterred from building webs in areas where L. triangularis was established. Significantly fewer F. communis built webs on plots with L. triangularis than on control plots. In both experiments, L. triangularis sometimes took over webs of F. communis or incorporated F. communis webs into their own webs, but F. communisnever took over or incorporated L. triangularis webs. Competition between L. triangularis and F. communis for both webs and web sites may contribute to the decline of F. communis.

Interchangeable grabs for mobile cranes

Energy Technology Data Exchange (ETDEWEB)

Arnold, A

1985-02-07

Not only the large variety of material to be handled, but also the enormous amounts of material to be loaded and unloaded have been a constant source of danger for the operators of mobile or portal cranes with cable pull, or of fork lifters. Bad accident statistics and materials handling problems have thus been the reason leading to the purchase of mobile cranes with stable load handling and, in the following, to the development of various graps suitable for the different types of material to be handled. Rigid graps with hydraulic drive and designed for mechanical replacement have been developed and tested. The following equipment has so far been tested and developed to maturity: Rapid replacement automatism, tipping and magnetic slewing mechanism, safety equipment for magnetic operation, vacuum lifter and stacker fork.

Induction of direct and indirect plant responses by jasmonic acid, low spider mite densities, or a combination of jasmonic acid treatment and spider mite infestation.

Science.gov (United States)

Gols, Rieta; Roosjen, Mara; Dijkman, Herman; Dicke, Marcel

2003-12-01

Jasmonic acid (JA) and the octadecanoid pathway are involved in both induced direct and induced indirect plant responses. In this study, the herbivorous mite, Tetranychus urticae, and its predator, Phytoseiulus persimilis, were given a choice between Lima bean plants induced by JA or spider mites and uninduced control plants. Infestation densities resulting in the induction of predator attractants were much lower than thus far assumed, i.e., predatory mites were significantly attracted to plants that were infested for 2 days with only one or four spider mites per plant. Phytoseiulus persimilis showed a density-dependent response to volatiles from plants that were infested with different numbers of spider mites. Similarly, treating plants with increasing concentrations of JA also led to increased attraction of P. persimilis. Moreover, the duration of spider mite infestation was positively correlated with the proportion of predators that were attracted to mite-infested plants. A pretreatment of the plants with JA followed by a spider mite infestation enhanced the attraction of P. persimilis to plant volatiles compared to attraction to volatiles from plants that were only infested with spider mites and did not receive a pretreatment with JA. The herbivore, T. urticae preferred leaf tissue that previously had been infested with conspecifics to uninfested leaf tissue. In the case of choice tests with JA-induced and control leaf tissue, spider mites slightly preferred control leaf tissue. When spider mites were given a choice between leaf discs induced by JA and leaf discs damaged by spider mite feeding, they preferred the latter. The presence of herbivore induced chemicals and/or spider mite products enhanced settlement of the mites, whereas treatment with JA seemed to impede settlement.

Spider foraging strategy affects trophic cascades under natural and drought conditions.

Science.gov (United States)

Liu, Shengjie; Chen, Jin; Gan, Wenjin; Schaefer, Douglas; Gan, Jianmin; Yang, Xiaodong

2015-07-23

Spiders can cause trophic cascades affecting litter decomposition rates. However, it remains unclear how spiders with different foraging strategies influence faunal communities, or present cascading effects on decomposition. Furthermore, increased dry periods predicted in future climates will likely have important consequences for trophic interactions in detritus-based food webs. We investigated independent and interactive effects of spider predation and drought on litter decomposition in a tropical forest floor. We manipulated densities of dominant spiders with actively hunting or sit-and-wait foraging strategies in microcosms which mimicked the tropical-forest floor. We found a positive trophic cascade on litter decomposition was triggered by actively hunting spiders under ambient rainfall, but sit-and-wait spiders did not cause this. The drought treatment reversed the effect of actively hunting spiders on litter decomposition. Under drought conditions, we observed negative trophic cascade effects on litter decomposition in all three spider treatments. Thus, reduced rainfall can alter predator-induced indirect effects on lower trophic levels and ecosystem processes, and is an example of how such changes may alter trophic cascades in detritus-based webs of tropical forests.

Sway control method and system for rotary cranes

Science.gov (United States)

Robinett, Rush D.; Parker, Gordon G.; Feddema, John T.; Dohrmann, Clark R.; Petterson, Ben J.

1999-01-01

Methods and apparatuses for reducing the oscillatory motion of rotary crane payloads during operator-commanded or computer-controlled maneuvers. An Input-shaping filter receives input signals from multiple operator input devices and converts them into output signals readable by the crane controller to dampen the payload tangential and radial sway associated with rotation of the jib. The input signals are characterized by a hub rotation trajectory .gamma.(t), which includes a jib angular acceleration .gamma., a trolley acceleration x, and a load-line length velocity L. The system state variables are characterized by a tangential rotation angle .theta.(t) and a radial rotation angle .phi.(t) of the load-line. The coupled equations of motion governing the filter are non-linear and configuration-dependent. In one embodiment, a filter is provided between the operator and the crane for filtering undesired frequencies from the angular .gamma. and trolley x velocities to suppress payload oscillation. In another embodiment, crane commands are computer generated and controlled to suppress vibration of the payload using a postulated asymmetrical shape for the acceleration profiles of the jib, which profiles are uniquely determined by a set of parameters (including the acceleration pulse amplitude and the duration and coast time between pulses), or a dynamic programming approach.

Comparison of Serum Protein Electrophoresis Values in Wild and Captive Whooping Cranes ( Grus americana ).

Science.gov (United States)

Hausmann, Jennifer C; Cray, Carolyn; Hartup, Barry K

2015-09-01

Protein electrophoresis of serum samples from endangered, wild whooping cranes ( Grus americana ) was performed to help assess the health of the only self-sustaining, migratory population in North America. Serum samples from wild adult cranes (n = 22) were taken at Aransas National Wildlife Refuge, Texas, USA during winter. Wild juvenile cranes (n = 26) were sampled at Wood Buffalo National Park, Northwest Territories, Canada, in midsummer. All captive crane samples were acquired from the International Crane Foundation, Baraboo, WI, USA. Captive adult cranes (n = 30) were sampled during annual examinations, and archived serum samples from captive juvenile cranes (n = 19) were selected to match the estimated age of wild juveniles. Wild juveniles had significantly lower concentrations of all protein fractions than wild adults, except for prealbumin and γ globulins. All protein fraction concentrations for wild juveniles were significantly lower compared with captive juveniles, except for prealbumin and γ globulins, which were higher. Wild adults had significantly greater γ globulin concentrations than captive adults. Captive juveniles had significantly lower prealbumin and albumin concentrations and albumin : globulin ratios than captive adults. The higher γ globulin concentrations in wild versus captive cranes are likely because of increased antigenic exposure and immune stimulation. Protein fraction concentrations vary significantly with age and natural history in this species. Reference intervals for serum protein electrophoresis results from captive adult whooping cranes are provided in this study.

Peculiar torsion dynamical response of spider dragline silk

Science.gov (United States)

Liu, Dabiao; Yu, Longteng; He, Yuming; Peng, Kai; Liu, Jie; Guan, Juan; Dunstan, D. J.

2017-07-01

The torsional properties of spider dragline silks from Nephila edulis and Nephila pilipes spiders are investigated by using a torsion pendulum technique. A permanent torsional deformation is observed after even small torsional strain. This behaviour is quite different from that of the other materials tested here, i.e., carbon fiber, thin metallic wires, Kevlar fiber, and human hair. The spider dragline thus displays a strong energy dissipation upon the initial excitation (around 75% for small strains and more for a larger strain), which correspondingly reduces the amplitude of subsequent oscillations around the new equilibrium position. The variation of torsional stiffness in relaxation dynamics of spider draglines for different excitations is also determined. The experimental result is interpreted in the light of the hierarchical structure of dragline silk.

Preventive maintenance and load testing of fixed position cranes in support of major operations

International Nuclear Information System (INIS)

Detrick, C.K.

1980-01-01

This paper will address load testing and preventive maintenance of fixed in-place cranes in general, and maintenance and load testing of the 200 ton Polar Gantry Crane at the FFTF in particular. This paper also covers the installation of a 100-ton bridge crane in the FFTF's Reactor Service Building, as well as use of these cranes in making important lifts of FFTF equipment

Plastic material investment in load-bearing silk attachments in spiders.

Science.gov (United States)

Wolff, Jonas O; Jones, Braxton; Herberstein, Marie E

2018-05-17

The nature and size of attachments is a fundamental element of animal constructions. Presumably, these adhesive structures are plastically deployed to balance material investment and attachment strength. Here we studied plasticity in dragline anchorages of the golden orb web spider, Nephila plumipes. Specifically, we predict that spiders adjust the size and structure of dragline anchorages with load, i.e. spider mass. Mass was manipulated by attaching lead pieces to the spider's abdomen resulting in a 50 percent increase in mass. Loaded spiders spun larger but structurally similar thread anchorages than unloaded spiders. Thus, the spinning program that determines the overall anchor structure is highly stereotypic, and flexibility is introduced through varying the anchor size by increasing material investment. Our study showcases substrate attachments as suitable models to investigate the interplay between innate and changeable elements in the economy of building behaviours. Copyright © 2018 Elsevier GmbH. All rights reserved.

Pathogenicity of West Nile virus and response to vaccination in sandhill cranes (Grus canadensis) using a killed vaccine.

Science.gov (United States)

Olsen, Glenn H; Miller, Kimberli J; Docherty, Douglas E; Bochsler, Valerie S; Sileo, Louis

2009-06-01

West Nile virus was introduced into the United States in the vicinity of New York, New York, USA in 1999. The virus has since killed large numbers of birds nationwide, especially, but not limited to, crows (Corvus brachyrhinchos). One sandhill crane (Grus canadensis) at the Bridgeport Zoo (Bridgeport, Connecticut, USA) reportedly died from West Nile virus, so sandhill cranes and endangered whooping cranes (Grus americana), both in the wild and in captive breeding colonies at United States Geological Service (USGS) Patuxent Wildlife Research Center (Laurel, Maryland, USA) were considered at risk. A killed vaccine in sandhill cranes was evaluated by vaccinating and then challenging these cranes with live West Nile virus. No sandhill cranes inoculated with the killed vaccine developed significant titers when compared with unvaccinated controls. No sandhill cranes inoculated with the vaccine and challenged with the virus died from West Nile virus infection. In addition, no unvaccinated challenged sandhill cranes died. However, 2 days postchallenge, vaccinated cranes had significantly less viremia (P cranes. Seven days postchallenge vaccinated cranes had significantly less cloacal shedding of the virus (P cranes and significantly less weight loss (P cranes. Vaccinated sandhill cranes developed significantly higher titers 14 days postchallenge and were viremic for shorter periods of time after challenge than unvaccinated individuals. Unvaccinated challenged cranes had glial cell aggregates in both the brain and brain stem areas, and this was not observed in vaccinated challenged cranes or in vaccinated unchallenged cranes.

Serum corticosterone response to adrenocorticotropic hormone stimulation in Florida sandhill cranes.

Science.gov (United States)

Ludders, J W; Langenberg, J A; Czekala, N M; Erb, H N; McCormick, H

1998-10-01

Florida sandhill cranes (Grus canadensis pratensis) were conditioned to confinement in an enclosure for 7 days, 6 hr a day. On day 8, cranes were catheterized and then confined in an enclosure. Venous blood (2 ml) was collected through the catheter and an attached IV line immediately before (-60 min) and 60 min after (0 min) confinement. Using a randomization table and a restricted cross-over experimental design, cranes were injected intravenously with either saline (control) or adrenocorticotropic hormone (ACTH; cosyntropin, Cortrosyn; 0.25 mg). At 30, 60, 120, 180, 240 and 300 min after injection, blood samples were collected and assayed for corticosterone. The cranes receiving ACTH increased their serum corticosterone concentrations as much as fivefold above baseline concentrations. Serum corticosterone concentrations remained significantly elevated for approximately 60 min after ACTH stimulation. Physical restraint and catheterization caused an increase in serum corticosterone almost comparable to that induced by ACTH stimulation. In cranes injected with saline, serum corticosterone decreased within 1 hr after physical restraint and catheterization, and remained at lower levels throughout the remaining 5 hr of confinement.

Wintering Sandhill Crane exposure to wind energy development in the central and southern Great Plains, USA

Science.gov (United States)

Pearse, Aaron T.; Brandt, David; Krapu, Gary

2016-01-01

Numerous wind energy projects have been constructed in the central and southern Great Plains, USA, the main wintering area for midcontinental Sandhill Cranes (Grus canadensis). In an initial assessment of the potential risks of wind towers to cranes, we estimated spatial overlap, investigated potential avoidance behavior, and determined the habitat associations of cranes. We used data from cranes marked with platform transmitting terminals (PTTs) with and without global positioning system (GPS) capabilities. We estimated the wintering distributions of PTT-marked cranes prior to the construction of wind towers, which we compared with current tower locations. Based on this analysis, we found 7% spatial overlap between the distributions of cranes and towers. When we looked at individually marked cranes, we found that 52% would have occurred within 10 km of a tower at some point during winter. Using data from cranes marked after tower construction, we found a potential indication of avoidance behavior, whereby GPS-marked cranes generally used areas slightly more distant from existing wind towers than would be expected by chance. Results from a habitat selection model suggested that distances between crane locations and towers may have been driven more by habitat selection than by avoidance, as most wind towers were constructed in locations not often selected by wintering cranes. Our findings of modest regional overlap and that few towers have been placed in preferred crane habitat suggest that the current distribution of wind towers may be of low risk to the continued persistence of wintering midcontinental Sandhill Cranes in the central and southern Great Plains.

COMPUTED TOMOGRAPHIC ANATOMY AND CHARACTERISTICS OF RESPIRATORY ASPERGILLOSIS IN JUVENILE WHOOPING CRANES.

Science.gov (United States)

Schwarz, Tobias; Kelley, Cristin; Pinkerton, Marie E; Hartup, Barry K

2016-01-01

Respiratory diseases are a leading cause of morbidity and mortality in captivity reared, endangered whooping cranes (Grus americana). Objectives of this retrospective, case series, cross-sectional study were to describe computed tomography (CT) respiratory anatomy in a juvenile whooping crane without respiratory disease, compare CT characteristics with gross pathologic characteristics in a group of juvenile whooping cranes with respiratory aspergillosis, and test associations between the number of CT tracheal bends and bird sex and age. A total of 10 juvenile whooping cranes (one control, nine affected) were included. Seven affected cranes had CT characteristics of unilateral extrapulmonary bronchial occlusion or wall thickening, and seven cranes had luminal occlusion of the intrapulmonary primary or secondary bronchi. Air sac membrane thickening was observed in three cranes in the cranial and caudal thoracic air sacs, and air sac diverticulum opacification was observed in four cranes. Necropsy lesions consisted of severe, subacute to chronic, focally extensive granulomatous pathology of the trachea, primary bronchi, lungs, or air sacs. No false positive CT scan results were documented. Seven instances of false negative CT scan results occurred; six of these consisted of subtle, mild air sacculitis including membrane opacification or thickening, or the presence of small plaques found at necropsy. The number of CT tracheal bends was associated with bird age but not sex. Findings supported the use of CT as a diagnostic test for avian species with respiratory disease and tracheal coiling or elongated tracheae where endoscopic evaluation is impractical. © 2015 The Authors. Veterinary Radiology & Ultrasound published by Wiley Periodicals, Inc. on behalf of American College of Veterinary Radiology.

Influence of spider silk on refugia preferences of the recluse spiders Loxosceles reclusa and Loxosceles laeta (Araneae: Sicariidae).

Science.gov (United States)

Vetter, Richard S; Rust, Michael K

2010-06-01

In a previous experimental study, recluse spiders Loxosceles reclusa Gertsch and Mulaik and Loxosceles laeta (Nicolet) (Araneae: Sicariidae) preferred small cardboard refugia covered with conspecific silk compared with never-occupied refugia. Herein, we investigated some factors that might be responsible for this preference using similar cardboard refugia. When the two Loxosceles species were given choices between refugia previously occupied by their own and by the congeneric species, neither showed a species-specific preference; however, each chose refugia coated with conspecific silk rather than those previously inhabited by a distantly related cribellate spider, Metaltella simoni (Keyserling). When L. laeta spiders were offered refugia that were freshly removed from silk donors compared with heated, aged refugia from the same silk donor, older refugia were preferred. Solvent extracts of L. laeta silk were chosen approximately as often as control refugia when a range of solvents (methylene chloride:methanol, water, and hexane) were used. However, when acetone was used on similar silk, there was a statistical preference for the control, indicating that there might be a mildly repellent aspect to acetone-washed silk. Considering the inability to show attraction to chemical aspects of fresh silk, it seems that physical attributes may be more important for selection and that there might be repellency to silk of a recently vacated spider. These findings are discussed in regard to pest management strategies to control recluse spiders.

75 FR 68429 - Cranes and Derricks in Construction; Approval of Information Collection Requirements

Science.gov (United States)

2010-11-08

.... OSHA-2007-0066] RIN 1218-AC01 Cranes and Derricks in Construction; Approval of Information Collection... requirements. SUMMARY: On August 9, 2010, OSHA published a final rule revising the Cranes and Derricks Standard... necessary to protect employees during the use of cranes and derricks in construction. That final standard...

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

Energy Technology Data Exchange (ETDEWEB)

Dmitrović, Svetlana, E-mail: svetlana8@vin.bg.ac.rs [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Nikolić, Marko G.; Jelenković, Branislav [University of Belgrade, Institute of Physics (Serbia); Prekajski, Marija [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia); Rabasović, Mihailo [University of Belgrade, Institute of Physics (Serbia); Zarubica, Aleksandra [University of Niš, Department of Chemistry, Faculty of Science and Mathematics (Serbia); Branković, Goran [University of Belgrade, Institute for Multidisciplinary Research, Department of Material Science (Serbia); Matović, Branko [University of Belgrade, Vinča Institute of Nuclear Sciences (Serbia)

2017-02-15

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO{sub 3}){sub 3}) and ammonium hydroxide (NH{sub 4}OH). Depending on the relationship between Ce{sup 3+} ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

High School Students' Attitudes Towards Spiders: A cross-cultural comparison

Science.gov (United States)

Prokop, Pavol; Tolarovičová, Andrea; Camerik, Anne M.; Peterková, Viera

2010-08-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is, however, ambivalent. Using a five-point score Likert-type questionnaire in which the items were developed in a similar way to four of Kellert's categories of attitude (scientistic, negativistic, naturalistic, and ecologistic) towards invertebrates, we compared the level of knowledge of and attitudes towards spiders of high school students from two countries, Slovakia (n = 354) and South Africa (n = 382). The students represented different cultures and followed dissimilar science education curricula. Only among the Slovakian students there was a statistically significant but low correlation between knowledge and attitude (r = 0.30). The South African students scored higher in the categories of scientistic, naturalistic, and ecologistic attitudes. Comparison of attitude towards spiders of indigenous Africans from coeducational Catholic schools revealed that South African students have greater fear of spiders than Slovakian students, supporting the biological preparedness hypothesis. This hypothesis predicts a greater fear of spiders in South Africa than in Europe since several South African spiders possess venoms that are dangerous to humans. The results of this study are discussed from science education, cultural, and evolutionary perspectives.

Photoluminescent properties of spider silk coated with Eu-doped nanoceria

International Nuclear Information System (INIS)

Dmitrović, Svetlana; Nikolić, Marko G.; Jelenković, Branislav; Prekajski, Marija; Rabasović, Mihailo; Zarubica, Aleksandra; Branković, Goran; Matović, Branko

2017-01-01

Spider dragline silk was coated with pure as well as Eu-doped ceria nanopowders at the room temperature. The treatment was done by immersion of the spider silk mesh into aqueous solutions of cerium nitrate (Ce(NO_3)_3) and ammonium hydroxide (NH_4OH). Depending on the relationship between Ce"3"+ ion and ammonium hydroxide concentration, coated fibers exhibited a different thickness. Obtained materials were studied by means of FESEM. It was found that ceria nanoparticles of average size of 3 nm were coated along spider thread. X-ray diffraction (XRD) and selected-area electron diffraction (SAED) confirmed crystal nature of nanoparticle coating of spider silk. By using Williamson-Hall plots, crystallite size and strain were estimated. EDS measurement confirmed the presence of Eu in spider-Eu-doped ceria composite, and according to FTIR analysis, the interaction between CeO2 and spider silk was proposed. The morphology of obtained composite was observed by TEM. The photoluminescence emission spectra of spider silk coated with Eu-doped ceria were measured with two different excitations of 385 and 466 nm. The two-photon excited auto-fluorescence of spider silk coated with Eu-doped ceria was detected using a nonlinear laser scanning microscope. Obtained composite has a potential as a fluorescent labeling material in diverse applications.

Migration patterns and movements of sandhill cranes wintering in central and southwestern Louisiana

Science.gov (United States)

King, Sammy L.; Pierce, Aaron R.; Hersey, Kent R.; Winstead, Nicholas; Hartup, Barry K.

2010-01-01

In this study we trapped wintering sandhill cranes (Grus canadensis) in Louisiana and fitted them with satellite transmitters to determine their migration routes. Four of the 6 sandhill cranes with validated locations and a terminus point used the Central Flyway for spring migration; 2 of these 4 (the only 2 for which we have data) also used the Central Flyway for fall migration. Two of the 6 birds used the Mississippi Flyway for spring migration. The results of this study suggest that reintroduced whooping cranes (G. americana) that intermix and migrate with sandhill cranes that winter in Louisiana may enter the Central Flyway. In addition, the Mississippi Flyway is a viable option to use as a migration route for whooping cranes if they are reintroduced in Louisiana.

Science 101: Why Don't Spiders Stick to Their Own Webs?

Science.gov (United States)

Robertson, Bill

2011-01-01

This article explains why spiders don't stick to their webs. Spiders don't get stuck in their own webs (and they aren't immune to their own glue) because they use a combination of sticky and nonsticky threads (different glands for producing those), and the glue is in droplets that the spider can avoid but the prey can't. The spider's nervous…

Salticid predation as one potential driving force of ant mimicry in jumping spiders

Science.gov (United States)

Huang, Jin-Nan; Cheng, Ren-Chung; Li, Daiqin; Tso, I-Min

2011-01-01

Many spiders possess myrmecomorphy, and species of the jumping spider genus Myrmarachne exhibit nearly perfect ant mimicry. Most salticids are diurnal predators with unusually high visual acuity that prey on various arthropods, including conspecifics. In this study, we tested whether predation pressure from large jumping spiders is one possible driving force of perfect ant mimicry in jumping spiders. The results showed that small non-ant-mimicking jumping spiders were readily treated as prey by large ones (no matter whether heterospecific or conspecific) and suffered high attack and mortality rates. The size difference between small and large jumping spiders significantly affected the outcomes of predatory interactions between them: the smaller the juvenile jumping spiders, the higher the predation risk from large ones. The attack and mortality rates of ant-mimicking jumping spiders were significantly lower than those of non-ant-mimicking jumping spiders, indicating that a resemblance to ants could provide protection against salticid predation. However, results of multivariate behavioural analyses showed that the responses of large jumping spiders to ants and ant-mimicking salticids differed significantly. Results of this study indicate that predation pressure from large jumping spiders might be one selection force driving the evolution of nearly perfect myrmecomorphy in spiders and other arthropods. PMID:20961898

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

Directory of Open Access Journals (Sweden)

Jun Wang

2018-01-01

Full Text Available Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows that the networking structure of artificial spider web is better than that of traditional networks in terms of improving the overall reliability and invulnerability of communication system. A comprehensive study on the advantage characteristics of spider web has important theoretical and practical significance for promoting the invulnerability research of farmland wireless sensor network.

Cooperative control system of the floating cranes for the dual lifting

OpenAIRE

Mihee Nam; Jinbeom Kim; Jaechang Lee; Daekyung Kim; Donghyuk Lee; Jangmyung Lee

2018-01-01

This paper proposes a dual lifting and its cooperative control system with two different kinds of floating cranes. The Mega-erection and Giga-erection in the ship building are used to handle heavier and wider blocks and modules as ships and off-shore platforms are enlarged. However, there is no equipment to handle such Tera-blocks. In order to overcome the limit on performance of existing floating cranes, the dual lifting is proposed in this research. In the dual lifting, two floating cranes ...

Silk Spinning in Silkworms and Spiders.

Science.gov (United States)

Andersson, Marlene; Johansson, Jan; Rising, Anna

2016-08-09

Spiders and silkworms spin silks that outcompete the toughness of all natural and manmade fibers. Herein, we compare and contrast the spinning of silk in silkworms and spiders, with the aim of identifying features that are important for fiber formation. Although spiders and silkworms are very distantly related, some features of spinning silk seem to be universal. Both spiders and silkworms produce large silk proteins that are highly repetitive and extremely soluble at high pH, likely due to the globular terminal domains that flank an intermediate repetitive region. The silk proteins are produced and stored at a very high concentration in glands, and then transported along a narrowing tube in which they change conformation in response primarily to a pH gradient generated by carbonic anhydrase and proton pumps, as well as to ions and shear forces. The silk proteins thereby convert from random coil and alpha helical soluble conformations to beta sheet fibers. We suggest that factors that need to be optimized for successful production of artificial silk proteins capable of forming tough fibers include protein solubility, pH sensitivity, and preservation of natively folded proteins throughout the purification and initial spinning processes.

Decision analysis for conservation breeding: Maximizing production for reintroduction of whooping cranes

Science.gov (United States)

Smith, Des H.V.; Converse, Sarah J.; Gibson, Keith; Moehrenschlager, Axel; Link, William A.; Olsen, Glenn H.; Maguire, Kelly

2011-01-01

Captive breeding is key to management of severely endangered species, but maximizing captive production can be challenging because of poor knowledge of species breeding biology and the complexity of evaluating different management options. In the face of uncertainty and complexity, decision-analytic approaches can be used to identify optimal management options for maximizing captive production. Building decision-analytic models requires iterations of model conception, data analysis, model building and evaluation, identification of remaining uncertainty, further research and monitoring to reduce uncertainty, and integration of new data into the model. We initiated such a process to maximize captive production of the whooping crane (Grus americana), the world's most endangered crane, which is managed through captive breeding and reintroduction. We collected 15 years of captive breeding data from 3 institutions and used Bayesian analysis and model selection to identify predictors of whooping crane hatching success. The strongest predictor, and that with clear management relevance, was incubation environment. The incubation period of whooping crane eggs is split across two environments: crane nests and artificial incubators. Although artificial incubators are useful for allowing breeding pairs to produce multiple clutches, our results indicate that crane incubation is most effective at promoting hatching success. Hatching probability increased the longer an egg spent in a crane nest, from 40% hatching probability for eggs receiving 1 day of crane incubation to 95% for those receiving 30 days (time incubated in each environment varied independently of total incubation period). Because birds will lay fewer eggs when they are incubating longer, a tradeoff exists between the number of clutches produced and egg hatching probability. We developed a decision-analytic model that estimated 16 to be the optimal number of days of crane incubation needed to maximize the number of

Multipurpose layout drawing of metalware of bridge crane load trolley

Directory of Open Access Journals (Sweden)

Goncharov K.A.

2017-03-01

Full Text Available Multipurpose layout drawing of metalware of bridge crane load trolley is proposed. The numerical analysis of proposed layout drawing is conducted using the example of bridge crane load trolley with capacity of 20 t. This analysis is carried out using the finite element method.

Multi-Motor Drives for Crane Application

Directory of Open Access Journals (Sweden)

MITROVIC, N.

2009-10-01

Full Text Available This paper focuses on the application of adjustable speed induction motor drives for gantry cranes. Modern solution considers application of frequency converters for all drives. Multi-motor drives are standard solutions in crane application and requirements of load sharing are present. Presented algorithm provides load sharing proportional to the rated motor power on the simple and practically applicable method on the basis of estimated torques by frequency converters, and controller realized in PLC. Special attention is devoted to wide span gantry drive and algorithm for skew elimination. Solutions for load distribution in multi-motor drive, as well as mode of gantry drive skew elimination, are described. Suggested solution concept is confirmed by the experimental results.

A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

Directory of Open Access Journals (Sweden)

Yunhua Zhong

Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

Asbestos fiber release from the brake pads of overhead industrial cranes.

Science.gov (United States)

Spencer, J W; Plisko, M J; Balzer, J L

1999-06-01

The purpose of this evaluation was to determine the actual contribution of airborne asbestos fibers to the work environment from the operation of overhead cranes and hoists that use asbestos composition brake pads. The evaluation was conducted in a working manufacturing facility. Other potential sources of asbestos were accounted for by visual inspection and background air monitoring. An overhead crane assembly comprised of a trolley and two hoists was employed for this study. The crane was operated for two consecutive eight-hour shifts representative of a heavy-duty cycle. Forty-four personal and area air samples were collected during the assessment. Asbestos fibers were analyzed for by phase contrast (NIOSH 7400), and transmission electron (NIOSH 7402) microscopy methods. Eight-hour time-weighted average (TWA) asbestos fiber concentrations ranged from cranes.

Conflicts between sandhill cranes and farmers in the western United States: evolving issues and solutions

Science.gov (United States)

Austin, Jane E.

2012-01-01

The main conflicts between Sandhill Cranes (Grus canadensis) and farmers in western United States occur in the Rocky Mountain region during migration and wintering periods. Most crop damage by cranes occurs in mature wheat (Triticum aestivum) and barley (Hordeum vulgare), young shoots of alfalfa (Medicago sativa) and cereal grains, chilies (Capsicum annuum), and silage corn (Zea mays). Damage is related to proximity of crop fields to roost sites and timing of crane concentrations relative to crop maturity or vulnerability. The evolution of conflicts between farmers and cranes and current solutions are described for two areas of the Rocky Mountains used by staging, migrating, or wintering cranes: Grays Lake, Idaho, and the Middle Rio Grande Valley, New Mexico. In both areas, conflicts with growing crane populations were aggravated by losses of wetlands and cropland, proximity of crops to roosts and other wetland areas, changing crop types and practices, and increasing urbanization. At Grays Lake, fall-staging cranes damaged barley fields near an important breeding refuge as well as fields 15-50 km away. In the Middle Rio Grande Valley, migrating and wintering cranes damaged young alfalfa fields, chilies, and silage corn. Solutions in both areas have been addressed through cooperative efforts among federal and state agencies, that manage wetlands and croplands to increase food availability and carrying capacity on public lands, provide hazing programs for private landowners, and strategically target crane hunting to problem areas. Sustaining the success of these programs will be challenging. Areas important to Sandhill Cranes in the western United Sates experience continued loss of habitat and food resources due to urbanization, changes in agricultural crops and practices, and water-use conflicts, which threaten the abilities of both public and private landowners to manage wetlands and croplands for cranes. Conservation of habitats and water resources are important

Gantry Crane Scheduling with Interference Constraints in Railway Container Terminals

Directory of Open Access Journals (Sweden)

Peng Guo

2013-04-01

Full Text Available Railway container terminals, where gantry cranes are responsible for loading and unloading containers between freight trains and yards, are important hubs of hinterland logistics transportation. Terminal managers confront the challenge in improving the efficiency of their service. As the most expensive equipment in a terminal, the operational performance of gantry cranes is a crucial factor. In this paper, the gantry crane scheduling problem of railway container terminals is investigated. A mixed integer programming model which considers the effect of dwelling position dependent processing times is formulated. In addition, the safety distances, the travel times and the non-crossing requirement of cranes are incorporated in the mathematical model. A novel discrete artificial bee colony algorithm is presented to solve the intractable scheduling problem. Computational experiments are conducted to evaluate the proposed algorithm on some randomly constructed instances based on typical terminal operational data. Experimental results show that the proposed approach can obtain near optimal solutions for the investigated problem in a reasonable computational time.

Spiders of Kerala Agricultural University Campus, Thrissur, Kerala, India

Directory of Open Access Journals (Sweden)

C. K. Adarsh

2015-12-01

Full Text Available A total of 86 species of spiders belonging to 56 genera of 20 families have been recorded from the Kerala Agricultural University (KAU campus, Thrissur, Kerala, southern India.  This represents 5.1% of the total spiders’ species and 33.33% of the total families of spiders recorded in India.  The dominant spider family at KAU campus is Araneidae with 18 species of nine genera. Salticidae is represented by 14 species of 13 genera.  Out of 252 endemic spiders of India, 16 have been reported from KAU campus.  Guild structure analysis shows spiders belonging to seven types of feeding guilds present in KAU campus.  Orb-web builders are the dominant feeding guild accounting for 34%, followed by stalkers (22%, ground runners (20%, ambushers (8%, scattered line weavers (8%, foliage runners (7% and sheet-web builders (1%. 

Gregory Crane e i cittadini della repubblica delle lettere

Directory of Open Access Journals (Sweden)

Maria Chiara Pievatolo

2012-05-01

Full Text Available Chi studia l’antichità conosce Gregory Crane anche quando non ne rammenta il nome, non per quello che ha scritto ma per quello che ha reso possibile scrivere. Crane è il direttore del Perseus Project, una biblioteca digitale che libera gli studiosi dal microcosmo chiuso e inaccessibile della monografia accademica, permettendo loro di lavorare sui classici [...

Research on Artificial Spider Web Model for Farmland Wireless Sensor Network

OpenAIRE

Jun Wang; Song Gao; Shimin Zhao; Guang Hu; Xiaoli Zhang; Guowang Xie

2018-01-01

Through systematic analysis of the structural characteristics and invulnerability of spider web, this paper explores the possibility of combining the advantages of spider web such as network robustness and invulnerability with farmland wireless sensor network. A universally applicable definition and mathematical model of artificial spider web structure are established. The comparison between artificial spider web and traditional networks is discussed in detail. The simulation result shows tha...

Spider diffraction: a comparison of curved and straight legs

International Nuclear Information System (INIS)

Richter, J.L.

1984-01-01

It has been known for some time that, if curved legs rather than the usual straight ones are used in the spider that supports the secondary optics in certain telescopes, the visible diffraction effect is reduced. Fraunhofer theory is used to calculate the diffraction effects due to the curved leg spider. Calculated and photographic diffraction patterns are compared for straight and curved leg spiders

High School Students' Attitudes towards Spiders: A Cross-Cultural Comparison

Science.gov (United States)

Prokop, Pavol; Tolarovicova, Andrea; Camerik, Anne M.; Peterkova, Viera

2010-01-01

Spiders are traditionally considered to be among the least popular of animals. Current evidence suggests that a negative attitude towards spiders could be influenced by both cultural and evolutionary pressures. Some researchers suggest that science education activities could positively influence students' perceptions of spiders. Their evidence is,…

Changes in agriculture and abundance of snow geese affect carrying capacity of sandhill cranes in Nebraska

Science.gov (United States)

Pearse, A.T.; Krapu, G.L.; Brandt, D.A.; Kinzel, P.J.

2010-01-01

The central Platte River valley (CPRV) in Nebraska, USA, is a key spring-staging area for approximately 80 of the midcontinent population of sandhill cranes (Grus canadensis; hereafter cranes). Evidence that staging cranes acquired less lipid reserves during the 1990s compared to the late 1970s and increases in use of the CPRV by snow geese (Chen caerulescens) prompted us to investigate availability of waste corn and quantify spatial and temporal patterns of crane and waterfowl use of the region. We developed a predictive model to assess impacts of changes in availability of corn and snow goose abundance under past, present, and potential future conditions. Over a hypothetical 60-day staging period, predicted energy demand of cranes and waterfowl increased 87 between the late 1970s and 19982007, primarily because peak abundances of snow geese increased by 650,000 and cranes by 110,000. Compared to spring 1979, corn available when cranes arrived was 20 less in 1998 and 68 less in 1999; consequently, the area of cornfields required to meet crane needs increased from 14,464 ha in 1979 to 32,751 ha in 1998 and 90,559 ha in 1999. Using a pooled estimate of 88 kg/ha from springs 19981999 and 20052007, the area of cornfields needed to supply food requirements of cranes and waterfowl increased to 65,587 ha and was greatest in the eastern region of the CPRV, where an estimated 54 of cranes, 47 of Canada geese (Branta canadensis), 45 of greater white-fronted geese (Anser albifrons), and 46 of snow geese occurred during ground surveys. We estimated that a future reduction of 25 in available corn or cornfields would increase daily foraging flight distances of cranes by 2738. Crane use and ability of cranes to store lipid reserves in the CPRV could be reduced substantially if flight distance required to locate adequate corn exceeded a physiological maximum distance cranes could fly in search of food. Options to increase carrying capacity for cranes include increasing

Spiders (Arachnida: Araneae of Gujarat University Campus, Ahmedabad, India with additional description of Eilica tikaderi (Platnick, 1976

Directory of Open Access Journals (Sweden)

Dhruv A. Prajapati

2016-09-01

Full Text Available We report a checklist of spiders based on a survey made from August 2013 to July 2014 in Gujarat University Campus, an urban area located in the middle of Ahmadabad City, Gujarat State. A total of 77 species of spiders belonging to 53 genera and 20 families of spiders were recorded from the study area represented by 31.74% of the total 63 families reported from India. Salticidae was found to be the most dominant family with 18 species from 14 genera. Guild structure analysis revealed six feeding guilds, namely stalkers, orb-web builders, space-web builders, ambushers, foliage hunters and ground runners. Stalkers and orb-web builders were the most dominant feeding guilds representing 28.58% and 20.78% respectively among all studied guilds. Species Eilica tikaderi (Platnick, 1976 is reported for the first time from Gujarat with additional description and detailed genitalic illustrations.

Dynamic loads during failure risk assessment of bridge crane structures

Science.gov (United States)

Gorynin, A. D.; Antsev, V. Yu; Shaforost, A. N.

2018-03-01

The paper presents the method of failure risk assessment associated with a bridge crane metal structure at the design stage. It also justifies the necessity of taking into account dynamic loads with regard to the operational cycle of a bridge crane during failure risk assessment of its metal structure.

Automatic Supervisory System Synthesis for Port Cranes Collision Prevention by Using Petri Net

Directory of Open Access Journals (Sweden)

Danko Kezić

2006-05-01

Full Text Available The article deals with the system of port cranes comprisingtwo independently controlled cranes which are simultaneouslyengaged in the transhipment of cargo between a vessel and arailway wagon assembly alongside. The crane operator's errorcan lead to tlie collision of cranes. Therefore, it is necessary toinstall the supervisor in an automatic control system with thefunctions of continuous supervision of the process of cranemovement, and blocking of commands that can lead to collision.The article shows the method of crane system modellingas a discrete event system by using PIT and P-timed Petri nets.There is a proposal of a formal mathematic method for calculationof the state supervisor by P-invariant method. The supervisorcalculated in this way is maximally permissive supervisor.The efficiency of the supervisor is verified by a computer simulation.

Optically probing torsional superelasticity in spider silks

Energy Technology Data Exchange (ETDEWEB)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P. [Department of Physical Sciences, IISER Mohali, Sector 81, Manauli, Mohali 140306 (India)

2013-11-11

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10{sup 2−3} rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices.

Optically probing torsional superelasticity in spider silks

International Nuclear Information System (INIS)

Kumar, Bhupesh; Thakur, Ashish; Panda, Biswajit; Singh, Kamal P.

2013-01-01

We investigate torsion mechanics of various spider silks using a sensitive optical technique. We find that spider silks are torsionally superelastic in that they can reversibly withstand great torsion strains of over 10 2−3 rotations per cm before failure. Among various silks from a spider, we find the failure twist-strain is greatest in the sticky capture silk followed by dragline and egg-case silk. Our in situ laser-diffraction measurements reveal that torsional strains on the silks induce a nano-scale transverse compression in its diameter that is linear and reversible. These unique torsional properties of the silks could find applications in silk-based materials and devices

Seismic response of a sliding polar crane for a nuclear power plant

International Nuclear Information System (INIS)

Rieck, P.; Schlund, H.

1981-01-01

In the analysis, the bridge crane design is mathematically modeled in the vertical and lateral directions. The bridge crane system is postulated to vibrate in a linear-elastic fashion, until the dynamic reactions occurring at the crane wheel/support interface exceed the available resisting friction, at which time sliding is initiated. Sliding is postulated to continue until the relative velocity of the crane and supporting structure is zero, at which time a linear-elastic vibration mode is again developed. The analysis considers the variation in static and dynamic coefficients of friction and the variation of available friction resistance due to the crane vertical response. The initiation of sliding is modeled as an instantaneous event requiring a redescription of the crane system physical properties and coordinate system. Transfer from the vibrating system to the sliding system is governed by maintaining conservation of energy. Seismic excitation is defined using design floor response spectra appropriate for the crane system location. The design spectra are decomposed into a spectrum of acceleration time history harmonic motions which, when applied to a spectrum of single degree-of-freedom damped spring-mass oscillators, redevelops the original design spectra. The spectrum of acceleration times histories is used as base excitation to the mathematical model. Analytical results include sliding displacements and velocities, number of time sliding occurs, cumulative sliding displacements, and system kinetic and potential energy. A description of the crane system configuration and the development of the effective mass and stiffness values used in the analysis of the vibrating and sliding systems is presented. The equations of motions coupling the horizontal and vertical responses during the vibrating and sliding phases are presented. A discussion evaluating the applicability of the results, and how the results can be used for design, is also presented. (orig.)

And along Came a Spider: An Attentional Bias for the Detection of Spiders in Young Children and Adults

Science.gov (United States)

LoBue, Vanessa

2010-01-01

Spiders are among the most common targets of fears and phobias in the world. In visual search tasks, adults detect their presence more rapidly than other kinds of stimuli. Reported here is an investigation of whether young children share this attentional bias for the detection of spiders. In a series of experiments, preschoolers and adults were…

Early events in the evolution of spider silk genes.

Directory of Open Access Journals (Sweden)

James Starrett

Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

Spider-web amphiphiles as artificial lipid clusters: design, synthesis, and accommodation of lipid components at the air-water interface.

Science.gov (United States)

Ariga, Katsuhiko; Urakawa, Toshihiro; Michiue, Atsuo; Kikuchi, Jun-ichi

2004-08-03

As a novel category of two-dimensional lipid clusters, dendrimers having an amphiphilic structure in every unit were synthesized and labeled "spider-web amphiphiles". Amphiphilic units based on a Lys-Lys-Glu tripeptide with hydrophobic tails at the C-terminal and a polar head at the N-terminal are dendrically connected through stepwise peptide coupling. This structural design allowed us to separately introduce the polar head and hydrophobic tails. Accordingly, we demonstrated the synthesis of the spider-web amphiphile series in three combinations: acetyl head/C16 chain, acetyl head/C18 chain, and ammonium head/C16 chain. All the spider-web amphiphiles were synthesized in satisfactory yields, and characterized by 1H NMR, MALDI-TOFMS, GPC, and elemental analyses. Surface pressure (pi)-molecular area (A) isotherms showed the formation of expanded monolayers except for the C18-chain amphiphile at 10 degrees C, for which the molecular area in the condensed phase is consistent with the cross-sectional area assigned for all the alkyl chains. In all the spider-web amphiphiles, the molecular areas at a given pressure in the expanded phase increased in proportion to the number of units, indicating that alkyl chains freely fill the inner space of the dendritic core. The mixing of octadecanoic acid with the spider-web amphiphiles at the air-water interface induced condensation of the molecular area. From the molecular area analysis, the inclusion of the octadecanoic acid bears a stoichiometric characteristic; i.e., the number of captured octadecanoic acids in the spider-web amphiphile roughly agrees with the number of branching points in the spider-web amphiphile.

CRAnE: A JAS-based Data Acquisition System for Cosmic Rays

Energy Technology Data Exchange (ETDEWEB)

Langeveld, Willy G.J.

2003-08-25

Cosmic Ray Analysis Environment (CRAnE) is a software tool designed to collect and plot data from a cosmic ray telescope (CRT) connected to a computer serial port. As a plug-in to Java Analysis Studio (JAS), CRAnE provides visual displays of incoming cosmic ray rates as they are detected. In an effort to make the program user-friendly, it operates through a graphical user interface. This paper describes the features of CRAnE and includes installation and operation instructions in the appended user's manual.

Radiographic analysis of the development of the pelvic limb of captive-reared cranes (Grus spp.)

International Nuclear Information System (INIS)

Curro, T.G.; Langenberg, J.A.; Deakin, L.

1996-01-01

For captive-reared cranes, pelvic limb abnormalities in chicks have been identified as significant morbidity/mortality factors. An important component of the diagnosis of limb abnormalities is the understanding of the normal limb. This study was undertaken to describe the normal, radiographic development of the femur, tibiotarsus, tarsometatarsus, and fibula of the whooping crane (Grus americana), Florida sandhill crane (Grus canadensis pratensis), and Siberian crane (Grus leucogeranus). Crane chicks were anesthetized and their pelvic limb bone development evaluated radiographically on a weekly to bimonthly basis from one to fourteen weeks of age. Body weight, bone length, diaphyseal width, and physeal development and closure were evaluated. Based on the radiographic analysis, the gross development of the long bones of the pelvic limb of whooping, Florida sandhill, and Siberian cranes was found to be similar among the three species, and not dissimilar from other avian species which have been studied. Repeated handling, anesthesia, and radiographic exposure did not produce any behavioral, developmental, or physical abnormalities in the studied cranes when compared to cranes of the same species raised using the same methods. This is the first work to describe pelvic limb bone development in these species

A heuristics-based solution to the continuous berth allocation and crane assignment problem

Directory of Open Access Journals (Sweden)

Mohammad Hamdy Elwany

2013-12-01

Full Text Available Effective utilization plans for various resources at a container terminal are essential to reducing the turnaround time of cargo vessels. Among the scarcest resources are the berth and its associated cranes. Thus, two important optimization problems arise, which are the berth allocation and quay crane assignment problems. The berth allocation problem deals with the generation of a berth plan, which determines where and when a ship has to berth alongside the quay. The quay crane assignment problem addresses the problem of determining how many and which quay crane(s will serve each vessel. In this paper, an integrated heuristics-based solution methodology is proposed that tackles both problems simultaneously. The preliminary experimental results show that the proposed approach yields high quality solutions to such an NP-hard problem in a reasonable computational time suggesting its suitability for practical use.

Investigating transportation system in container terminals and developing a yard crane scheduling model

Directory of Open Access Journals (Sweden)

Hassan Javanshir

2012-01-01

Full Text Available The world trade has tremendous growth in marine transportation. This paper studies yard crane scheduling problem between different blocks in container terminal. Its purpose is to minimize total travel time of cranes between blocks and total delayed workload in blocks at different periods. In this way the problem is formulated as a mixed integer programming (MIP model. The block pairs between which yard cranes will be transferred, during the various periods, is determined by this model. Afterwards the model is coded in LINGO software, which benefits from branch and bound algorithm to solve. Computational results determine the yard cranes movement sequence among blocks to achieve minimum total travel time for cranes and minimum total delayed workload in blocks at different planning periods. Also the results show capability and adequacy of the developed model.

Features and perspectives of automatized construction crane-manipulators

Science.gov (United States)

Stepanov, Mikhail A.; Ilukhin, Peter A.

2018-03-01

Modern construction industry still has a high percentage of manual labor, and the greatest prospects of improving the construction process are lying in the field of automatization. In this article automatized construction manipulator-cranes are being studied in order to achieve the most rational design scheme. This is done through formulating a list of general conditions necessary for such cranes and a set of specialized kinematical conditions. A variety of kinematical schemes is evaluated via these conditions, and some are taken for further dynamical analisys. The comparative dynamical analisys of taken schemes was made and the most rational scheme was defined. Therefore a basis for a more complex and practical research of manipulator-cranes design is given and ways to implement them on practical level can now be calculated properly. Also, the perspectives of implementation of automated control systems and informational networks on construction sites in order to boost the quality of construction works, safety of labour and ecological safety are shown.

Herbivory in spiders: the importance of pollen for orb-weavers.

Science.gov (United States)

Eggs, Benjamin; Sanders, Dirk

2013-01-01

Orb-weaving spiders (Araneidae) are commonly regarded as generalist insect predators but resources provided by plants such as pollen may be an important dietary supplementation. Their webs snare insect prey, but can also trap aerial plankton like pollen and fungal spores. When recycling their orb webs, the spiders may therefore also feed on adhering pollen grains or fungal spores via extraoral digestion. In this study we measured stable isotope ratios in the bodies of two araneid species (Aculepeira ceropegia and Araneus diadematus), their potential prey and pollen to determine the relative contribution of pollen to their diet. We found that about 25% of juvenile orb-weaving spiders' diet consisted of pollen, the other 75% of flying insects, mainly small dipterans and hymenopterans. The pollen grains in our study were too large to be taken up accidentally by the spiders and had first to be digested extraorally by enzymes in an active act of consumption. Therefore, pollen can be seen as a substantial component of the spiders' diet. This finding suggests that these spiders need to be classified as omnivores rather than pure carnivores.

Molecular Evolution of Spider Vision: New Opportunities, Familiar Players.

Science.gov (United States)

Morehouse, Nathan I; Buschbeck, Elke K; Zurek, Daniel B; Steck, Mireille; Porter, Megan L

2017-08-01

Spiders are among the world's most species-rich animal lineages, and their visual systems are likewise highly diverse. These modular visual systems, composed of four pairs of image-forming "camera" eyes, have taken on a huge variety of forms, exhibiting variation in eye size, eye placement, image resolution, and field of view, as well as sensitivity to color, polarization, light levels, and motion cues. However, despite this conspicuous diversity, our understanding of the genetic underpinnings of these visual systems remains shallow. Here, we review the current literature, analyze publicly available transcriptomic data, and discuss hypotheses about the origins and development of spider eyes. Our efforts highlight that there are many new things to discover from spider eyes, and yet these opportunities are set against a backdrop of deep homology with other arthropod lineages. For example, many (but not all) of the genes that appear important for early eye development in spiders are familiar players known from the developmental networks of other model systems (e.g., Drosophila). Similarly, our analyses of opsins and related phototransduction genes suggest that spider photoreceptors employ many of the same genes and molecular mechanisms known from other arthropods, with a hypothesized ancestral spider set of four visual and four nonvisual opsins. This deep homology provides a number of useful footholds into new work on spider vision and the molecular basis of its extant variety. We therefore discuss what some of these first steps might be in the hopes of convincing others to join us in studying the vision of these fascinating creatures.

Acute Generalized Exanthematous Pustulosis (AGEP Triggered by a Spider Bite

Directory of Open Access Journals (Sweden)

Michael Makris

2009-01-01

Discussion: A spider bite may represent a possible causative factor of AGEP. A spider's venom contains sphingomyelinase that stimulates the release of IL8 and GM-CSF, which are involved in AGEP pathogenesis. Whether or not the con-current use of antibiotics has an effect in AGEP appearance when combined with a spider's venom, cannot be excluded.

Coagulopathy after spider bites in a six-year-old boy

Directory of Open Access Journals (Sweden)

Ansari SH.

2008-06-01

Full Text Available Background: Spider bites are common in most parts of the world. In some areas, where snake or scorpion bites are common, spider bites may not be considered a significant problem by the general public and those who have been bitten by spiders may not go to a hospital. However, significant problems are observed in the victims of certain species of spiders including: widow spider (of the genus Latrodectus, including the black widow and brown spiders (of the genus Loxosceles, such as the brown recluse. Case: We report a six-year-old boy, admitted to the hospital two weeks after suffering a spider bite. The patient presented with a severe nose bleed, ecchymosis and purpura, as well as anemia, indicating a clotting disorder. Laboratory results revealed abnormal values for prothrombin time (PT >50 sec, partial thromboplastin time (PTT >120 min and fibrinogen = 0 mg/dl, whereas factor VIII was normal according to a mixing study, with a normal platelet count of 350,000/µl. The patient was managed with fresh frozen plasma every 12 h, and was discharged one week after hospital admission. At present, the patient is well with more normal laboratory results one month after treatment: PT=13.4 sec, PTT= 34 sec, fibrinogen=105 mg/dl.         Conclusions: Although spider bites are uncommon in Iran, severe systemic reactions may occur in the pediatric population requiring admission to the pediatric intensive care unit. These systemic reactions may include hemolytic anemia coagulopathy and renal failure.

HEMATOLOGY AND BIOCHEMISTRY IN CAPTIVE WHITE-NAPED CRANES (GRUS VIPIO).

Science.gov (United States)

Rayhel, Laura; Aitken-Palmer, Copper; Joyner, Priscilla; Cray, Carolyn; Lizárraga, César Andrés; Ackerman, Betty; Crowe, Chris

2015-12-01

In this retrospective study, 36 hematologic and biochemistry samples from white-naped crane (Grus vipio) were analyzed. All birds were housed at a single institution, and samples were obtained between 1990 and 2013. All cranes were healthy at the time of sample collection, and ages ranged from 1 mo to 33 yr old. Cranes below 18 mo old were considered juveniles. Comparisons were made between means for juveniles and adults and for males and females. Significant increases in adults (P cranes were also compared; calcium levels were higher in females (4.68 mg/dl, P < 0.05). Plasma electrophoresis and radioimmunoassay for bile acids were performed on 25 banked serum or plasma samples; results from juvenile and adult samples were also compared. Significant increases in adult birds were found in total protein (1.2 g/dl, P < 0.05) and in all absolute values for all protein types; however, no difference was found when protein fractions were compared. Bile acids were found to decrease in adults (19.9 μM/L, P < 0.05).

Invariant-Based Inverse Engineering of Crane Control Parameters

Science.gov (United States)

González-Resines, S.; Guéry-Odelin, D.; Tobalina, A.; Lizuain, I.; Torrontegui, E.; Muga, J. G.

2017-11-01

By applying invariant-based inverse engineering in the small-oscillation regime, we design the time dependence of the control parameters of an overhead crane (trolley displacement and rope length) to transport a load between two positions at different heights with minimal final-energy excitation for a microcanonical ensemble of initial conditions. The analogy between ion transport in multisegmented traps or neutral-atom transport in moving optical lattices and load manipulation by cranes opens a route for a useful transfer of techniques among very different fields.

Camel spider (Solifugae) use of prairie dog colonies

Science.gov (United States)

Solifugids (camel spiders) are widespread throughout arid regions of western North America and are thought to be important in structuring desert arthropod communities. Despite the ubiquity of camel spiders, little is known about their ecology. Black-tailed prairie dogs (Cynomys ludovicianus) are als...

Nutrient regulation in a predator, the wolf spider Pardosa prativaga

DEFF Research Database (Denmark)

Jensen, Kim; Mayntz, David; Toft, Søren

2011-01-01

Nutrient balancing is well known in herbivores and omnivores, but has only recently been demonstrated in predators. To test how a predator might regulate nutrients when the prey varies in nutrient composition, we restricted juvenile Pardosa prativaga wolf spiders to diets of one of six fruit fly......, Drosophila melanogaster, prey types varying in lipid:protein composition during their second instar. We collected all fly remnants to estimate food and nutrient intake over each meal. The spiders adjusted their capture rate and nutrient extraction in response to prey mass and nutrient composition...... irrespective of energy intake. Intake was initially regulated to a constant lipid plus protein mass, but later spiders fed on prey with high proportions of protein increased consumption relative to spiders fed on other prey types. This pattern indicates that the spiders were prepared to overconsume vast...

Design of bridge crane girder strain acquisition system based on virtual instrument

Directory of Open Access Journals (Sweden)

Wenxue LIU

Full Text Available Girder is an important part of the bridge crane, which is also the main force element. In order to prevent accidents, it is necessary to collect the bridge crane girder stress data to analyse the fatigue life. This paper constructs a bridge crane girder strain acquisition system. The hardware system consists of sensors, connectors, data acquisition cards, wireless data transmission groups, POE power and host computer. The software system consists of NI MAX to interface with the computer's NI hardware and software resources,and LabVIEW programming to display and storage the girder strain data. Through this system, positions and working days strain data acquisition for the 50/10 t bridge crane girder gets the key positions strain data. The results show that the girder strain data acquisition system runs stably, channel signals of acquisition task transmit accurately, and the terminal data stores competely, meeting the detection requirements, which provides an important data support for the subsequent fatigue analysis and accurate remaining service life prediction of the crane girder.

The effect of restraints type on the generated stresses in gantry crane beam

Directory of Open Access Journals (Sweden)

Sowa Leszek

2018-01-01

Full Text Available This paper includes an analysis of the mechanical phenomena in the gantry crane beam, because the cranes are currently one of the most common devices for the transporting loads. Designing modern mechanical structures is a complex task that requires the use of appropriate tools. Such a modern tool is the numerical simulation, which uses different numerical methods. One of the best known methods is the finite element method, also used here. Simulations are limited to analysis of the strength of the gantry crane beam that was the loaded of the force load movement along its length. The numerical analysis was made to the gantry crane beam which cross-section was an I-beam and ends were fixed in different ways. As the result of numerical calculations, the stresses and displacements of the structure of gantry were obtained. The influence of the restraints type and changing the loading force position on generate the Huber-Misses stress in the gantry crane beam was estimated. The aim was to ensure that the maximum equivalent stress generated in the gantry crane beam was less than the strength of material, because then the construction is safe.

Reintroduction medicine: whooping cranes in Wisconsin.

Science.gov (United States)

Keller, Dominique L; Hartup, Barry K

2013-01-01

This paper presents veterinary management strategies and diagnostic findings in the reintroduction of the endangered whooping crane (Grus americana). Between 2005 and 2010, 63 (27 male, 36 female) hatchling whooping cranes were assigned to a reintroduction project involving autumn release of costume-reared chicks in Wisconsin. Veterinary care included preventive measures and comprehensive pre-release evaluations to improve fitness and reduce translocation of potential disease agents to native habitats. A total of 44 clinically normal birds were released (70% of assigned individuals). Cases of morbidity were classified according to primary body system affected. Musculoskeletal disorders were described in 57 birds (90%); five birds were removed from the project prior to release (8%), all for abnormalities that prevented normal function. Fourteen birds died or were euthanized prior to release (22%); pre-release mortality was attributed to developmental abnormality, predation, trauma or infectious disease. Chronic respiratory aspergillosis, diagnosed in seven birds (11%), was the most common infectious disease of concern. Predation and trauma were primary causes of post-release mortality; no evidence of infectious disease of captive origin was detected in the study population by the end of 2010. The assessment of data accumulated by this project helped to outline successful health management strategies, as well as identify and mitigate ongoing risks to captive whooping cranes that impede reintroduction efforts and achieving management goals for species recovery. © 2013 Wiley Periodicals, Inc.

78 FR 8985 - Cranes and Derricks in Construction: Revising the Exemption for Digger Derricks

Science.gov (United States)

2013-02-07

.... OSHA-2012-0025] RIN 1218-AC75 Cranes and Derricks in Construction: Revising the Exemption for Digger... November 9, 2012, to broaden the exemption for digger derricks in its construction standard for cranes and... broaden the exemption for digger derricks in its construction standard for cranes and derricks. In those...

76 FR 75450 - Safety Zone; Container Crane Relocation, Cooper and Wando Rivers, Charleston, SC

Science.gov (United States)

2011-12-02

...-AA00 Safety Zone; Container Crane Relocation, Cooper and Wando Rivers, Charleston, SC AGENCY: Coast... moving safety zone around a barge transporting two container cranes on the Cooper and Wando Rivers during... barge will transit the Cooper and Wando Rivers. Because of the size of the two container cranes and the...

Risk assessment during operating self-propelled lifting jib cranes in conditions of insufficient information

Directory of Open Access Journals (Sweden)

Lagerev A.V.

2017-06-01

Full Text Available Presents the results of statistical analyses identified by the expert diagnostics of defects of the self-propelled lifting jib cranes, spent a normative term of exploitation. The greatest number of defects associated with the destruction and dete-rioration of structural elements, the occurrence of fatigue cracks and a violation of the conditions of operation of the equipment. The greatest number of defects occurs in the hydraulic system of cranes, the rope-block system, and rarely in steel structures. To conduct risk analysis of self-propelled jib cranes in case of insufficient information, proposed the method of expert estimations. It allows to assess the impact of potential defects on self-propelled jib cranes on the value of the economic damage of the crane and moving cargo and the value of the traumatic exposure on men. The proposed list of possible defects self-propelled lifting jib cranes and a checklist of questions about the degree of influence of these defects. Proposed calculated dependences to the approximate calculation of the magnitude of technical risk in the opera-tion of self-propelled jib cranes. The results of statistical analysis of expert estimations for each possible defect and per-formed their ranking in terms of impact on the magnitude of the economic damage of the crane and moving loads, the value of the traumatic exposure. Was calculated the value of technical risk for the surveyed taps.

Arachnid aloft: directed aerial descent in neotropical canopy spiders.

Science.gov (United States)

Yanoviak, Stephen P; Munk, Yonatan; Dudley, Robert

2015-09-06

The behaviour of directed aerial descent has been described for numerous taxa of wingless hexapods as they fall from the tropical rainforest canopy, but is not known in other terrestrial arthropods. Here, we describe similar controlled aerial behaviours for large arboreal spiders in the genus Selenops (Selenopidae). We dropped 59 such spiders from either canopy platforms or tree crowns in Panama and Peru; the majority (93%) directed their aerial trajectories towards and then landed upon nearby tree trunks. Following initial dorsoventral righting when necessary, falling spiders oriented themselves and then translated head-first towards targets; directional changes were correlated with bilaterally asymmetric motions of the anterolaterally extended forelegs. Aerial performance (i.e. the glide index) decreased with increasing body mass and wing loading, but not with projected surface area of the spider. Along with the occurrence of directed aerial descent in ants, jumping bristletails, and other wingless hexapods, this discovery of targeted gliding in selenopid spiders further indicates strong selective pressures against uncontrolled falls into the understory for arboreal taxa. © 2015 The Author(s).

Spider silk reinforced by graphene or carbon nanotubes

Science.gov (United States)

Lepore, Emiliano; Bosia, Federico; Bonaccorso, Francesco; Bruna, Matteo; Taioli, Simone; Garberoglio, Giovanni; Ferrari, Andrea C.; Pugno, Nicola Maria

2017-09-01

Spider silk has promising mechanical properties, since it conjugates high strength (~1.5 GPa) and toughness (~150 J g-1). Here, we report the production of silk incorporating graphene and carbon nanotubes by spider spinning, after feeding spiders with the corresponding aqueous dispersions. We observe an increment of the mechanical properties with respect to pristine silk, up to a fracture strength ~5.4 GPa and a toughness modulus ~1570 J g-1. This approach could be extended to other biological systems and lead to a new class of artificially modified biological, or ‘bionic’, materials.

Seismic evaluation of K basin bridge cranes (HOI-320 ampersand HOI-418) and supporting structure

International Nuclear Information System (INIS)

Winkel, B.V.; Kanjilad, S.K.

1996-03-01

The Safety Class 1 100-K fuel storage basins are vulnerable to impact damage if a bridge crane were to fall during a seismic event. The pupose of this report is to address the adequacy of the K Basin bridge cranes to resist a seismic-induced fall. The approach used to demonstrate adequacy against falling, was to evaluate the crane structural components relative to requirements specified in ASME NOG-1, Rules for Construction of Overhead and Gantry Cranes. Additionally, wheel lift-off and the adequacy of the crane supporting structure, are addressed. Seismic adequacy of the mechanical hoist equipment is not addressed in this report

Parasitism of Trombidium brevimanum larvae on agrobiont linyphiid spiders from Germany.

Science.gov (United States)

Tomić, Vladimir; Mąkol, Joanna; Stamenković, Srdjan; Büchs, Wolfgang; Prescher, Sabine; Sivčev, Ivan; Graora, Draga; Sivčev, Lazar; Gotlin-Čuljak, Tatjana; Dudić, Boris

2015-08-01

An experiment on three differently-managed agricultural fields in Ahlum, Germany, which aimed at establishing the impact of different management systems on the biodiversity of predators and decomposers, yielded a significant number of spiders parasitized by larvae of Trombidium brevimanum (Actinotrichida, Parasitengona, Trombidiidae). Spider data from the whole sampling period (September 2010-July 2012), indicated that ectoparasitic larvae were recorded only on spiders in pitfall traps in the period of June-July 2011. In this period, only eight species of Linyphiidae--out of 42 species assigned to nine spider families recorded from the study area--were parasitized by mites; considerable levels of parasitism were recorded on Erigone atra, E. dentipalpis, and Oedothorax apicatus. The highest prevalence of parasitism was recorded on the organic field for E. atra (29%), while on the integrated and conventional fields significantly fewer parasitized spiders were observed. The preferred attachment sites on the spider host were regions with softer cuticle, especially regions on the carapace and on the abdomen, adjacent to the pedicel.

Cognitive reappraisal of snake and spider pictures: An event-related potentials study.

Science.gov (United States)

Langeslag, Sandra J E; van Strien, Jan W

2018-05-30

Fear of snakes and spiders are common animal phobias. Emotion regulation can change the response to emotional stimuli, including snakes and spiders. It is well known that emotion regulation modulates the late positive potential (LPP), which reflects sustained motivated attention. However, research concerning the effect of emotion regulation on the early posterior negativity (EPN), which reflects early selective attention, is scarce. The present research question was whether the EPN and LPP amplitudes are modulated by regulation of emotional responses to snake and spider stimuli. Emotion up- and down-regulation were expected to enhance and reduce the LPP amplitude, respectively, but emotion regulation was not expected to modulate the EPN amplitude. Female participants passively viewed snake, spider, and bird pictures, and up- and down-regulated their emotional responses to the snake and spider pictures using self-focused reappraisal, while their electroencephalogram was recorded. There were EPNs for snakes and spiders vs. birds, as well as for snakes vs. spiders. The LPP amplitude tended to be enhanced for snakes and spiders compared to birds. Most importantly, the LPP amplitude was larger in the up-regulate than in the down-regulate condition for both snakes and spiders, but there was no evidence that the EPN amplitude was modulated by emotion regulation. This suggests that emotion regulation modulated sustained motivated attention, but not early selective attention, to snakes and spiders. The findings are in line with the notion that the emotional modulation of the EPN is more automatic than the emotional modulation of the LPP. Copyright © 2018 Elsevier B.V. All rights reserved.

Early Cretaceous greenhouse pumped higher taxa diversification in spiders.

Science.gov (United States)

Shao, Lili; Li, Shuqiang

2018-05-24

The Cretaceous experienced one of the most remarkable greenhouse periods in geological history. During this time, ecosystem reorganizations significantly impacted the diversification of many groups of organisms. The rise of angiosperms marked a major biome turnover. Notwithstanding, relatively little remains known about how the Cretaceous global ecosystem impacted the evolution of spiders, which constitute one of the most abundant groups of predators. Herein, we evaluate the transcriptomes of 91 taxa representing more than half of the spider families. We add 23 newly sequenced taxa to the existing database to obtain a robust phylogenomic assessment. Phylogenetic reconstructions using different datasets and methods obtain novel placements of some groups, especially in the Synspermiata and the group having a retrolateral tibial apophysis (RTA). Molecular analyses indicate an expansion of the RTA clade at the Early Cretaceous with a hunting predatory strategy shift. Fossil analyses show a 7-fold increase of diversification rate at the same period, but this likely owes to the first occurrences spider in amber deposits. Additional analyses of fossil abundance show an accumulation of spider lineages in the Early Cretaceous. We speculate that the establishment of a warm greenhouse climate pumped the diversification of spiders, in particular among webless forms tracking the abundance of insect prey. Our study offers a new pathway for future investigations of spider phylogeny and diversification. Copyright © 2018. Published by Elsevier Inc.

78 FR 71666 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Cranes and...

Science.gov (United States)

2013-11-29

... for OMB Review; Comment Request; Cranes and Derricks in Construction Standard ACTION: Notice. SUMMARY... Administration (OSHA) sponsored information collection request (ICR) revision titled, ``Cranes and Derricks in... seeks PRA authorization for the current information collection requirements contained in the Cranes and...

Phylogenomics resolves a spider backbone phylogeny and rejects a prevailing paradigm for orb web evolution.

Science.gov (United States)

Bond, Jason E; Garrison, Nicole L; Hamilton, Chris A; Godwin, Rebecca L; Hedin, Marshal; Agnarsson, Ingi

2014-08-04

Spiders represent an ancient predatory lineage known for their extraordinary biomaterials, including venoms and silks. These adaptations make spiders key arthropod predators in most terrestrial ecosystems. Despite ecological, biomedical, and biomaterial importance, relationships among major spider lineages remain unresolved or poorly supported. Current working hypotheses for a spider "backbone" phylogeny are largely based on morphological evidence, as most molecular markers currently employed are generally inadequate for resolving deeper-level relationships. We present here a phylogenomic analysis of spiders including taxa representing all major spider lineages. Our robust phylogenetic hypothesis recovers some fundamental and uncontroversial spider clades, but rejects the prevailing paradigm of a monophyletic Orbiculariae, the most diverse lineage, containing orb-weaving spiders. Based on our results, the orb web either evolved much earlier than previously hypothesized and is ancestral for a majority of spiders or else it has multiple independent origins, as hypothesized by precladistic authors. Cribellate deinopoid orb weavers that use mechanically adhesive silk are more closely related to a diverse clade of mostly webless spiders than to the araneoid orb-weaving spiders that use adhesive droplet silks. The fundamental shift in our understanding of spider phylogeny proposed here has broad implications for interpreting the evolution of spiders, their remarkable biomaterials, and a key extended phenotype--the spider web. Copyright © 2014 Elsevier Ltd. All rights reserved.

Volatile compounds from leaves of the African spider plant (Gynandropsis gynandra) with bioactivity against spider mite (Tetranychus urticae)

DEFF Research Database (Denmark)

Nyalala, Samuel Odeyo; Petersen, Mikael Agerlin; Grout, Brian William Wilson

2013-01-01

Previous studies have demonstrated that Gynandropsis gynandra emits acetonitrile as a foliar volatile from intact plants and isolated leaves, and that this compound is an effective spider mite repellent. This study has used gas chromatography–mass spectrometry to investigate volatile compounds...... emitted from homogenised G. gynandra leaves to evaluate their tissue acetonitrile content and to look for other compounds that might be exploited for the management of spider mites. Acetonitrile was absent from the homogenised tissues of five lines of G. gynandra, studied over two seasons. Thirteen...... volatile compounds were emitted by G. gynandra at significantly higher levels than mite-susceptible pot roses, including isothiocyanates, aldehydes, esters, alcohols and terpenes. Six representative compounds were selected to assess bioactivity. Spider mite populations were completely inactive after a 2¿h...

Invited review current progress and limitations of spider silk for biomedical applications.

Science.gov (United States)

Widhe, Mona; Johansson, Jan; Hedhammar, My; Rising, Anna

2012-06-01

Spider silk is a fascinating material combining remarkable mechanical properties with low density and biodegradability. Because of these properties and historical descriptions of medical applications, spider silk has been proposed to be the ideal biomaterial. However, overcoming the obstacles to produce spider silk in sufficient quantities and in a manner that meets regulatory demands has proven to be a difficult task. Also, there are relatively few studies of spider silk in biomedical applications available, and the methods and materials used vary a lot. Herein we summarize cell culture- and in vivo implantation studies of natural and synthetic spider silk, and also review the current status and future challenges in the quest for a large scale production of spider silk for medical applications. Copyright © 2011 Wiley Periodicals, Inc.

Determination of PCDDs in spider webs: preliminary studies

Science.gov (United States)

Rybak, Justyna; Rutkowski, Radosław

2018-01-01

The application of spider webs for determination of polichlorinated dibenzo-para-dioxins (PCDDs) has been studied for the first time. The aim of the studies was to find out if spider webs are suitable for such examinations as it was proved in the previous research they are excellent indicators of air pollutants. Spiders are ubiquitous, thus collection of samples is easy and non-invasive. Studies were conducted within the city of Wrocław and surroundings, one of the biggest and at the same time heaviest polluted city in Poland. Five research sites have been chosen, where spider webs were collected after 60 days of continuous exposure time. Webs belonging to two genera Tegenaria sylvestris and Tegenaria ferruginea (family Agelenidae) have been chosen as they are large and very dense, thus they are very suitable for such examinations. Webs were found to retain dioxins probably mainly by external exposure. These promising results should be continued and expanded in the future research.

Design of a WSN-Based Monitoring System for Avoiding Collision of Tower Cranes

Directory of Open Access Journals (Sweden)

Jiannong Wang

2014-07-01

Full Text Available Tower cranes in large construction projects are likely to collide with other cranes close to them during the operation, which is a severe hazard to the security of the staff. Thus, a WSN- based monitoring system for avoiding collision of tower cranes is proposed. The 3D data positioning technology is used to install angle and position sensors at intervals in the cranes in order to collect position data in real time. After the data are sent to the upper computer, the computer calculates the distance using the 3D positioning technique and sets a proper threshold for alarm. When the measured distance is smaller than the threshold, the alarm is set off to prevent collision. In the experiment, three pairs of cranes 15-22 m in height that are located separately are tested in terms of errors in data collection and in alarms. The experimental results show that the proposed system has an alarm accuracy of 99.3 %, and thus, is highly applicable.

Spider fauna of semiarid eastern Colorado agroecosystems: diversity, abundance, and effects of crop intensification.

Science.gov (United States)

Kerzicnik, Lauren M; Peairs, Frank B; Cushing, Paula E; Draney, Michael L; Merrill, Scott C

2013-02-01

Spiders are critical predators in agroecosystems. Crop management practices can influence predator density and diversity, which, in turn, can influence pest management strategies. Crop intensification is a sustainable agricultural technique that can enhance crop production although optimizing soil moisture. To date, there is no information on how crop intensification affects natural enemy populations, particularly spiders. This study had two objectives: to characterize the abundance and diversity of spiders in eastern Colorado agroecosystems, and to test the hypothesis that spider diversity and density would be higher in wheat (Triticum aestivum L.) in crop-intensified rotations compared with wheat in conventional rotations. We collected spiders through pitfall, vacuum, and lookdown sampling from 2002 to 2007 to test these objectives. Over 11,000 spiders in 19 families from 119 species were captured from all sampling techniques. Interestingly, the hunting spider guild represented 89% of the spider fauna captured from all sites with the families Gnaphosidae and Lycosidae representing 75% of these spiders. Compared with European agroecosystems, these agroecosystems had greater diversity, which can be beneficial for the biological control of pests. Overall, spider densities were low in these semiarid cropping systems, and crop intensification effects on spider densities were not evident at this scale.

A Cable-Passive Damper System for Sway and Skew Motion Control of a Crane Spreader

Directory of Open Access Journals (Sweden)

La Duc Viet

2015-01-01

Full Text Available While the crane control problem is often approached by applying a certain active control command to some parts of the crane, this paper proposes a cable-passive damper system to reduce the vibration of a four-cable suspended crane spreader. The residual sway and skew motions of a crane spreader always produce the angle deflections between the crane cables and the crane spreader. The idea in this paper is to convert those deflections into energy dissipated by the viscous dampers, which connect the cables and the spreader. The proposed damper system is effective in reducing spreader sway and skew motions. Moreover, the optimal damping coefficient can be found analytically by minimizing the time integral of system energy. The numerical simulations show that the proposed passive system can assist the input shaping control of the trolley motion in reducing both sway and skew responses.

Analysis of Offshore Knuckle Boom Crane - Part Two: Motion Control

Directory of Open Access Journals (Sweden)

Morten K. Bak

2013-10-01

Full Text Available In this paper design of electro-hydraulic motion control systems for offshore knuckle boom cranes is discussed. The influence of the control valve bandwidth along with the ramp time for the control signal are investigated both analytically with simplified system models and numerically with an experimentally verified crane model. The results of both types of investigations are related to general design rules for selection of control valves and ramp times and the relevance of these design rules is discussed. Generally, they are useful but may be too conservative for offshore knuckle boom cranes. However, as demonstrated in the paper, the only proper way to determine this is to evaluate the motion control system design by means of simulation.

Extended spider cognition.

Science.gov (United States)

Japyassú, Hilton F; Laland, Kevin N

2017-05-01

There is a tension between the conception of cognition as a central nervous system (CNS) process and a view of cognition as extending towards the body or the contiguous environment. The centralised conception requires large or complex nervous systems to cope with complex environments. Conversely, the extended conception involves the outsourcing of information processing to the body or environment, thus making fewer demands on the processing power of the CNS. The evolution of extended cognition should be particularly favoured among small, generalist predators such as spiders, and here, we review the literature to evaluate the fit of empirical data with these contrasting models of cognition. Spiders do not seem to be cognitively limited, displaying a large diversity of learning processes, from habituation to contextual learning, including a sense of numerosity. To tease apart the central from the extended cognition, we apply the mutual manipulability criterion, testing the existence of reciprocal causal links between the putative elements of the system. We conclude that the web threads and configurations are integral parts of the cognitive systems. The extension of cognition to the web helps to explain some puzzling features of spider behaviour and seems to promote evolvability within the group, enhancing innovation through cognitive connectivity to variable habitat features. Graded changes in relative brain size could also be explained by outsourcing information processing to environmental features. More generally, niche-constructed structures emerge as prime candidates for extending animal cognition, generating the selective pressures that help to shape the evolving cognitive system.

78 FR 42800 - Certain Crawler Cranes and Components Thereof; Institution of Investigation Pursuant to United...

Science.gov (United States)

2013-07-17

... INTERNATIONAL TRADE COMMISSION [Investigation No. 337-TA-887] Certain Crawler Cranes and... amended, 19 U.S.C. 1337, on behalf of Manitowoc Cranes, LLC of Manitowoc, Wisconsin. The complaint alleges... the sale within the United States after importation of certain crawler cranes and components thereof...

A comparison of spider communities in Bt and non-Bt rice fields.

Science.gov (United States)

Lee, Sue Yeon; Kim, Seung Tae; Jung, Jong Kook; Lee, Joon-Ho

2014-06-01

To assess the potential adverse effects of a Bt rice line (Japonica rice cultivar, Nakdong) expressing a synthetic cry1Ac1 gene, C7-1-9-1-B, which was highly active against all larval stages of Cnaphalocrocis medinalis (Guenée) (Lepidoptera: Crambidae), we investigated the community structure of spiders in Bt and non-Bt rice fields during the rice-growing season in 2007 and 2008 in Chungcheongnam-do, Korea. Spiders were surveyed with a sweep net and suction device. Suction sampling captured more spiders, measured in terms of species level and abundance, than sweeping. Araneidae and Thomisidae were captured more by sweeping, and certain species were captured only by sweeping. These findings show that both suction and sweep sampling methods should be used because these methods are most likely complementary. In total, 29 species in 23 genera and nine families were identified from the 4,937 spiders collected, and both Bt and non-Bt rice fields showed a typical Korean spider assemblage. The temporal patterns of spider species richness and spider abundance were very similar between Bt and non-Bt rice, although significant differences in species richness were observed on a few occasions. Overall, spider community structure, including diversity, the dominant species, and abundance did not differ between Bt and non-Bt rice. The results of the study indicated that the transgenic Cry1Ac rice lines tested in this study had no adverse effects on the spider community structure of the rice fields.

Edge effect on weevils and spiders

OpenAIRE

Horváth, R.; Magura, T.; Péter, G.; Tóthmérész, B.

2002-01-01

The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest...

Cuticular bacteria appear detrimental to social spiders in mixed but not monoculture exposure

Science.gov (United States)

Keiser, Carl N.; Shearer, Taylor A.; DeMarco, Alexander E.; Brittingham, Hayley A.; Knutson, Karen A.; Kuo, Candice; Zhao, Katherine; Pruitt, Jonathan N.

2016-01-01

Abstract Much of an animal’s health status, life history, and behavior are dictated by interactions with its endogenous and exogenous bacterial communities. Unfortunately, interactions between hosts and members of their resident bacterial community are often ignored in animal behavior and behavioral ecology. Here, we aim to identify the nature of host–microbe interactions in a nonmodel organism, the African social spider Stegodyphus dumicola. We collected and identified bacteria from the cuticles of spiders in situ and then exposed spiders to bacterial monocultures cultures via topical application or injection. We also topically inoculated spiders with a concomitant “cocktail” of bacteria and measured the behavior of spiders daily for 24 days after inoculation. Lastly, we collected and identified bacteria from the cuticles of prey items in the capture webs of spiders, and then fed spiders domestic crickets which had been injected with these bacteria. We also injected 1 species of prey-borne bacteria into the hemolymph of spiders. Only Bacillus thuringiensis caused increased mortality when injected into the hemolymph of spiders, whereas no bacterial monocultures caused increased mortality when applied topically, relative to control solutions. However, a bacterial cocktail of cuticular bacteria caused weight loss and mortality when applied topically, yet did not detectibly alter spider behavior. Consuming prey injected with prey-borne bacteria was associated with an elongated lifespan in spiders. Thus, indirect evidence from multiple experiments suggests that the effects of these bacteria on spider survivorship appear contingent on their mode of colonization and whether they are applied in monoculture or within a mixed cocktail. We urge that follow-up studies should test these host–microbe interactions across different social contexts to determine the role that microbes play in colony performance. PMID:29491926

STRESS-DEFORMED STATE OF A STRUT-FRAMED CRANE GIRDER

Directory of Open Access Journals (Sweden)

Kh. M. Muselemov

2017-01-01

Full Text Available Objectives. The aim of the present work is to study the influence of design parameters on the stress-deformed state of a sprengel crane girder; to compile the tables and corresponding graphs illustrating changes in internal force factors in the characteristic cross-sections of the system elements under consideration. The article describes the study of the stress-deformed state (SDS of a metal strut-framed crane girder.Methods. Numerical methods of analysis based on the use of the Green's function are used during solving this problem. A dimensionless parameter is introduced, depending on which the tables and graphs are constructed. According to the known algorithm, the calculations of internal force factors in the sections of the considered construction are performed.Results. Depending on the dimensionless parameter characterising the geometry and physical features of the system, tables of bending moments and transverse forces are compiled. According to these tables, the appropriate graphs are plotted in order to choose easily the optimal design parameters.Conclusion. The dependence of the moments and transverse forces on the dimensionless parameter k was found, the corresponding graphs were plotted and the metal costs for the girders were calculated. The minimum values of the moments and transverse forces are established to take place when the dimensionless parameter k values are close to zero. The most economical was a strut-framed crane girder having k = 0.0001. The most uneconomical had k = 0.05 and k =∞. Eventually, the sprengel girders were found to be more profitable as compared to conventional crane girders. In the examples considered in the article, the metal savings amounted up to 14%. The presented methodology allows the calculation and designing of strut-framed crane girders with two racks to be carried out. 

[Effects of habitat fragmentation on nesting site selection of red-crowned crane].

Science.gov (United States)

Wan, Dongmei; Gao, Wei; Wang, Qiuyu; Wang, Haitao; Liu, Mingyu

2002-05-01

During April and May of 1985, 1995 and 1998, red-crowned crane's nesting and variation of breeding population quantities in Shuangtaihekou National Natural Reserve in Liaoning, and also the habitat fragmentation there were investigated. Associated with previous data of the reserve, red-crowned crane's nesting habitat had been seriously fragmentated into 91 patches from one integrated reed wetland. The area of the smallest patch was 0.37 km2, and the minimum distance of two nests was 304 m. Compared with records of previous data, the minimum area of nesting habitat reduced by 0.72 km2. However, the breeding population quantities of red-crowned crane had maintained at about 30 pairs for a long period. The red-crowned crane adapted to the changed environment by the ecological adaptation strategy of reducing area of nesting habitat.

Subsocial behaviour and brood adoption in mixed-species colonies of two theridiid spiders

DEFF Research Database (Denmark)

Grinsted, Lena; Agnarsson, Ingi; Bilde, Trine

2012-01-01

Cooperation and group living often evolves through kin selection. However, associations between unrelated organisms, such as different species, can evolve if both parties benefit from the interaction. Group living is rare in spiders, but occurs in cooperative, permanently social spiders, as well...... as in territorial, colonial spiders. Mixed species spider colonies, involving closely related species, have rarely been documented. We examined social interactions in newly discovered mixed-species colonies of theridiid spiders on Bali, Indonesia. Our aim was to test the degree of intra- and interspecific tolerance...

Seismic effects on the reliability of polar cranes for nuclear power plants

International Nuclear Information System (INIS)

Kaiser, W.; Friedrich, H.; Knoefel, L.

1985-01-01

In order to meet the requirements of nuclear safety reactor components have to be designed aseismically. A model for studying simulated seismic effects on the reliability of containment equipment polar cranes is presented. Based on this model vertical and horizontal motions of the crane are investigated. Emphasis is laid on non-linearities caused by malfunctions such as lift of the crane from the runaway, lift of the trolley from the beams, slackening of the ropes as well as sliding of blocked track wheels. Seismic excitations are simulated by computer produced accelerograms

The time course of location-avoidance learning in fear of spiders.

Science.gov (United States)

Rinck, Mike; Koene, Marieke; Telli, Sibel; Moerman-van den Brink, Wiltine; Verhoeven, Barbara; Becker, Eni S

2016-01-01

Two experiments were designed to study the time course of avoidance learning in spider fearfuls (SFs) under controlled experimental conditions. To achieve this, we employed an immersive virtual environment (IVE): While walking freely through a virtual art museum to search for specific paintings, the participants were exposed to virtual spiders. Unbeknown to the participants, only two of four museum rooms contained spiders, allowing for avoidance learning. Indeed, the more SF the participants were, the faster they learned to avoid the rooms that contained spiders (Experiment. 1), and within the first six trials, high fearfuls already developed a preference for starting their search task in rooms without spiders (Experiment 2). These results illustrate the time course of avoidance learning in SFs, and they speak to the usefulness of IVEs in fundamental anxiety research.

Edge effect on weevils and spiders

Directory of Open Access Journals (Sweden)

R. Horváth

2002-05-01

Full Text Available The edge effect on weevils and spiders was tested along oak forest – meadow transects using sweep-net samples at the Síkfökút Project in Hungary. For spiders the species richness was significantly higher in the forest edge than either in the meadow or the forest interior. For weevils the species richness of the forest edge was higher than that of the meadow, but the difference was not statistically significant whereas the species richness of the forest interior was significantly lower than that of the forest edge and the meadow. The composition of the spider assemblage of the edge was more similar to the forest, while the composition of weevils in the edge was more similar to the meadow. Our results based on two invertebrate groups operating on different trophic levels suggest that there is a significant edge effect for the studied taxa resulting in higher species richness in the edge.

Endemic harvestmen and spiders of Austria (Arachnida: Opiliones, Araneae

Directory of Open Access Journals (Sweden)

Komposch, Christian

2011-01-01

Full Text Available A comprehensive overview of plant, fungus and animal species of Austria revealed a total of 748 endemic and subendemic species, including, 11 harvestman and 46 spider species. Altogether two endemic harvestmen (Nemastoma bidentatum relictum, Nemastoma schuelleri and 8 endemic spiders (Abacoproeces molestus, Collinsia (caliginosa nemenziana, Mughiphantes severus, Mughiphantes styriacus, Pelecopsis alpica, Scotophaeus nanus, Troglohyphantes novicordis, Troglohyphantes tauriscus, beside 9 subendemic harvestman and 38 subendemic spider species have been recorded from Austria. Hot-spots of endemism in the Eastern Alps are the north-eastern (Ennstaler Alps and southern Calcareous Alps (Karawanken, Karnische Alps and the Central Alps (Hohe Tauern, Gurktaler Alps, Ötztaler and Stubaier Alps. Most of the endemic arachnid species occur from the nival down to the montane zone. Important habitats are rocky areas, caves and woodlands. High absolute numbers and percentages of endemics can be found within the harvestman families Cladonychiidae, Ischyropsalididae and Nemastomatidae and in the spider genera Lepthyphantes s. l. and Troglohyphantes. The conservation status of these highly endangered taxa – 85 % of the spider species and 100 % of the harvestman taxa are endangered in Austria – is poor.

SPIDER: A Framework for Understanding Driver Distraction.

Science.gov (United States)

Strayer, David L; Fisher, Donald L

2016-02-01

The objective was to identify key cognitive processes that are impaired when drivers divert attention from driving. Driver distraction is increasingly recognized as a significant source of injuries and fatalities on the roadway. A "SPIDER" model is developed that identifies key cognitive processes that are impaired when drivers divert attention from driving. SPIDER is an acronym standing for scanning, predicting, identifying, decision making, and executing a response. When drivers engage in secondary activities unrelated to the task of driving, SPIDER-related processes are impaired, situation awareness is degraded, and the ability to safely operate a motor vehicle may be compromised. The pattern of interference helps to illuminate the sources of driver distraction and may help guide the integration of new technology into the automobile. © 2015, Human Factors and Ergonomics Society.

Information processing biases in spider phobia: application of the Stroop and "White Noise" Paradigm.

Science.gov (United States)

Olatunji, Bunmi O; Sawchuk, Craig N; Lee, Thomas C; Lohr, Jeffrey M; Tolin, David F

2008-06-01

The present study examines attentional and implicit memory biases in spider phobic and nonphobic participants. The results showed that spider phobics demonstrated increased interference for neutral, negative, and spider-relevant words on a computerized Stroop task. However, no group differences emerged when adjusting for differences in color-naming speed. Prior exposure to a dead spider did result in higher overall Stroop interference in spider phobics and this appeared to be mostly pronounced for spider-relevant words. Implicit memory bias for threat was examined with a noise judgment task. Participants first heard neutral and spider-relevant sentences and implicit memory for these sentences was evaluated by having participants rate the volume of noise accompanying the presentation of old sentences intermixed with new sentences. An implicit memory bias is indicated if participants rate noise accompanying old sentences as less loud than noise accompanying new sentences. No evidence was found for an implicit memory bias in spider phobics. These findings are discussed in relation to the role of information processing biases in spider phobia.

Climate change, cranes, and temperate floodplain ecosystems

Science.gov (United States)

King, Sammy L.

2010-01-01

Floodplain ecosystems provide important habitat to cranes globally. Lateral, longitudinal, vertical, and temporal hydrologic connectivity in rivers is essential to maintaining the functions and values of these systems. Agricultural development, flood control, water diversions, dams, and other anthropogenic activities have greatly affected hydrologic connectivity of river systems worldwide and altered the functional capacity of these systems. Although the specific effects of climate change in any given area are unknown, increased intensity and frequency of flooding and droughts and increased air and water temperatures are among many potential effects that can act synergistically with existing human modifications in these systems to create even greater challenges in maintaining ecosystem productivity. In this paper, I review basic hydrologic and geomorphic processes of river systems and use three North American rivers (Guadalupe, Platte, and Rio Grande) that are important to cranes as case studies to illustrate the challenges facing managers tasked with balancing the needs of cranes and people in the face of an uncertain climatic future. Each river system has unique natural and anthropogenic characteristics that will affect conservation strategies. Mitigating the effects of climate change on river systems necessitates an understanding of river/floodplain/landscape linkages, which include people and their laws as well as existing floodplain ecosystem conditions.

Spider diversity in coffee agroecosystems: the influence of agricultural intensification and aggressive ants.

Science.gov (United States)

Marín, Linda; Perfecto, Ivette

2013-04-01

Spiders are a very diverse group of invertebrate predators found in agroecosystems and natural systems. However, spider distribution, abundance, and eventually their ecological function in ecosystems can be influenced by abiotic and biotic factors such as agricultural intensification and dominant ants. Here we explore the influence of both agricultural intensification and the dominant arboreal ant Azteca instabilis on the spider community in coffee agroecosystems in southern Mexico. To measure the influence of the arboreal ant Azteca instabilis (F. Smith) on the spider community inhabiting the coffee layer of coffee agroecosystems, spiders were collected from coffee plants that were and were not patrolled by the ant in sites differing in agricultural intensification. For 2008, generalized linear mixed models showed that spider diversity was affected positively by agricultural intensification but not by the ant. However, results suggested that some spider species were associated with A. instabilis. Therefore, in 2009 we concentrated our research on the effect of A. instabilis on spider diversity and composition. For 2009, generalized linear mixed models show that spider richness and abundance per plant were significantly higher in the presence of A. instabilis. In addition, analyses of visual counts of insects and sticky traps data show that more resources were present in plants patrolled by the ant. The positive effect of A. instabilis on spiders seems to be caused by at least two mechanisms: high abundance of insects and protection against predators.

Seasonal movements and multiscale habitat selection of Whooping Crane (Grus americana) in natural and agricultural wetlands

Science.gov (United States)

Pickens, Bradley A.; King, Sammy L.; Vasseur, Phillip L.; Zimorski, Sara E.; Selman, Will

2017-01-01

Eleven of 15 species of cranes (family: Gruidae) are considered vulnerable or endangered, and the increase of agriculture and aquaculture at the expense of natural wetlands and grasslands is a threat to Gruidae worldwide. A reintroduced population of Whooping Crane (Grus americana) was studied in coastal and agricultural wetlands of Louisiana and Texas, USA. The objectives were to compare Whooping Crane movements across seasons, quantify multiscale habitat selection, and identify seasonal shifts in selection. Whooping Cranes (n = 53) were tracked with satellite transmitters to estimate seasonal core-use areas (50% home range contours) via Brownian bridge movement models and assess habitat selection. Whooping Crane core-use areas (n = 283) ranged from 4.7 to 438.0 km2, and habitat selection changed seasonally as shallow water availability varied. Whooping Crane core-use areas were composed of more fresh marsh in spring/summer, but shifted towards rice and crawfish (Procambarus spp.) aquaculture in the fall/winter. Within core-use areas, aquaculture was most strongly selected, particularly in fall when fresh marsh became unsuitable. Overall, the shifting of Whooping Crane habitat selection over seasons is likely to require large, heterogeneous areas. Whooping Crane use of agricultural and natural wetlands may depend on spatio-temporal dynamics of water depth.

Reconstitutable control rod spider assembly

International Nuclear Information System (INIS)

Shallenberger, J.M.; Ferian, S.J.

1990-01-01

A reconstitutable control rod/spider assembly includes a hollow connecting finger of the spider having a pair of opposing flat segments formed on the interior thereof and engaging a pair of opposing flat sectors formed on the exterior of a stem extending form the upper end of control rod. The stem also has an externally-threaded portion engaging a nut and a pilot aligning portion for the nut. The nut has a radially flexible and expandable thread-defining element captured in its bore. The segments and sectors allow the rod to be removed and reattached after turning through 180 0 to allow more even wear on the rod. (author)

Phylogenomics, Diversification Dynamics, and Comparative Transcriptomics across the Spider Tree of Life.

Science.gov (United States)

Fernández, Rosa; Kallal, Robert J; Dimitrov, Dimitar; Ballesteros, Jesús A; Arnedo, Miquel A; Giribet, Gonzalo; Hormiga, Gustavo

2018-05-07

Dating back to almost 400 mya, spiders are among the most diverse terrestrial predators [1]. However, despite considerable effort [1-9], their phylogenetic relationships and diversification dynamics remain poorly understood. Here, we use a synergistic approach to study spider evolution through phylogenomics, comparative transcriptomics, and lineage diversification analyses. Our analyses, based on ca. 2,500 genes from 159 spider species, reject a single origin of the orb web (the "ancient orb-web hypothesis") and suggest that orb webs evolved multiple times since the late Triassic-Jurassic. We find no significant association between the loss of foraging webs and increases in diversification rates, suggesting that other factors (e.g., habitat heterogeneity or biotic interactions) potentially played a key role in spider diversification. Finally, we report notable genomic differences in the main spider lineages: while araneoids (ecribellate orb-weavers and their allies) reveal an enrichment in genes related to behavior and sensory reception, the retrolateral tibial apophysis (RTA) clade-the most diverse araneomorph spider lineage-shows enrichment in genes related to immune responses and polyphenic determination. This study, one of the largest invertebrate phylogenomic analyses to date, highlights the usefulness of transcriptomic data not only to build a robust backbone for the Spider Tree of Life, but also to address the genetic basis of diversification in the spider evolutionary chronicle. Copyright © 2018 Elsevier Ltd. All rights reserved.

Spiders (Araneae) Found in Bananas and Other International Cargo Submitted to North American Arachnologists for Identification.

Science.gov (United States)

Vetter, Richard S; Crawford, Rodney L; Buckle, Donald J

2014-11-01

Spiders found in international cargo brought into North America are sometimes submitted to arachnologists for identification. Often, these spiders are presumed to be of medical importance because of size or a submitter's familiarity with a toxic spider genus from the continent of origin. Starting in 2006, requests were made for spiders found in international cargo brought into North America, in addition to the specimens from similar cargo shipments already in our museum collections. This was an ad hoc study that allowed us to focus on spiders of concern to the discoverer. We identified 135 spiders found in international cargo. A key for the most common species is provided. The most frequently submitted spiders were the pantropical huntsman spider, Heteropoda venatoria (L.) (Sparassidae), and the redfaced banana spider, Cupiennius chiapanensis Medina Soriano (Ctenidae). Spiders of medical importance were rare. The most common cargo from which spiders were submitted was bananas with most specimens coming from Central America, Ecuador, or Colombia. Lack of experience with nonnative fauna caused several experienced American arachnologists to misidentify harmless ctenid spiders (C. chiapanensis, spotlegged banana spider, Cupiennius getazi Simon) as highly toxic Phoneutria spiders. These misidentifications could have led to costly, unwarranted prophylactic eradication measures, unnecessary employee health education, heightened employee anxiety and spoilage when perishable goods are left unloaded due to safety concerns. © 2014 Entomological Society of America.

Remote monitoring of vibrational information in spider webs

Science.gov (United States)

Mortimer, B.; Soler, A.; Siviour, C. R.; Vollrath, F.

2018-06-01

Spiders are fascinating model species to study information-acquisition strategies, with the web acting as an extension of the animal's body. Here, we compare the strategies of two orb-weaving spiders that acquire information through vibrations transmitted and filtered in the web. Whereas Araneus diadematus monitors web vibration directly on the web, Zygiella x-notata uses a signal thread to remotely monitor web vibration from a retreat, which gives added protection. We assess the implications of these two information-acquisition strategies on the quality of vibration information transfer, using laser Doppler vibrometry to measure vibrations of real webs and finite element analysis in computer models of webs. We observed that the signal thread imposed no biologically relevant time penalty for vibration propagation. However, loss of energy (attenuation) was a cost associated with remote monitoring via a signal thread. The findings have implications for the biological use of vibrations by spiders, including the mechanisms to locate and discriminate between vibration sources. We show that orb-weaver spiders are fascinating examples of organisms that modify their physical environment to shape their information-acquisition strategy.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Directory of Open Access Journals (Sweden)

Yann Hénaut

Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

Environmental and hormonal factors controlling reversible colour change in crab spiders.

Science.gov (United States)

Llandres, Ana L; Figon, Florent; Christidès, Jean-Philippe; Mandon, Nicole; Casas, Jérôme

2013-10-15

Habitat heterogeneity that occurs within an individual's lifetime may favour the evolution of reversible plasticity. Colour reversibility has many different functions in animals, such as thermoregulation, crypsis through background matching and social interactions. However, the mechanisms underlying reversible colour changes are yet to be thoroughly investigated. This study aims to determine the environmental and hormonal factors underlying morphological colour changes in Thomisus onustus crab spiders and the biochemical metabolites produced during these changes. We quantified the dynamics of colour changes over time: spiders were kept in yellow and white containers under natural light conditions and their colour was measured over 15 days using a spectrophotometer. We also characterised the chemical metabolites of spiders changing to a yellow colour using HPLC. Hormonal control of colour change was investigated by injecting 20-hydroxyecdysone (20E) into spiders. We found that background colouration was a major environmental factor responsible for colour change in crab spiders: individuals presented with white and yellow backgrounds changed to white and yellow colours, respectively. An ommochrome precursor, 3-OH-kynurenine, was the main pigment responsible for yellow colour. Spiders injected with 20E displayed a similar rate of change towards yellow colouration as spiders kept in yellow containers and exposed to natural sunlight. This study demonstrates novel hormonal manipulations that are capable of inducing reversible colour change.

A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest

Science.gov (United States)

Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain

2014-01-01

Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055

Analysis of Electrical Power Consumption in Container Crane of Container Terminal Surabaya

Directory of Open Access Journals (Sweden)

A.A. Masroeri

2017-12-01

Full Text Available Container crane electrification is a re-powering process of container cranes from diesel to electricity. In electrification process, it is required an analysis of electrical power consumption that is needed in the operational of container crane. It aims to determine whether the amount of electrical power that is supplied by PLN can be optimally used in the operational of container crane to do loading and unloading activities. To perform the analysis of electrical power consumption, it is required various data and calculations. The required data are container crane specifications and other electrical equipment specifications, the amount of electrical power that is supplied by PLN, also the single line diagram from the electrical system at the port. While, the calculations that is needed to be performed are the calculation of electrical power load in motors and other electrical equipments, the calculation of nominal current and start current, the selection of cable and busbar, and the calculation of wiring diagram junction power. From the calculations that has been done, then the next step is to do the load flow analysis simulation by using software simulation, so an accurate and effective load flow analysis can be obtained to optimize loading and unloading activities at the port. The result of this research, it can be seen that container crane electrification will give advantages in both technical and economical for the company and for the ship, such as accelerate the loading and unloading time of containers and reduce idle time, especially in the operational of diesel generator.

Further Research on an Anti-Swing Control System for Overhead Cranes

Directory of Open Access Journals (Sweden)

B. Spruogis

2018-02-01

Full Text Available A method of reducing load oscillations that occur when overhead crane reaches destination position is presented in the article. The use of control drive scheme of crane bridge and trolley that ensures a smooth phase trajectory transition of the load to the optimum trajectory in accordance with Pontryagin's maximum principle is proposed. Mentioned control system changes the magnitude or direction of the traction force at the moment when the load is located above the destination. It is found that the degree of change of the traction force depends on the hoisting rope deviation angle from vertical. This study was conducted in order to provide more accurate and fast handling of loads by overhead crane.

Identification, inheritance, and linkage of B-G-like and MHC class I genes in cranes

Science.gov (United States)

Jarvi, S.I.; Goto, R.M.; Gee, G.F.; Briles, W.E.; Miller, M.M.

1999-01-01

We identified B-G-like genes in the whooping and Florida sandhill cranes and linked them to the major histocompatibility complex (MHC). We evaluated the inheritance of B-G-like genes in families of whooping and Florida sandhill cranes using restriction fragment patterns (RFPs). Two B-G-like genes, designated wcbgl and wcbg2, were located within 8 kb of one another. The fully sequenced wcbg2 gene encodes a B-G IgV-like domain, an additional Ig-like domain, a transmembrane domain, and a single heptad domain typical of '-helical coiled coils. Patterns of restriction fragments in DNA from the whooping crane and from a number of other species indicate that the B-G-like gene families of cranes are large with diverse sequences. Segregation of RFPs in families of Florida sandhill cranes provide evidence for genetic polymorphism in the B-G-like genes. The restriction fragments generally segregated in concert with MHC haplotypes assigned by serological typing and by single stranded conformational polymorphism (SSCP) assays based in the second exon of the crane MHC class I genes. This study supports the concept of a long-term association of polymorphic B-G-like genes with the MHC. It also establishes SSCP as a means for evaluating MHC genetic variability in cranes.

Identification, inheritance, and linkage of B-G-like and MHC class I genes in cranes.

Science.gov (United States)

Jarvi, S I; Goto, R M; Gee, G F; Briles, W E; Miller, M M

1999-01-01

We identified B-G-like genes in the whooping and Florida sandhill cranes and linked them to the major histocompatibility complex (MHC). We evaluated the inheritance of B-G-like genes in families of whooping and Florida sandhill cranes using restriction fragment patterns (RFPs). Two B-G-like genes, designated wcbg1 and wcbg2, were located within 8 kb of one another. The fully sequenced wcbg2 gene encodes a B-G IgV-like domain, an additional Ig-like domain, a transmembrane domain, and a single heptad domain typical of alpha-helical coiled coils. Patterns of restriction fragments in DNA from the whooping crane and from a number of other species indicate that the B-G-like gene families of cranes are large with diverse sequences. Segregation of RFPs in families of Florida sandhill cranes provide evidence for genetic polymorphism in the B-G-like genes. The restriction fragments generally segregated in concert with MHC haplotypes assigned by serological typing and by single stranded conformational polymorphism (SSCP) assays based in the second exon of the crane MHC class I genes. This study supports the concept of a long-term association of polymorphic B-G-like genes with the MHC. It also establishes SSCP as a means for evaluating MHC genetic variability in cranes.

Small Molecules from Spiders Used as Chemical Probes

DEFF Research Database (Denmark)

Olsen, Christian Adam; Kristensen, Anders S.; Strømgaard, Kristian

2011-01-01

Spiders are important species in ecological systems and as major predators of insects they are endowed with a plethora of low‐molecular‐weight natural products having intriguing biological activities. The isolation and biological characterization of these entities are well established, however......, only very recently have these compounds been used as templates for the design, synthesis, and biological evaluation of synthetic analogues. In contrast, the investigation of compounds responsible for chemical communication between spiders is far less developed, but recently new light has been shed onto...... the area of pheromones and allomones from spiders. Herein, we recapitulate these recent results, put them into perspective with previous findings, and provide an outlook for future studies of these chemotypes....

Exploring of the first recorded spider (Arachenida: Aranae species of Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Perveen

2015-09-01

Full Text Available The spiders (Arthropoada: Arachenida are one of the groups of grasping animals. Their carapaces are found on the dorsal side of the cephalothorax, which is an important characteristic of spiders. The present study was conducted to explore the first recorded spider species (nti=75 of Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Dir Upper, Khyber Pakhtunkhwa, Pakistan. The 10 genera with 10 species under 7 families were recorded from June 2013-July 2014. According to length of legs, the largest spider was the huntsman spider, Halconia insignis Thorell having length of the first leg was 1.9±0.20, however, the same of the last leg was 1.44±0.25 (n=9. In the same contest, the smallest spider was the ground spider, Gnaphosa eucalyptus Ghafoor and Beg having length of the first leg was 0.4±0.08, while the same of the last leg was 0.4±0.08 (n=3. According to length of cephalothorax and abdomen, the largest spider was the wolf spider, Hippasa partita Takidar having length of the cephalothorax was 1.1±0.01, however, the same of the abdomen was 0.7±0.1 (n=6. In the same contest, the smallest spider was the harvestmen, Hadrobunus grandis Sundevall having length of the cephalothorax was 0.1±0.04, while the same of the abdomen was 0.3±0.04 (n=12. During present research, 10 spider species of Sheringal with different sizes were explored. The present research will be useful to educate and create awareness about spiders in the people of Sheringal.

Optical surface profiling of orb-web spider capture silks

Energy Technology Data Exchange (ETDEWEB)

Kane, D M; Joyce, A M; Staib, G R [Department of Physics, Macquarie University, Sydney, NSW 2109 (Australia); Herberstein, M E, E-mail: deb.kane@mq.edu.a [Department of Biological Sciences, Macquarie University, Sydney, NSW 2109 (Australia)

2010-09-15

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Optical surface profiling of orb-web spider capture silks

International Nuclear Information System (INIS)

Kane, D M; Joyce, A M; Staib, G R; Herberstein, M E

2010-01-01

Much spider silk research to date has focused on its mechanical properties. However, the webs of many orb-web spiders have evolved for over 136 million years to evade visual detection by insect prey. It is therefore a photonic device in addition to being a mechanical device. Herein we use optical surface profiling of capture silks from the webs of adult female St Andrews cross spiders (Argiope keyserlingi) to successfully measure the geometry of adhesive silk droplets and to show a bowing in the aqueous layer on the spider capture silk between adhesive droplets. Optical surface profiling shows geometric features of the capture silk that have not been previously measured and contributes to understanding the links between the physical form and biological function. The research also demonstrates non-standard use of an optical surface profiler to measure the maximum width of a transparent micro-sized droplet (microlens).

Spiders do not evoke greater early posterior negativity in the event-related potential as snakes.

Science.gov (United States)

He, Hongshen; Kubo, Kenta; Kawai, Nobuyuki

2014-09-10

It has been long believed that both snakes and spiders are archetypal fear stimuli for humans. Furthermore, snakes have been assumed as stronger threat cues for nonhuman primates. However, it is still unclear whether spiders hold a special status in human perception. The current study explored to what extent spider pictures draw early visual attention [as assessed with early posterior negativity (EPN)] when compared with insects similar to spiders. To measure the EPN, participants watched a random rapid serial presentation of pictures, which consisted of two conditions: spider condition (spider, wasp, bumblebee, beetle) and snake condition (snake, bird). EPN amplitudes revealed no significant difference between spider, wasp, bumblebee, and beetle pictures, whereas EPN amplitudes were significantly larger for snake pictures relative to bird pictures. In addition, EPN amplitudes were significantly larger for snake pictures relative to spider pictures. These results suggest that the early visual attentional capture of animate objects is stronger for snakes, whereas spiders do not appear to hold special early attentional value.

Solubilization of spider silk proteins and its structural analysis using Fourier transform infrared spectroscopy

Science.gov (United States)

Osbin, K.; Jayan, Manuel; Bhadrakumari, S.; Predeep, P.

2017-06-01

This study investigates the presence of various amide bands present in different spider silk species, which provides extraordinary physical properties. Three different spider silks were collected from Western Ghats region. The collected spider silks samples belonging to the spider Heteropoda venatoria (species 1), Hersilia savignyi (species 2) and Pholcus phalangioides (species 3). Fourier transform infrared (FTIR) spectra reveals the protein peaks in the amide I, II, and III regions in all the three types of spider silk species.

How informative are case studies of spider bites in the medical literature?

Science.gov (United States)

Stuber, Marielle; Nentwig, Wolfgang

2016-05-01

We analyzed the reliability and information content of 134 medical case studies on spider bites, published in 91 journal articles. Overall, we found that only 22% of these studies fulfilled the criteria for a verified spider bite. This means that the majority of such case studies cannot be attributed to a given spider species and usually not even to a spider. Their scientific value is negligible, moreover, such publications are even dangerous because they suggest incorrect conclusions. Secondly, we found that such case studies usually do not follow an obvious structure and many details on the development of symptoms, therapy and healing process are widely lacking. So even for verified spider bites, the comparability of case studies is limited. We discuss the obvious failure of a reviewing process for case studies and give recommendations how to increase the currently low information content of medical case studies on spider bites. Copyright © 2016 Elsevier Ltd. All rights reserved.

Rapid visuomotor processing of phobic images in spider- and snake-fearful participants.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp; Schmidt, Thomas

2013-10-01

This study investigates enhanced visuomotor processing of phobic compared to fear-relevant and neutral stimuli. We used a response priming design to measure rapid, automatic motor activation by natural images (spiders, snakes, mushrooms, and flowers) in spider-fearful, snake-fearful, and control participants. We found strong priming effects in all tasks and conditions; however, results showed marked differences between groups. Most importantly, in the group of spider-fearful individuals, spider pictures had a strong and specific influence on even the fastest motor responses: Phobic primes entailed the largest priming effects, and phobic targets accelerated responses, both effects indicating speeded response activation by phobic images. In snake-fearful participants, this processing enhancement for phobic material was less pronounced and extended to both snake and spider images. We conclude that spider phobia leads to enhanced processing capacity for phobic images. We argue that this is enabled by long-term perceptual learning processes. © 2013.

Who is afraid of a black Spider(-Man)?

OpenAIRE

Ora C. McWilliams

2013-01-01

An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

Location and agricultural practices influence spring use of harvested cornfields by cranes and geese in Nebraska

Science.gov (United States)

Anteau, Michael J.; Sherfy, Mark H.; Bishop, Andrew A.

2011-01-01

Millions of ducks, geese, and sandhill cranes (Grus canadensis; hereafter cranes) stop in the Central Platte River Valley (CPRV) of Nebraska to store nutrients for migration and reproduction by consuming corn remaining in fields after harvest. We examined factors that influence use of cornfields by cranes and geese (all mid-continent species combined; e.g., Anser, Chen, and Branta spp.) because it is a key step to efficient conservation planning aimed at ensuring that adequate food resources are available to migratory birds stopping in the CPRV. Distance to night-time roost site, segment of the CPRV (west to east), and agricultural practices (post-harvest treatment of cornfields: idle, grazed, mulched, mulched and grazed, and tilled) were the most important and influential variables in our models for geese and cranes. Probability of cornfield use by geese and cranes decreased with increasing distance from the closest potential roosting site. The use of cornfields by geese increased with the density of corn present there during the early migration period, but field use by cranes appeared not to be influenced by early migration corn density. However, probability of cornfield use by cranes did increase with the amount of wet grassland habitat within 4.8 km of the field. Geese were most likely to use fields that were tilled and least likely to use fields that were mulched and grazed. Cranes were most likely to use fields that were mulched and least likely to use fields that were tilled, but grazing appeared not to influence the likelihood of field use by cranes. Geese were more likely to use cornfields in western segments of the CPRV, but cranes were more likely to use cornfields in eastern segments. Our data suggest that managers could favor crane use of fields and reduce direct competition with geese by reducing fall and spring tilling and increasing mulching. Moreover, crane conservation efforts would be most beneficial if they were focused in the eastern portions

Factors that influence the beta-diversity of spider communities in northwestern Argentinean Grasslands

Directory of Open Access Journals (Sweden)

Sandra M. Rodriguez-Artigas

2016-04-01

Full Text Available Beta-diversity, defined as spatial replacement in species composition, is crucial to the understanding of how local communities assemble. These changes can be driven by environmental or geographic factors (such as geographic distance, or a combination of the two. Spiders have been shown to be good indicators of environmental quality. Accordingly, spiders are used in this work as model taxa to establish whether there is a decrease in community similarity that corresponds to geographic distance in the grasslands of the Campos & Malezales ecoregion (Corrientes. Furthermore, the influence of climactic factors and local vegetation heterogeneity (environmental factors on assemblage composition was evaluated. Finally, this study evaluated whether the differential dispersal capacity of spider families is a factor that influences their community structure at a regional scale. Spiders were collected with a G-Vac from vegetation in six grassland sites in the Campos & Malezales ecoregion that were separated by a minimum of 13 km. With this data, the impact of alpha-diversity and different environmental variables on the beta-diversity of spider communities was analysed. Likewise, the importance of species replacement and nesting on beta-diversity and their contribution to the regional diversity of spider families with different dispersion capacities was evaluated. The regional and site-specific inventories obtained were complete. The similarity between spider communities declined as the geographic distance between sites increased. Environmental variables also influenced community composition; stochastic events and abiotic forces were the principal intervening factors in assembly structure. The differential dispersal capacity of spider groups also influenced community structure at a regional scale. The regional beta-diversity, as well as species replacement, was greater in high and intermediate vagility spiders; while nesting was greater in spiders with low

Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

Science.gov (United States)

Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

2014-01-01

Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

78 FR 36572 - Certain Crawler Cranes and Components Thereof Notice of Receipt of Complaint; Solicitation of...

Science.gov (United States)

2013-06-18

... INTERNATIONAL TRADE COMMISSION [Docket No. 2960] Certain Crawler Cranes and Components Thereof... Trade Commission has received a complaint entitled Certain Crawler Cranes and Components Thereof, DN...) of the Commission's Rules of Practice and Procedure filed on behalf of Manitowoc Cranes, LLC on June...

Structure–Activity Relationship Study of Spider Polyamine Toxins as Inhibitors of Ionotropic Glutamate Receptors

DEFF Research Database (Denmark)

Xiong, Xiaofeng; Poulsen, Mette H; Hussein, Rama A

2014-01-01

The spider polyamine toxins Joro spider toxin-3 (JSTX-3) and Nephila polyamine toxins-1 and -8 (NPTX-1 and NPTX-8) are isolated from the venom of the orb-weaver spider Nephila clavata (Joro spider). They share a high degree of structural resemblance, their aromatic head groups being the only...

Isolation and characterization of major histocompatibility complex class II B genes in cranes.

Science.gov (United States)

Kohyama, Tetsuo I; Akiyama, Takuya; Nishida, Chizuko; Takami, Kazutoshi; Onuma, Manabu; Momose, Kunikazu; Masuda, Ryuichi

2015-11-01

In this study, we isolated and characterized the major histocompatibility complex (MHC) class II B genes in cranes. Genomic sequences spanning exons 1 to 4 were amplified and determined in 13 crane species and three other species closely related to cranes. In all, 55 unique sequences were identified, and at least two polymorphic MHC class II B loci were found in most species. An analysis of sequence polymorphisms showed the signature of positive selection and recombination. A phylogenetic reconstruction based on exon 2 sequences indicated that trans-species polymorphism has persisted for at least 10 million years, whereas phylogenetic analyses of the sequences flanking exon 2 revealed a pattern of concerted evolution. These results suggest that both balancing selection and recombination play important roles in the crane MHC evolution.

Disgruntled employees challenge GPU on TMI-2 polar crane safety, say load test needed

International Nuclear Information System (INIS)

Smock, R.

1983-01-01

Workers at the Three Mile Island No. 2 unit have gone public with their complaint that General Public Utilities (GPU) Corp. is ignoring safety at the cleanup site. With the exception of a specific concern over an overhead crane inside the containment building, however, the charges are vague. The polar crane will be used to lift the 170 to 180-ton reactor vessel head later this year, but a plant engineer faults the planned test procedure because it calls for lifting 40-ton missile shields from above the reactor before the crane is tested for strength. If the crane fails when lifting the missile shields, the engineer contends, there could be another loss of coolant. GPU rejected a 50-ton test of the crane because it is not required and because the risk is virtually zero. The utility also argues that additional testing will only increase exposure for the workers. 1 figure

Record breaking achievements by spiders and the scientists who study them.

Science.gov (United States)

Mammola, Stefano; Michalik, Peter; Hebets, Eileen A; Isaia, Marco

2017-01-01

Organismal biology has been steadily losing fashion in both formal education and scientific research. Simultaneous with this is an observable decrease in the connection between humans, their environment, and the organisms with which they share the planet. Nonetheless, we propose that organismal biology can facilitate scientific observation, discovery, research, and engagement, especially when the organisms of focus are ubiquitous and charismatic animals such as spiders. Despite being often feared, spiders are mysterious and intriguing, offering a useful foundation for the effective teaching and learning of scientific concepts and processes. In order to provide an entryway for teachers and students-as well as scientists themselves-into the biology of spiders, we compiled a list of 99 record breaking achievements by spiders (the "Spider World Records"). We chose a world-record style format, as this is known to be an effective way to intrigue readers of all ages. We highlighted, for example, the largest and smallest spiders, the largest prey eaten, the fastest runners, the highest fliers, the species with the longest sperm, the most venomous species, and many more. We hope that our compilation will inspire science educators to embrace the biology of spiders as a resource that engages students in science learning. By making these achievements accessible to non-arachnologists and arachnologists alike, we suggest that they could be used: (i) by educators to draw in students for science education, (ii) to highlight gaps in current organismal knowledge, and (iii) to suggest novel avenues for future research efforts. Our contribution is not meant to be comprehensive, but aims to raise public awareness on spiders, while also providing an initial database of their record breaking achievements.

Radiation Safety System for SPIDER Neutral Beam Accelerator

International Nuclear Information System (INIS)

Sandri, S.; Poggi, C.; Coniglio, A.; D'Arienzo, M.

2011-01-01

SPIDER (Source for Production of Ion of Deuterium Extracted from RF Plasma only) and MITICA (Megavolt ITER Injector Concept Advanced) are the ITER neutral beam injector (NBI) testing facilities of the PRIMA (Padova Research Injector Megavolt Accelerated) Center. Both injectors accelerate negative deuterium ions with a maximum energy of 1 MeV for MITICA and 100 keV for SPIDER with a maximum beam current of 40 A for both experiments. The SPIDER facility is classified in Italy as a particle accelerator. At present, the design of the radiation safety system for the facility has been completed and the relevant reports have been presented to the Italian regulatory authorities. Before SPIDER can operate, approval must be obtained from the Italian Regulatory Authority Board (IRAB) following a detailed licensing process. In the present work, the main project information and criteria for the SPIDER injector source are reported together with the analysis of hypothetical accidental situations and safety issues considerations. Neutron and photon nuclear analysis is presented, along with special shielding solutions designed to meet Italian regulatory dose limits. The contribution of activated corrosion products (ACP) to external exposure of workers has also been assessed. Nuclear analysis indicates that the photon contribution to worker external exposure is negligible, and the neutron dose can be considered by far the main radiation protection issue. Our results confirm that the injector has no important radiological impact on the population living around the facility.

Colonization of subterranean habitats by spiders in Central Europe

Directory of Open Access Journals (Sweden)

Vlastimil Růžička

2013-05-01

Full Text Available Using data from the Czech Republic, we studied the distribution of spiders in soils, crevice systems, scree and caves, i.e. subterranean habitats at depths spanning from 10 cm to 100 m. In total, we found 161 species. The number of species declines with increasing habitat depth, with a major drop in species richness at the depth of 10 meters. Thirteen species exhibit morphological adaptations to life in subterranean habitats. At depths greater than 10 meters, spider assemblages are almost exclusively composed of troglomorphic species. We propose a hypothesis of evolution of troglomorphisms at spiders during Quaternary climatic cycles.

Distribution and importance of spiders inhabiting a Brazilian sugar cane plantation

Directory of Open Access Journals (Sweden)

Isabela Maria Piovesan Rinaldi

2002-07-01

Full Text Available The spider fauna (Araneae of a sugar eane plantation was surveyed monthly by hand colteetion and beating vegetation in sugar cane fields across Botucatu, State of São Paulo, Brazil. Composition and rchness (family and species where identifieation to species was possible microhabitat preferenees were reeorded, and diversity and evenness indices were calculated. A total of 1291 spiders belonging to 73 species and 20 families were collected. The most diverse families were Theridiidae, Salticidae, and Araneidae, and the most abundant ones were Theridiidae, Saltieidae, Anyphaenidae, and Araneidae, Seven species represented 58.6% of the total fauna, with Crysso pulcherrima (Mello-Leitão,1917 (Theridiidae composing 28.2%. About 65% of the spiders occupied the upper part of the plants (above 20 cm. Five spider species were present in the sugar cane throughout crop development. Evidence of spiders feeding on sugar cane pest species was observed.

Sandhill cranes hunting food at KSC

Science.gov (United States)

2000-01-01

A pair of Sandhill Cranes searches for food with their still- fluffy fledgling close by. The trio have been seen wandering the grassy areas in the KSC Launch Complex 39 area. Sandhill cranes range from Siberia, Alaska and Arctic islands to Michigan, Minnesota and California; from Florida to Texas. They prefer large freshwater marshes, prairie ponds and marshy tundra. KSC shares a boundary with the Merritt Island National Wildlife Refuge, which encompasses 92,000 acres that are a habitat for more than 331 species of birds, 31 mammals, 117 fishes, and 65 amphibians and reptiles. The marshes and open water of the refuge provide wintering areas for 23 species of migratory waterfowl, as well as a year-round home for great blue herons, great egrets, wood storks, cormorants, brown pelicans and other species of marsh and shore birds, as well as a variety of insects.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

Energy Technology Data Exchange (ETDEWEB)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A [Department of Tissue Regeneration, University of Twente, PO Box 217, 7500 AE Enschede (Netherlands); Hedhammar, My; Johansson, Jan [Department of Anatomy, Physiology and Biochemistry, Swedish University of Agricultural Sciences, the Biomedical Centre, Box 575, 751 23 Uppsala (Sweden); Blom, Tobias; Leifer, Klaus [Department of Engineering Sciences, Uppsala University, Box 534, S-751 21 Uppsala (Sweden)

2010-08-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Spider Silk as Guiding Biomaterial for Human Model Neurons

Directory of Open Access Journals (Sweden)

Frank Roloff

2014-01-01

Full Text Available Over the last years, a number of therapeutic strategies have emerged to promote axonal regeneration. An attractive strategy is the implantation of biodegradable and nonimmunogenic artificial scaffolds into injured peripheral nerves. In previous studies, transplantation of decellularized veins filled with spider silk for bridging critical size nerve defects resulted in axonal regeneration and remyelination by invading endogenous Schwann cells. Detailed interaction of elongating neurons and the spider silk as guidance material is unknown. To visualize direct cellular interactions between spider silk and neurons in vitro, we developed an in vitro crossed silk fiber array. Here, we describe in detail for the first time that human (NT2 model neurons attach to silk scaffolds. Extending neurites can bridge gaps between single silk fibers and elongate afterwards on the neighboring fiber. Culturing human neurons on the silk arrays led to an increasing migration and adhesion of neuronal cell bodies to the spider silk fibers. Within three to four weeks, clustered somata and extending neurites formed ganglion-like cell structures. Microscopic imaging of human neurons on the crossed fiber arrays in vitro will allow for a more efficient development of methods to maximize cell adhesion and neurite growth on spider silk prior to transplantation studies.

Biomimetic calcium phosphate coatings on recombinant spider silk fibres

International Nuclear Information System (INIS)

Yang Liang; Habibovic, Pamela; Van Blitterswijk, Clemens A; Hedhammar, My; Johansson, Jan; Blom, Tobias; Leifer, Klaus

2010-01-01

Calcium phosphate ceramic coatings, applied on surfaces of metallic and polymeric biomaterials, can improve their performance in bone repair and regeneration. Spider silk is biocompatible, strong and elastic, and hence an attractive biomaterial for applications in connective tissue repair. Recently, artificial spider silk, with mechanical and structural characteristics similar to those of native spider silk, has been produced from recombinant minispidroins. In the present study, supersaturated simulated body fluid was used to deposit calcium phosphate coatings on recombinant spider silk fibres. The mineralization process was followed in time using scanning electron microscopy equipped with an energy dispersive x-ray (EDX) detector and Raman spectroscope. Focused ion beam technology was used to produce a cross section of a coated fibre, which was further analysed by EDX. Preliminary in vitro experiments using a culture of bone marrow-derived human mesenchymal stem cells (hMSCs) on coated fibres were also performed. This study showed that recombinant spider silk fibres were successfully coated with a homogeneous and thick crystalline calcium phosphate layer. In the course of the mineralization process from modified simulated body fluid, sodium chloride crystals were first deposited on the silk surface, followed by the deposition of a calcium phosphate layer. The coated silk fibres supported the attachment and growth of hMSCs.

Improved Visual Hook Capturing and Tracking for Precision Hoisting of Tower Crane

Directory of Open Access Journals (Sweden)

Yanming Li

2013-01-01

Full Text Available To maintain safe operation of the tower crane, it is important to monitor the activities of the hook system. Visual monitoring and image recognition are the optimum methods for crane hook tracking and precision hoisting. High real-time performance and low computation requirements are required for tower crane hook capturing and tracking system which is implemented on the embedded Advanced RISC Machines (ARM processor or Microcontrol Unit (MCU. Using the lift rope of a tower crane as the target object, a new high-performance hook tracking method suitble for ARM processor or MCU applications is presented. The features of the lifting process are analyzed, and an improved progressive probabilistic Hough transform (IPPHT algorithm is proposed which canreduce capturing time by up to 80%. Combining color histogram with a binary search algorithm, an adaptive zooming method for precise hoisting is presented. Using this method the optimum zoom scale can be achieved within a few iterations.

Coccidian Parasites and Conservation Implications for the Endangered Whooping Crane (Grus americana.

Directory of Open Access Journals (Sweden)

Miranda R Bertram

Full Text Available While the population of endangered whooping cranes (Grus americana has grown from 15 individuals in 1941 to an estimated 304 birds today, the population growth is not sufficient to support a down-listing of the species to threatened status. The degree to which disease may be limiting the population growth of whooping cranes is unknown. One disease of potential concern is caused by two crane-associated Eimeria species: Eimeria gruis and E. reichenowi. Unlike most species of Eimeria, which are localized to the intestinal tract, these crane-associated species may multiply systemically and cause a potentially fatal disease. Using a non-invasive sampling approach, we assessed the prevalence and phenology of Eimeria oocysts in whooping crane fecal samples collected across two winter seasons (November 2012-April 2014 at the Aransas National Wildlife Refuge along the Texas Gulf coast. We also compared the ability of microscopy and PCR to detect Eimeria in fecal samples. Across both years, 26.5% (n = 328 of fecal samples were positive for Eimeria based on microscopy. Although the sensitivity of PCR for detecting Eimeria infections seemed to be less than that of microscopy in the first year of the study (8.9% vs. 29.3%, respectively, an improved DNA extraction protocol resulted in increased sensitivity of PCR relative to microscopy in the second year of the study (27.6% and 20.8%, respectively. The proportion of positive samples did not vary significantly between years or among sampling sites. The proportion of Eimeria positive fecal samples varied with date of collection, but there was no consistent pattern of parasite shedding between the two years. We demonstrate that non-invasive fecal collections combined with PCR and DNA sequencing techniques provides a useful tool for monitoring Eimeria infection in cranes. Understanding the epidemiology of coccidiosis is important for management efforts to increase population growth of the endangered whooping

Neural correlation of successful cognitive behaviour therapy for spider phobia: a magnetoencephalography study.

Science.gov (United States)

Wright, Barry; Alderson-Day, Ben; Prendergast, Garreth; Kennedy, Juliette; Bennett, Sophie; Docherty, Mary; Whitton, Clare; Manea, Laura; Gouws, Andre; Tomlinson, Heather; Green, Gary

2013-12-30

Cognitive behavioural therapy (CBT) can be an effective treatment for spider phobia, but the underlying neural correlates of therapeutic change are yet to be specified. The present study used magnetoencephalography (MEG) to study responses within the first half second, to phobogenic stimuli in a group of individuals with spider phobia prior to treatment (n=12) and then in nine of them following successful CBT (where they could touch and manage live large common house spiders) at least 9 months later. We also compared responses to a group of age-matched healthy control participants (n=11). Participants viewed static photographs of real spiders, other fear-inducing images (e.g. snakes, sharks) and neutral stimuli (e.g. kittens). Beamforming methods were used to localise sources of significant power changes in response to stimuli. Prior to treatment, participants with spider phobia showed a significant maximum response in the right frontal pole when viewing images of real spiders specifically. No significant frontal response was observed for either control participants or participants with spider phobia post-treatment. In addition, participants' subjective ratings of spider stimuli significantly predicted peak responses in right frontal regions. The implications for understanding brain-based effects of cognitive therapies are discussed. © 2013 Published by Elsevier Ireland Ltd.

SPIDER: Probing the dawn of time from above the clouds

Science.gov (United States)

Moncelsi, Lorenzo; Spider Collaboration

2017-11-01

SPIDER is a balloon-borne microwave polarimeter designed to measure cosmological B-modes on degree angular scales in the presence of Galactic foregrounds. With six independent telescopes housing a total of 2000 detectors in the 90 GHz and 150 GHz frequency bands, SPIDER is the most instantaneously-sensitive CMB polarimeter deployed on the sky to date. SPIDER was successfully launched from McMurdo Station, Antarctica in January 2015 and acquired science data for 16 days. We cover the in-flight performance and present highlights from the ongoing data-analysis. After a successful recovery, the SPIDER team is planning the next flight, featuring one foreground-optimized channel at 280GHz, which will allow us constrain the primordial tensor-mode amplitude at the level of r < 0.03 (99% CL), in the presence of foregrounds.

Interpretative bias in spider phobia: Perception and information processing of ambiguous schematic stimuli.

Science.gov (United States)

Haberkamp, Anke; Schmidt, Filipp

2015-09-01

This study investigates the interpretative bias in spider phobia with respect to rapid visuomotor processing. We compared perception, evaluation, and visuomotor processing of ambiguous schematic stimuli between spider-fearful and control participants. Stimuli were produced by gradually morphing schematic flowers into spiders. Participants rated these stimuli related to their perceptual appearance and to their feelings of valence, disgust, and arousal. Also, they responded to the same stimuli within a response priming paradigm that measures rapid motor activation. Spider-fearful individuals showed an interpretative bias (i.e., ambiguous stimuli were perceived as more similar to spiders) and rated spider-like stimuli as more unpleasant, disgusting, and arousing. However, we observed no differences between spider-fearful and control participants in priming effects for ambiguous stimuli. For non-ambiguous stimuli, we observed a similar enhancement for phobic pictures as has been reported previously for natural images. We discuss our findings with respect to the visual representation of morphed stimuli and to perceptual learning processes. Copyright © 2015 Elsevier B.V. All rights reserved.

76 FR 16764 - Crane & Company; Notice of Application Tendered for Filing With the Commission and Soliciting...

Science.gov (United States)

2011-03-25

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13583-001] Crane & Company... c. Date filed: March 9, 2011 d. Applicant: Crane & Company e. Name of Project: Byron Weston... connected to the Crane & Company mill complex. The proposed project is estimated to generate an average of...

Who is afraid of a black Spider(-Man?

Directory of Open Access Journals (Sweden)

Ora C. McWilliams

2013-06-01

Full Text Available An Internet post asking about Spider-Man's race in a film turned into an Internet campaign about an actor that led fans to interact with each other as well as with the actor, which in turn led to the attention of media producers, which resulted in a change in Spider-Man's race in a print comic book.

SURVEY OF GROSS AND HISTOPATHOLOGIC FINDINGS IN TWO WINTERING SUBPOPULATIONS OF SANDHILL CRANES ( ANTIGONE CANADENSIS).

Science.gov (United States)

Hensel, Martha; Bertram, Miranda; Rech, Raquel; Hamer, Gabriel L; Hamer, Sarah A

2018-01-01

:  Sandhill Cranes ( Antigone canadensis) of the midcontinent population (MCP) and Rocky Mountain population (RMP) are migratory game birds with stable populations that travel between Canada and the southern US and Mexico. In the winters of 2012-14, we performed gross and histologic examinations of 43 hunter-harvested Sandhill Cranes in Texas (MCP) and New Mexico (RMP) to assess the impact of disease on populations. Lesions were significantly more common in the MCP relative to the RMP, likely reflecting differential environmental exposure to pathogens and parasites. Grossly, liver nodules and esophageal granulomas were present in 8-39% of birds. In feces from over half of birds, we found coccidian oocysts with mitochondrial gene sequences identical to those of Eimeria gruis and Eimeria reichenowi previously obtained from sympatric Whooping Cranes ( Grus americana). Over one-quarter of birds had liver and cardiac lesions suggestive of disseminated visceral coccidiosis. We documented proliferative colitis due to Cryptosporidium in a wild Sandhill Crane. Additionally, several endoparasites were found in histologic sections from several cranes, including a bird with respiratory trematodiasis and two birds with Tetrameres sp. in the proventriculus associated with ductal ectasia. In addition to describing lesions and parasites that impact Sandhill Crane health, these pathology data may also be relevant for the conservation of endangered Whooping Cranes using a surrogate species approach.

Dynamic Optimization Design of Cranes Based on Human–Crane–Rail System Dynamics and Annoyance Rate

Directory of Open Access Journals (Sweden)

Yunsheng Xin

2017-01-01

Full Text Available The operators of overhead traveling cranes experience discomfort as a result of the vibrations of crane structures. These vibrations are produced by defects in the rails on which the cranes move. To improve the comfort of operators, a nine-degree-of-freedom (nine-DOF mathematical model of a “human–crane–rail” system was constructed. Based on the theoretical guidance provided in ISO 2631-1, an annoyance rate model was established, and quantization results were determined. A dynamic optimization design method for overhead traveling cranes is proposed. A particle swarm optimization (PSO algorithm was used to optimize the crane structural design, with the structure parameters as the basic variables, the annoyance rate model as the objective function, and the acceleration amplitude and displacement amplitude of the crane as the constraint conditions. The proposed model and method were used to optimize the design of a double-girder 100 t–28.5 m casting crane, and the optimal parameters are obtained. The results show that optimization decreases the human annoyance rate from 28.3% to 9.8% and the root mean square of the weighted acceleration of human vibration from 0.59 m/s2 to 0.38 m/s2. These results demonstrate the effectiveness and practical applicability of the models and method proposed in this paper.

Distribution, densities, and ecology of Siberian cranes in the Khroma River region of northern Yakutia in northeastern Russia

Science.gov (United States)

Bysykatova, Inga P.; Krapu, Gary L.; Germogenov, Nicolai I.; Buhl, Deborah A.; Aborn, David

2014-01-01

The Siberian crane (Grus leucogeranus) is the third rarest crane species in the world with a breeding range now centered on 3 core areas and a buffer zone in the arctic of northern Yakutia in northeastern Russia. During 16 July-2 August 2009, we undertook ground surveys within the Khroma River core breeding area, surrounding buffer zone, and lands lying to the west of the known rbeeding range to estimate densities and determine habitat use and social status of Siberian cranes. A total of 142 Siberian cranes were sighted (including 55 pairs) at 54 locations with 32 cranes (including 13 pairs) sighted outside the currently known breeding range in the lower drainages of the Syalakh and Syuryuktyakh Rivers. After adjusting for a probability of detection of 0.484 (95% CI = 0.281-0.833), Siberian crane densities in the Khroma core area and the buffer zone averaged 0.0921 cranes/km2 and 0.0363 cranes/km2, respectively. A majority of cranes (n = 93 [65%]) occurred in complexes of large basin wetlands, with use centered in those having extensive beds of pendant grass (Arctophila fulva). Of the 142 cranes seen, 110 (77%) were paired, 21 (15%) were singles, and 11 (8%) were in groups of 3-5. The Khroma core supports 1 of 2 large concentrations of breeding Siberian cranes remaining in the wild; therefore, we recommend that consideration be given to designating a nature reserve that would encompass the Khroma core, adjacent buffer zone, and lands to the west (including coastal tundra areas along the lower drainages of the Syalah and Syuryuktyah Rivers). Further research is needed to gain additional insight into Siberian crane distribution and numbers on lands beyond the currently delineated western boundary of the Siberian crane breeding range in the Ust-Yana District of northern Yakutia. Important gaps remain in information needed to effectively guide conservation efforts for the Eastern Population, and recent advances in remote tracking technology offer potential

Characteristics of the first recorded spider (Arthropoda: Arachnida fauna from Sheringal, Khyber Pakhtunkhwa, Pakistan

Directory of Open Access Journals (Sweden)

Farzana Khan Perveen

2015-12-01

Full Text Available The spiders (order: Aranae are an important environmental indicator and play a significant role as predators in biological control of the most of the key insect pests. The present study was conducted to establish the characteristics of the first recorded spider fauna from Sheringal, Dir Upper (DU, Khyber Pakhtunkhwa (KP, Pakistan during June 2013-July 2014. Their 10 species belong to 7 families, and 10 genera (nt=123: total; ni=77: identified; nui=46: unidentified were recorded in the 6 quadrates, i.e., Daramdala, Doki, Guryaal, Samang, Shahoor and Sia-Sheringal of Sheringal. The largest family was Lycosidae (wolf spiders with respect to size and numbers of specimens collected (n=20, which contained Arctosa littorali Simon, 1897; Hippasa partita Takidar, 1970; Pardosa distincta Backwall, 1867, while the smallest family was Gnphosidae (ground spiders (n=3 with Gnaphosa eucalyptus Ghafoor and Beg, 2002; while other families Sparassidae (huntsman spiders (n=19 Halconia insignis Thorell, 1836, and Isopeda tuhogniga Barrion and Litsinger, 1995, Opilionidae (harvestmen spiders (n=12 Hadrobunus grandis Sundevall, 1833; Pholcidae (cellar spider (n=10 have Crossopriza lyoni Blackwall, 1867; Hersiliidae (two-tailed spiders (n=6 is having Harsilia savignyi Lucas, 1836; (n=5 with Araneus diadematus Clerck, 1757 were recorded. It was concluded that 50% of the spiders collected from the study area were venomous. A detail study is required for further exploration of spider fauna of Sheringal, KP, Pakistan with special reference to their taxonomical, physiological and ecological characteristics.

Status of the CNESM diagnostic for SPIDER

International Nuclear Information System (INIS)

Muraro, A.; Croci, G.; Albani, G.; Cazzaniga, C.; Claps, G.; Cavenago, M.; Grosso, G.; Palma, M. Dalla; Fincato, M.; Murtas, F.; Pasqualotto, R.; Cippo, E. Perelli; Rebai, M.; Tollin, M.; Tardocchi, M.; Gorini, G.

2015-01-01

Highlights: • We have finished the design of the detector box of the CNESM diagnostic for SPIDER. • We have constructed the GEM detector of the CNESM detector for SPIDER. • We have tested the detector under fast neutron irradiation. - Abstract: The ITER neutral beam test facility under construction in Padova will host two experimental devices: SPIDER, a 100 kV negative H/D RF source, and MITICA, a full scale, 1 MeV deuterium beam injector. A detection system called close-contact neutron emission surface mapping (CNESM) is under development with the aim to resolve the horizontal beam intensity profile in MITICA and one of the eight beamlet groups in SPIDER, with a spatial resolution of 1.5 and 2.5 cm respectively. This is achieved by the evaluation of the map of the neutron emission due to interaction of the deuterium beam with the deuterons implanted in the beam dump surface. CNESM uses nGEM detectors, i.e. GEM detectors equipped with a cathode that also serves as neutron–proton converter foil. The diagnostic will be placed right behind the SPIDER and MITICA beam dump, i.e. in an UHV environment, but the nGEM detectors need to operate at atmospheric pressure: in order to maintain the detector at atmospheric pressure, a vacuum sealed box, that will be mounted inside the vacuum, has been designed. The box design was driven by the need to minimize the neutron attenuation and the distance between the beam dump surface and the detector active area. This paper presents the status of the CNESM diagnostic describing the design of the detector, the design of the sealed box and reporting the results obtained with the first full-size prototype under fast neutron irradiation.

Applying remote handling attributes to the ITER neutral beam cell monorail crane

Energy Technology Data Exchange (ETDEWEB)

Crofts, O., E-mail: Oliver.Crofts@CCFE.ac.uk [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Allan, P.; Raimbach, J. [CCFE, Culham Science Centre, Abingdon OX14 3DB (United Kingdom); Tesini, A.; Choi, C.-H. [ITER Organisation, CS90 046, 13067 St. Paul les Durance Cedex (France); Damiani, C.; Van Uffelen, M. [Fusion for Energy, C/Josep Pla 2, Torres Diagonal Litoral-B3, E-08019 Barcelona (Spain)

2013-10-15

The maintenance requirements for the equipment in the ITER neutral beam cell require components to be lifted and transported within the cell by remote means. To meet this requirement, the provision of an overhead crane with remote handling capabilities has been initiated. The layout of the cell has driven the design to consist of a monorail crane that travels on a branched monorail track attached to the cell ceiling. This paper describes the principle design constraints and how the remote handling attributes were applied to the concept design of the monorail crane, concentrating on areas where novel design solutions have been required and on the remote recovery requirements and solutions.

Applying remote handling attributes to the ITER neutral beam cell monorail crane

International Nuclear Information System (INIS)

Crofts, O.; Allan, P.; Raimbach, J.; Tesini, A.; Choi, C.-H.; Damiani, C.; Van Uffelen, M.

2013-01-01

The maintenance requirements for the equipment in the ITER neutral beam cell require components to be lifted and transported within the cell by remote means. To meet this requirement, the provision of an overhead crane with remote handling capabilities has been initiated. The layout of the cell has driven the design to consist of a monorail crane that travels on a branched monorail track attached to the cell ceiling. This paper describes the principle design constraints and how the remote handling attributes were applied to the concept design of the monorail crane, concentrating on areas where novel design solutions have been required and on the remote recovery requirements and solutions

Design of the interlock and protection system for the SPIDER experiment

International Nuclear Information System (INIS)

Pomaro, N.; Grando, L.; Luchetta, A.; Paolucci, F.; Sartori, F.

2013-01-01

Highlights: •A custom designed interlock and protection system for SPIDER experiment is described. •It includes two subsystems implementing slow and fast protection functions. •High reliability PLCs are adopted for slow protection. •Fiber-optic based, custom designed fast logic circuitry is proposed for fast protection. •Accelerators breakdown events are also managed by the fast subsystem. -- Abstract: Unprecedented levels of beam energy and power are required for ITER Neutral Beam Heating systems. SPIDER experiment is an experimental device aimed to test and optimize a full size beam source satisfying ITER requirements. SPIDER experiment operation involves high power, voltage, temperature, and gas pressure. All these critical conditions are present simultaneously, so that any failure if not properly detected and managed is likely to cause severe damage. The Interlock and Protection System is a high-reliability system devoted to the investment protection of SPIDER. Its main purpose is to manage abnormal events occurring in one or more plants in order to minimize adverse consequences. The Interlock System also manages the SPIDER Operating Modes, defining the set and status of the Plants used in the various possible experimental configurations. In addition, the Interlock and Protection System takes care of particular events occurring during normal SPIDER operation, i.e. electrical arcs between accelerator grids, named breakdowns. Their treatment is committed to the Interlock and Protection System, as they need to be managed timely and with absolute reliability like actual faults. To perform the required functions, the Interlock and Protection System is interfaced with most SPIDER plants and with the SPIDER Control and Data Acquisition System. The paper describes the rationale of the protection functions, their implementation in the design and the technical specifications of the system

Deer herbivory reduces web-building spider abundance by simplifying forest vegetation structure

Directory of Open Access Journals (Sweden)

Elizabeth J. Roberson

2016-09-01

Full Text Available Indirect ecological effects are a common feature of ecological systems, arising when one species affects interactions among two or more other species. We examined how browsing by white-tailed deer (Odocoileus virginianus indirectly affected the abundance and composition of a web-building spider guild through their effects on the structure of the ground and shrub layers of northern hardwood forests. We examined paired plots consisting of deer-free and control plots in the Allegheny Plateau region Pennsylvania and Northern Highlands region of Wisconsin. We recorded the abundance of seven types of webs, each corresponding to a family of web-building spiders. We quantified vegetation structure and habitat suitability for the spiders by computing a web scaffold availability index (WSAI at 0.5 m and 1.0 m above the ground. At Northern Highlands sites, we recorded prey availability. Spider webs were twice as abundant in deer-free plots compared to control plots, while WSAI was 7–12 times greater in deerfree plots. Prey availability was lower in deer-free plots. With the exception of funnel web-builders, all spider web types were significantly more abundant in deer-free plots. Both deer exclusion and the geographic region of plots were significant predictors of spider community structure. In closed canopy forests with high browsing pressure, the low density of tree saplings and shrubs provides few locations for web-building spiders to anchor webs. Recruitment of these spiders may become coupled with forest disturbance events that increase tree and shrub recruitment. By modifying habitat structure, deer appear to indirectly modify arthropod food web interactions. As deer populations have increased in eastern North America over the past several decades, the effects of deer on web-building spiders may be widespread.

Effects of attention manipulations on motivated attention to feared and nonfeared negative distracters in spider fear.

Science.gov (United States)

Norberg, Joakim; Wiens, Stefan

2013-11-09

When people view emotional and neutral pictures, the emotional pictures capture more attention than do neutral pictures. In support, studies with event-related potentials have shown that the early posterior negativity (EPN) and the late positive potential (LPP) to emotional versus neutral pictures are enhanced when pictures are attended. However, this motivated attention decreases when voluntary attention is directed away from the pictures. Most previous studies included only generally emotional pictures of either negative or positive valence. Because people with spider fear report intense fear of spiders, we examined whether directing attention away from emotional pictures at fixation decreases motivated attention less strongly for spiders than for generally negative distracters. We recorded event-related potentials from 128 channels to study whether manipulations of attention (i.e., spatial attention and perceptual load) decrease the EPN and the LPP to emotional distracters less strongly for spiders than for fear-irrelevant negative pictures in people with spider fear. Results confirmed that the EPN and the LPP to spiders (vs. neutral pictures) were particularly enhanced in participants with spider fear compared to participants without spider fear. When attention was directed away from the pictures, the EPN and the LPP to spiders (vs. neutral pictures) decreased similarly in fearful and nonfearful participants. Further, in fearful participants, the decrease in the EPN and the LPP was similar for spiders and for fear-irrelevant negative pictures. Our findings suggest that for people with spider fear, directing attention away from emotional pictures at fixation decreases motivated attention to these distracters similarly for spiders as for fear-irrelevant negative pictures. These findings imply that attention to spiders in spider fear does not exceed the level of attention expected from the spider pictures' high arousal and negative valence (i.e., their intrinsic

Dangerous mating systems: signal complexity, signal content and neural capacity in spiders.

Science.gov (United States)

Herberstein, M E; Wignall, A E; Hebets, E A; Schneider, J M

2014-10-01

Spiders are highly efficient predators in possession of exquisite sensory capacities for ambushing prey, combined with machinery for launching rapid and determined attacks. As a consequence, any sexually motivated approach carries a risk of ending up as prey rather than as a mate. Sexual selection has shaped courtship to effectively communicate the presence, identity, motivation and/or quality of potential mates, which help ameliorate these risks. Spiders communicate this information via several sensory channels, including mechanical (e.g. vibrational), visual and/or chemical, with examples of multimodal signalling beginning to emerge in the literature. The diverse environments that spiders inhabit have further shaped courtship content and form. While our understanding of spider neurobiology remains in its infancy, recent studies are highlighting the unique and considerable capacities of spiders to process and respond to complex sexual signals. As a result, the dangerous mating systems of spiders are providing important insights into how ecology shapes the evolution of communication systems, with future work offering the potential to link this complex communication with its neural processes. Copyright © 2014 Elsevier Ltd. All rights reserved.

Inactivation of complement by Loxosceles reclusa spider venom.

Science.gov (United States)

Gebel, H M; Finke, J H; Elgert, K D; Cambell, B J; Barrett, J T

1979-07-01

Zymosan depletion of serum complement in guinea pigs rendered them highly resistant to lesion by Loxosceles reclusa spider venom. Guinea pigs deficient in C4 of the complement system are as sensitive to the venom as normal guinea pigs. The injection of 35 micrograms of whole recluse venom intradermally into guinea pigs lowered their complement level by 35.7%. Brown recluse spider venom in concentrations as slight as 0.02 micrograms protein/ml can totally inactivate one CH50 of guinea pig complement in vitro. Bee, scorpion, and other spider venoms had no influence on the hemolytic titer of complement. Fractionation of recluse spider venom by Sephadex G-200 filtration separated the complement-inactivating property of the venom into three major regions which could be distinguished on the basis of heat stability as well as size. None was neutralized by antivenom. Polyacrylamide gel electrophoresis of venom resolved the complement inactivators into five fractions. Complement inactivated by whole venom or the Sephadex fractions could be restored to hemolytic activity by supplements of fresh serum but not by heat-inactivated serum, pure C3, pure C5, or C3 and C5 in combination.

SPIDER OPTIMIZATION. II. OPTICAL, MAGNETIC, AND FOREGROUND EFFECTS

International Nuclear Information System (INIS)

O'Dea, D. T.; Clark, C. N.; Contaldi, C. R.; Ade, P. A. R.; Amiri, M.; Burger, B.; Davis, G.; Benton, S. J.; Bock, J. J.; Crill, B. P.; Dore, O.; Filippini, J. P.; Bond, J. R.; Farhang, M.; Bonetti, J. A.; Bryan, S.; Chiang, H. C.; Fraisse, A. A.; Fissel, L. M.; Gandilo, N. N.

2011-01-01

SPIDER is a balloon-borne instrument designed to map the polarization of the cosmic microwave background (CMB) with degree-scale resolution over a large fraction of the sky. SPIDER's main goal is to measure the amplitude of primordial gravitational waves through their imprint on the polarization of the CMB if the tensor-to-scalar ratio, r, is greater than 0.03. To achieve this goal, instrumental systematic errors must be controlled with unprecedented accuracy. Here, we build on previous work to use simulations of SPIDER observations to examine the impact of several systematic effects that have been characterized through testing and modeling of various instrument components. In particular, we investigate the impact of the non-ideal spectral response of the half-wave plates, coupling between focal-plane components and Earth's magnetic field, and beam mismatches and asymmetries. We also present a model of diffuse polarized foreground emission based on a three-dimensional model of the Galactic magnetic field and dust, and study the interaction of this foreground emission with our observation strategy and instrumental effects. We find that the expected level of foreground and systematic contamination is sufficiently low for SPIDER to achieve its science goals.

Operation and maintenance techniques of cranes and Hoist in IMEF

Energy Technology Data Exchange (ETDEWEB)

Soong, Woong Sup; Oh, Yon Woo; Ahn, Sang Bock; Park, Dae Gue; Whang, Ryoung Wha

1999-07-01

Crane and hoist of 11 sets are installed int the Irradiated Material Examination Facility (IMEF). IMEF is divided into two parts such as hot cell area and service area. 30/5-ton overhead crane is installed in service area for transfer of irradiated material transportation cask and other several kinds of heavy equipment. This report describes maintenance techniques, repair procedure, daily and special checking list, which will ensure safety in routine operation and even in abnormality. (author). 8 refs.

Operation and maintenance techniques of cranes and Hoist in IMEF

International Nuclear Information System (INIS)

Soong, Woong Sup; Oh, Yon Woo; Ahn, Sang Bock; Park, Dae Gue; Whang, Ryoung Wha

1999-07-01

Crane and hoist of 11 sets are installed int the Irradiated Material Examination Facility (IMEF). IMEF is divided into two parts such as hot cell area and service area. 30/5-ton overhead crane is installed in service area for transfer of irradiated material transportation cask and other several kinds of heavy equipment. This report describes maintenance techniques, repair procedure, daily and special checking list, which will ensure safety in routine operation and even in abnormality. (author). 8 refs

Analysis of the D0 Crane Rail as a Support for a Horizontal Lifeline

International Nuclear Information System (INIS)

Cease, H.

2000-01-01

The D-Zero crane rail is analyzed for use as an anchor support for a one person Horizon(trademark) Horizontal Lifeline system that will span the pit area at D-Zero assembly hall. The lifeline will span 75 ft across the pit area, will be located out of the travel of the crane and above the concrete lentil wall. The crane rail is a suitable anchor for a one person Horizon TM Horizontal Lifeline system. The expected stress on the rail is 1,995 psi which has a factor of safety of 5.5 on the allowable stress. The anchor position is located 18 feet away from the concrete lentil wall and out of the travel of the overhead crane.

The Spider Files

Science.gov (United States)

McDonald, James; Dominguez, Lynn

2012-01-01

As children develop misconceptions about animals they believe are dangerous, they also adopt attitudes that are difficult to change. Changing these attitudes is challenging for teachers. One animal that is easy to find but difficult for children to understand is a spider. As with most wild animals, they are difficult to teach about because…

New summer areas and mixing of two greater sandhill crane populations in the Intermountain West

Science.gov (United States)

Collins, Daniel P.; Grisham, Blake A.; Conring, Courtenay M.; Knetter, Jeffrey M.; Conway, Warren C.; Carleton, Scott A.; Boggie, Matthew A.

2016-01-01

Population delineation throughout the annual life cycle for migratory birds is needed to formulate regional and national management and conservation strategies. Despite being well studied continentally, connectivity of sandhill crane Grus canadensis populations throughout the western portion of their North American range remains poorly described. Our objectives were to 1) use global positioning system satellite transmitter terminals to identify summer distributions for the Lower Colorado River Valley Population of greater sandhill cranes Grus canadensis tabida and 2) determine whether intermingling occurs among any of the western greater sandhill crane populations: Rocky Mountain Population, Lower Colorado River Valley Population, and Central Valley Population. Capture and marking occurred during winter and summer on private lands in California and Idaho as well as on two National Wildlife Refuges: Cibola and Sonny Bono Salton Sea National Wildlife Refuges. A majority of marked greater sandhill cranes summered in what is established Lower Colorado River Valley Population breeding areas in northeastern Nevada and southwestern Idaho. A handful of greater sandhill cranes summered outside of traditional breeding areas in west-central Idaho around Cascade Reservoir near Donnelly and Cascade, Idaho. For example, a greater sandhill crane colt captured near Donnelly in July 2014 survived to winter migration and moved south to areas associated with the Rocky Mountain Population. The integration of the greater sandhill crane colt captured near Donnelly provides the first evidence of potential intermingling between the Lower Colorado River Population and Rocky Mountain Population. We suggest continued marking and banding efforts of all three western populations of greater sandhill cranes will accurately delineate population boundaries and connectivity and inform management decisions for the three populations.

30 CFR 250.108 - What requirements must I follow for cranes and other material-handling equipment?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What requirements must I follow for cranes and... Performance Standards § 250.108 What requirements must I follow for cranes and other material-handling equipment? (a) All cranes installed on fixed platforms must be operated in accordance with American...

Structure-function-property-design interplay in biopolymers: spider silk.

Science.gov (United States)

Tokareva, Olena; Jacobsen, Matthew; Buehler, Markus; Wong, Joyce; Kaplan, David L

2014-04-01

Spider silks have been a focus of research for almost two decades due to their outstanding mechanical and biophysical properties. Recent advances in genetic engineering have led to the synthesis of recombinant spider silks, thus helping to unravel a fundamental understanding of structure-function-property relationships. The relationships between molecular composition, secondary structures and mechanical properties found in different types of spider silks are described, along with a discussion of artificial spinning of these proteins and their bioapplications, including the role of silks in biomineralization and fabrication of biomaterials with controlled properties. Copyright © 2013 Acta Materialia Inc. Published by Elsevier Ltd. All rights reserved.

Inhibition of the spider heartbeat by gravity and vibration

Science.gov (United States)

Finck, A.

1984-01-01

The rate and vigor of the spider heartbeat is controlled by an external pacemaker. A mechanical feature of the spider cardio-vascular system is the production of high serum pressure in the prosoma and the legs. This appears to be the source for leg extension. The lyriform organ on the patella of the leg is sensitive to vibratory and kinesthetic stimuli. This sensitivity depends upon the degree of leg extension. Thus the activity of the heart and the response characteristics of the sense receptor are related. The effect of a supra-threshold vibratory or gravitational stimulus is to produce an inhibition and a tachycardia of the spider heartbeat.

Ineffective crypsis in a crab spider: a prey community perspective.

Science.gov (United States)

Brechbühl, Rolf; Casas, Jérôme; Bacher, Sven

2010-03-07

Cryptic coloration is assumed to be beneficial to predators because of an increased encounter rate with unwary prey. This hypothesis is, however, very rarely, if ever, studied in the field. The aim of this study was to quantify the encounter rate and capture success of an ambush predator, in the field, as a function of its level of colour-matching with the background. We used the crab spider Misumena vatia, which varies its body colour and can thereby match the colour of the flower it hunts upon. We carried out a manipulative field experiment using a complete factorial design resulting in six different colour combinations of crab spiders and flowers differing in their degree of colour-matching. A rich and diverse set of naturally occurring insects visited the flowers while we continuously video-recorded the spider's foraging activity. This enabled us to test the crypsis, the spider avoidance and the flower visitor attraction hypotheses, all three supported by previous studies. Flower visitors of different groups either avoided crab spiders independent of colour-matching, such as solitary bees and syrphid flies, or ignored them, such as bumble-bees and honeybees. Moreover, colour-matched spiders did not have a higher encounter rate and capture success compared to the visually apparent ones. Thus, our results support the spider avoidance hypothesis, reject the two other hypotheses and uncovered a fourth behaviour: indifference to predators. Because flower visitors reacted differently, a community approach is mandatory in order to understand the function of background colour-matching in generalist predators. We discuss our results in relation to the size and sociality of the prey and in relation to the functional significance of colour change in this predator.

Evolution of stenophagy in spiders (Araneae): evidence based on the comparative analysis of spider diets.

Science.gov (United States)

Pekár, Stano; Coddington, Jonathan A; Blackledge, Todd A

2012-03-01

Stenophagy (narrow diet breadth) represents an extreme of trophic specialization in carnivores, but little is known about the forces driving its evolution. We used spiders, the most diversified group of terrestrial predators, to investigate whether stenophagy (1) promoted diversification; (2) was phylogenetically conserved and evolutionarily derived state; and (3) was determined either by geographical distribution and foraging guild. We used published data on the prey of almost 600 species. Six categories of stenophagy were found: myrmecophagy, araneophagy, lepidopterophagy, termitophagy, dipterophagy, and crustaceophagy. We found that the species diversity of euryphagous genera and families was similar to stenophagous genera and families. At the family level, stenophagy evolved repeatedly and independently. Within families, the basal condition was oligophagy or euryphagy. Most types of stenophagy were clearly derived: myrmecophagy in Zodariidae; lepidopterophagy in Araneidae; dipterophagy in Theridiidae. In contrast, araneophagy was confined to basal and intermediate lineages, suggesting its ancestral condition. The diet breadth of species from the tropics and subtropics was less diverse than species from the temperate zone. Diet breadth was lower in cursorial spiders compared to web-building species. Thus, the evolution of stenophagy in spiders appears to be complex and governed by phylogeny as well as by ecological determinants. © 2011 The Author(s). Evolution© 2011 The Society for the Study of Evolution.

Three newly recorded Linyphiid spiders (Araneae: Linyphiidae from Korea

Directory of Open Access Journals (Sweden)

Sue Yeon Lee

2018-03-01

Full Text Available Three Linyphiid spiders, Caviphantes pseudosaxetorum Wunderlich, 1979, Erigone edentata Saito and Ono, 2001, and Savignia kawachiensis Oi, 1960, are reported for the first time from Korea with taxonomic illustrations and redescription. In this study, the genus Caviphantes Oi, 1960 is also newly recorded to Korean spider fauna.

First report of clinical presentation of a bite by a running spider ...

African Journals Online (AJOL)

This article describes the clinical progression of symptoms over a period of 5 days of a bite inflicted by a Philodromus sp. spider. Commonly known as 'running spiders', these are not considered to be harmful to humans. This report, however, is the first description of an actual bite by a member of this group of spiders ...

Web building and silk properties functionally covary among species of wolf spider.

Science.gov (United States)

Lacava, Mariángeles; Camargo, Arley; Garcia, Luis F; Benamú, Marco A; Santana, Martin; Fang, Jian; Wang, Xungai; Blamires, Sean J

2018-04-15

Although phylogenetic studies have shown covariation between the properties of spider major ampullate (MA) silk and web building, both spider webs and silks are highly plastic so we cannot be sure whether these traits functionally covary or just vary across environments that the spiders occupy. As MaSp2-like proteins provide MA silk with greater extensibility, their presence is considered necessary for spider webs to effectively capture prey. Wolf spiders (Lycosidae) are predominantly non-web building, but a select few species build webs. We accordingly collected MA silk from two web-building and six non-web-building species found in semirural ecosystems in Uruguay to test whether the presence of MaSp2-like proteins (indicated by amino acid composition, silk mechanical properties and silk nanostructures) was associated with web building across the group. The web-building and non-web-building species were from disparate subfamilies so we estimated a genetic phylogeny to perform appropriate comparisons. For all of the properties measured, we found differences between web-building and non-web-building species. A phylogenetic regression model confirmed that web building and not phylogenetic inertia influences silk properties. Our study definitively showed an ecological influence over spider silk properties. We expect that the presence of the MaSp2-like proteins and the subsequent nanostructures improves the mechanical performance of silks within the webs. Our study furthers our understanding of spider web and silk co-evolution and the ecological implications of spider silk properties. © 2018 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2018 European Society For Evolutionary Biology.

29 CFR 1926.550 - Cranes and derricks.

Science.gov (United States)

2010-07-01

... design or worksite conditions. (3) Cranes and derricks—(i) Operational criteria. (A) Hoisting of the... platform; and (D) The hoisting system shall be inspected if the load rope is slack to ensure all ropes are...

Cajun Maritime expands gas production platform with help from Liebherr crane

Energy Technology Data Exchange (ETDEWEB)

Anon.

2009-09-15

The South Marsh Island (SMI) Block 217 platform is a productive offshore natural gas handling hub in the Gulf of Mexico's Flatrock multiple reservoir deep-gas discovery. This one platform alone could increase natural gas production in the United States by 13 per cent. Louisiana-based Cajun Maritime LLC is the specialized marine subsidiary of the civil and mechanical contracting group Cajun Industries. The company focuses on maintaining a safe working environment at all times. The company purchased a new Liebherr LR 1300 lattice boom crawler crane for the Flatrock project because of its quality, lifting capacity and price. This article described the features of the crane that make it particularly suitable for offshore drilling, such as sealed bearings, big engine, high line pull, and the unique ability to move the main boom and luffing jib simultaneously while under load. The LR 1300 was used for several major installations, including pipelines, a new service crane and a water treatment deck platform. The safety features of the LR 1300 include a reeving winch which is used to install the lifting cables; the small diameter reeving winch cable is much easier to handle than the old method of hand pulling; and riggers are not required to walk the boom of the crane. The cab computer is useful in low overhead clearance work and completely removes the human error factor. The electronic hydraulic controls eliminate the risk of accidental load loss often associated with old-style friction cranes. 3 figs.

Stability Assessment as a Criterion of Stabilization of the Movement Trajectory of Mobile Crane Working Elements

Science.gov (United States)

Kacalak, W.; Budniak, Z.; Majewski, M.

2018-02-01

The article presents a stability assessment method of the mobile crane handling system based on the safety indicator values that were accepted as the trajectory optimization criterion. With the use of the mathematical model built and the model built in the integrated CAD/CAE environment, analyses were conducted of the displacements of the mass centre of the crane system, reactions of the outrigger system, stabilizing and overturning torques that act on the crane as well as the safety indicator values for the given movement trajectories of the crane working elements.

Drivers of inter-annual variation and long-term change in High-Arctic spider species abundances

DEFF Research Database (Denmark)

Bowden, Joseph J.; Hansen, Oskar L. P.; Olsen, Kent

2018-01-01

Understanding how species abundances vary in space and time is a central theme in ecology, yet there are few long-term field studies of terrestrial invertebrate abundances and the determinants of their dynamics. This is particularly relevant in the context of rapid climate change occurring...... in the Arctic. Arthropods can serve as strong indicators of ecosystem change due to their sensitivity to increasing temperatures and other environmental variables. We used spider samples collected by pitfall trapping from three different habitats (fen, mesic and arid heath) in High-Arctic Greenland to assess...... interpretation of long-term trends. We used model selection to determine which climatic variables and/or previous years’ abundance best explained annual variation in species abundances over this period. We identified and used 28 566 adult spiders that comprised eight species. Most notably, the abundances of some...

Spider (Araneae) predations on white-backed planthopper Sogatella furcifera in subtropical rice ecosystems, China.

Science.gov (United States)

Wang, Xue-Qin; Wang, Guang-Hua; Zhu, Zeng-Rong; Tang, Qi-Yi; Hu, Yang; Qiao, Fei; Heong, Kong Luen; Cheng, Jia-An

2017-06-01

Spiders are effective biological control agents in rice ecosystems, but the comparative study of predations among main spider species under field conditions has not been fully explored owing to a lack of practical methodology. In this study, more than 6000 spiders of dominant species were collected from subtropical rice ecosystems to compare their predations on Sogatella furcifera (Horváth) (white-backed planthopper, WBPH) using DNA-based gut content analysis. The positive rates for all spider taxa were closely related to prey densities, as well as their behaviors and niches. The relationships of positive rates to prey planthopper densities for Pardosa pseudoannulata (Böes. et Str.), Coleosoma octomaculata (Böes. et Str.), Tetragnatha maxillosa Thorell and Ummeliata insecticeps (Böes. et Str.) under field conditions could be described using saturated response curves. Quantitative comparisons of predations among the four spider species confirmed that P. pseudoannulata and C. octomaculata were more rapacious than U. insecticeps and T. maxillosa under field conditions. A comparison of ratio of spiders to WBPH and positive rates between fields revealed that biological control by spiders could be effectively integrated with variety resistance. Generalist spiders could follow up WBPH population timely, and assemblages of spiders coupled with variety resistance could effectively suppress WBPH population. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Spider Web Pattern

Science.gov (United States)

2006-01-01

A delicate pattern, like that of a spider web, appears on top of the Mars residual polar cap, after the seasonal carbon-dioxide ice slab has disappeared. Next spring, these will likely mark the sites of vents when the carbon-dioxide ice cap returns. This Mars Global Surveyor, Mars Orbiter Camera image is about 3-kilometers wide (2-miles).

PATHWAYS TO SPIDER PHOBIA

NARCIS (Netherlands)

MERCKELBACH, H; ARNTZ, A; ARRINDELL, WA; DEJONG, PJ

Using a revised version of the Phobic Origin Questionnaire (POQ; Ost, L. G. & Hugdahl, K. Behaviour Research and Therapy, 19,439-477; 1981), the present study examined whether conditioning experiences, modeling experiences, and/or informational learning experiences were more often reported by spider

Evolutionary morphology of the hemolymph vascular system of basal araneomorph spiders (Araneae: Araneomorphae).

Science.gov (United States)

Huckstorf, Katarina; Michalik, Peter; Ramírez, Martín; Wirkner, Christian S

2015-11-01

The superfamily Austrochiloidea (Austrochilidae and Gradungulidae) take a pivotal position in araneomorph spider phylogeny. In this discussion crevice weaver spiders (Filistatidae) are of equal interest. Especially data from these phylogenetically uncertain yet basal off branching groups can enlighten our understanding on the evolution of organ systems. In the course of a survey on the evolutionary morphology of the circulatory system in spiders we therefore investigated the hemolymph vascular system in two austrochiloid and one filistatid species. Additionally some data on a hypochilid and a gradungulid species are included. Using up-to-date morphological methods, the vascular systems in these spiders are visualized three dimensionally. Ground pattern features of the circulatory systems in austrochiloid spiders are presented and the data discussed along recent lines of phylogenetic hypotheses. Special topics highlighted are the intraspecific variability of the origins of some prosomal arteries and the evolutionary correlation of respiratory and circulatory systems in spiders. Copyright © 2015 Elsevier Ltd. All rights reserved.

Remote crane control techniques and closed-circuit television for the U.S. Department of Energy, Defense Waste Processing Facility

International Nuclear Information System (INIS)

DaSilva, D.A.

1988-01-01

The Defense Waste Processing Facility (DWPF) located at the Savannah River Plant (SRP), South Carolina is a nuclear waste facility being built to vitrify and containerize high level radioactive waste products. DWPF has a unique requirement for an unmanned crane system to install and replace equipment in the high humidity, high radiation and harsh chemical environment of permanently inaccessible processing cells. A radio control system is provided to control a 117 ton capacity bridge crane that is equipped with various power tools for remote handling of crane replaceable and maintained equipment. High resolution black and white closed circuit television (CTV) assemblies mounted on the crane and on the walls of the various processing cells are provided for viewing the equipment during normal operations and maintenance. The main process cell (MPC) crane is designed as the vehicle to be the eyes, ears and hands for remote in-cell operations and maintenance. The crane runs on elevated rails above the process cells. A trailer-like-electrical equipment compartment (EEC) containing control and radio communications equipment for the crane; is dragged along on rails in a heavily shielded corridor by a drag bar mounted to the crane. A two way RF system is the communications link for all control and video signals between the crane and two stationary crane control consoles

Design and Analysis of Cooperative Cable Parallel Manipulators for Multiple Mobile Cranes

Directory of Open Access Journals (Sweden)

Bin Zi

2012-11-01

Full Text Available The design, dynamic modelling, and workspace are presented in this paper concerning cooperative cable parallel manipulators for multiple mobile cranes (CPMMCs. The CPMMCs can handle complex tasks that are more difficult or even impossible for a single mobile crane. Kinematics and dynamics of the CPMMCs are studied on the basis of geometric methodology and d'Alembert's principle, and a mathematical model of the CPMMCs is developed and presented with dynamic simulation. The constant orientation workspace analysis of the CPMMCs is carried out additionally. As an example, a cooperative cable parallel manipulator for triple mobile cranes with 6 Degrees of Freedom is investigated on the basis of the above design objectives.

Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

Science.gov (United States)

Scheel, Matthew H; Edwards, Dori

2012-03-01

Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication. Copyright © 2012 Elsevier B.V. All rights reserved.

76 FR 55893 - Crane & Company; Notice of Application Accepted for Filing With the Commission, Intent To Waive...

Science.gov (United States)

2011-09-09

... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Project No. 13583-001] Crane & Company.... Date filed: March 9, 2011. d. Applicant: Crane & Company. e. Name of Project: Byron Weston... new 100-foot-long, 600-volt transmission line connected to the Crane & Company mill complex. The...

Decontamination of Savannah River Plant H-Area hot-canyon crane

International Nuclear Information System (INIS)

Rankin, W.N.; Sims, J.R.

1985-01-01

Decontamination techniques applicable to the remotely operated bridge cranes in canyon buildings at the Savannah River Plant (SRP) were identified and were evaluated in laboratory-scale tests. High pressure Freon blasting was found to be the most attractive process available for this application. Strippable coatings were selected as an alternative technique in selected applications. The ability of high pressure Freon blasting plus two strippable coatings (Quadcoat 100 and Alara 1146) to remove the type of contamination expected on SRP cranes was demonstrated in laboratory-scale tests. Quadrex HPS was given a contract to decontaminate the H-Area hot canyon crane. Decontamination operations were successfully carried out within the specified time-frame window. The radiation level goals specified by SRP were met and decontamination was accomplished with 85% less personnel exposure than estimated by SRP before the job started. This reduction is attributed to the increased efficiency of the new decontamination techniques used. 6 refs., 1 tab

Recombinant Spider Silks—Biopolymers with Potential for Future Applications

Directory of Open Access Journals (Sweden)

Thomas Scheibel

2011-03-01

Full Text Available Nature has evolved a range of materials that compete with man-made materials in physical properties; one of these is spider silk. Silk is a fibrous material that exhibits extremely high strength and toughness with regard to its low density. In this review we discuss the molecular structure of spider silk and how this understanding has allowed the development of recombinant silk proteins that mimic the properties of natural spider silks. Additionally, we will explore the material morphologies and the applications of these proteins. Finally, we will look at attempts to combine the silk structure with chemical polymers and how the structure of silk has inspired the engineering of novel polymers.

Slew Cranes in Shipyards: A Study

Science.gov (United States)

1985-01-01

yard in Germany and one in Malaysia , carried out the corrosion preventive shot blasting and repainting recommended by the manufacturers. The general...the guidance of Osha (USA) or VBG-9 (W. Germany) — it is up to. the operator, however, to use the crane safely. In ensuring operator safety, an owner

78 FR 33860 - Crawler, Locomotive, and Truck Cranes Standard; Extension of the Office of Management and Budget...

Science.gov (United States)

2013-06-05

...] Crawler, Locomotive, and Truck Cranes Standard; Extension of the Office of Management and Budget's (OMB... collection requirements contained in the General Industry Standard on Crawler, Locomotive, and Truck cranes... workers from using unsafe cranes and ropes, thereby reducing their risk of death or serious injury caused...

75 FR 20005 - Crawler, Locomotive, and Truck Cranes Standard; Extension of the Office of Management and Budget...

Science.gov (United States)

2010-04-16

...] Crawler, Locomotive, and Truck Cranes Standard; Extension of the Office of Management and Budget's (OMB... Crawler, Locomotive, and Truck Cranes Standard (29 CFR 1910.180). DATES: Comments must be submitted... of each of these requirements is to prevent workers from using unsafe cranes and ropes, thereby...

Dynamics and Embedded Internet of Things Input Shaping Control for Overhead Cranes Transporting Multibody Payloads

Directory of Open Access Journals (Sweden)

Gerardo Peláez

2018-06-01

Full Text Available Input shaping is an Optimal Control feedforward strategy whose ability to define how and when a flexible dynamical system defined by Ordinary Differential Equations (ODEs and computer controlled would move into its operative space, without command induced unwanted dynamics, has been exhaustively demonstrated. This work examines the issue of Embedded Internet of Things (IoT Input Shaping with regard to real time control of multibody oscillatory systems whose dynamics are better described by differential algebraic equations (DAEs. An overhead crane hanging a double link multibody payload has been appointed as a benchmark case; it is a multibody, multimode system. This might be worst scenario to implement Input Shaping. The reasons can be found in the wide array of constraints that arise. Firstly, the reliability of the multibody model was tested on a Functional Mock-Up Interface (FMI with the two link payload suspended from the trolley by comparing the experimental video tapping signals in time domain faced with the signals extracted from the multibody model. The FFTs of the simulated and the experimental signal contain the same frequency harmonics only with somewhat different power due to the real world light damping in the joints. The application of this approach may be extended to other cases i.e., the usefulness of mobile hydraulic cranes is limited because the payload is supported by an overhead cable under tension that allows oscillation to occur during crane motion. If the payload size is not negligible small when compared with the cable length may introduce an additional oscillatory mode that creates a multibody double pendulum. To give the insight into the double pendulum dynamics by Lagrangian methods two slender rods as payloads are analyzed dealing with the overhead crane and a composite revolute-revolute joint is proposed to model the cable of the hydraulic crane, both assumptions facilitates an affordable analysis. This allows

Dynamics and Embedded Internet of Things Input Shaping Control for Overhead Cranes Transporting Multibody Payloads.

Science.gov (United States)

Peláez, Gerardo; Vaugan, Joshua; Izquierdo, Pablo; Rubio, Higinio; García-Prada, Juan Carlos

2018-06-04

Input shaping is an Optimal Control feedforward strategy whose ability to define how and when a flexible dynamical system defined by Ordinary Differential Equations (ODEs) and computer controlled would move into its operative space, without command induced unwanted dynamics, has been exhaustively demonstrated. This work examines the issue of Embedded Internet of Things (IoT) Input Shaping with regard to real time control of multibody oscillatory systems whose dynamics are better described by differential algebraic equations (DAEs). An overhead crane hanging a double link multibody payload has been appointed as a benchmark case; it is a multibody, multimode system. This might be worst scenario to implement Input Shaping. The reasons can be found in the wide array of constraints that arise. Firstly, the reliability of the multibody model was tested on a Functional Mock-Up Interface (FMI) with the two link payload suspended from the trolley by comparing the experimental video tapping signals in time domain faced with the signals extracted from the multibody model. The FFTs of the simulated and the experimental signal contain the same frequency harmonics only with somewhat different power due to the real world light damping in the joints. The application of this approach may be extended to other cases i.e., the usefulness of mobile hydraulic cranes is limited because the payload is supported by an overhead cable under tension that allows oscillation to occur during crane motion. If the payload size is not negligible small when compared with the cable length may introduce an additional oscillatory mode that creates a multibody double pendulum. To give the insight into the double pendulum dynamics by Lagrangian methods two slender rods as payloads are analyzed dealing with the overhead crane and a composite revolute-revolute joint is proposed to model the cable of the hydraulic crane, both assumptions facilitates an affordable analysis. This allows developing a general

Impact of prescribed burning on a heathland inhabiting spider community

Directory of Open Access Journals (Sweden)

Krause, Rolf Harald

2016-04-01

Full Text Available Heathlands can provide refuge for many stenotopic and endangered arthropods, if habitat management practices are applied. A management measure that is rarely being used today, but which has the potential to support diversity of arthropod communities, is prescribed burning. In this study we investigated the effects of prescribed burning on spider assemblages on a burned site with Calluna vulgaris in the nature reserve Lueneburg Heath, northwest Germany. We used pitfall trapping with a sampling design of 39 traps over a period of one year and 17 sampling intervals on a burned and a control site. We compared overall species richness, activity abundance patterns and community composition of the two sites, with a particular focus on stenotopic and endangered species. We collected 5116 adult spiders and 99 species altogether in a relatively small sampling area. This number of species represents nearly one third of the regional species pool of heathland spider species. Twelve species occurred exclusively on the burned site in contrast to 28 species exclusively found on the unburned site. Although we found more than twice as many spider individuals and higher mean species richness on the control site than on the burned site, the species richness of red-listed spiders was higher on the burned site. Especially the fact that we found 24 endangered species on the burned site and only 20 on the control site indicates that the applied measure of prescribed burning can foster certain endangered spider species and contribute to preserving the overall biodiversity of heathland ecosystems.

Diseases of whooping cranes seen during annual migration of the Rocky Mountain flock

Science.gov (United States)

Snyder, S. Bret; Richard, Michael J.; Drewien, Roderick C.; Thomas, Nancy J.; Thilsted, John P.; Junge, Randall E.

1991-01-01

Diagnosis and treatment of ill whooping cranes of the Rocky Mountain flock was provided by a zoological facility. Cases of avian cholera, lead poisoning and avian tuberculosis were encountered. The zoo efforts were an adjunct to the U.S. Fish and Wildlife Service, Whooping Crane Recovery Plan.

A reliability analysis framework with Monte Carlo simulation for weld structure of crane's beam

Science.gov (United States)

Wang, Kefei; Xu, Hongwei; Qu, Fuzheng; Wang, Xin; Shi, Yanjun

2018-04-01

The reliability of the crane product in engineering is the core competitiveness of the product. This paper used Monte Carlo method analyzed the reliability of the weld metal structure of the bridge crane whose limit state function is mathematical expression. Then we obtained the minimum reliable welding feet height value for the welds between cover plate and web plate on main beam in different coefficients of variation. This paper provides a new idea and reference for the growth of the inherent reliability of crane.

Synthetic Spider Silk Production on a Laboratory Scale

Science.gov (United States)

Hsia, Yang; Gnesa, Eric; Pacheco, Ryan; Kohler, Kristin; Jeffery, Felicia; Vierra, Craig

2012-01-01

As society progresses and resources become scarcer, it is becoming increasingly important to cultivate new technologies that engineer next generation biomaterials with high performance properties. The development of these new structural materials must be rapid, cost-efficient and involve processing methodologies and products that are environmentally friendly and sustainable. Spiders spin a multitude of different fiber types with diverse mechanical properties, offering a rich source of next generation engineering materials for biomimicry that rival the best manmade and natural materials. Since the collection of large quantities of natural spider silk is impractical, synthetic silk production has the ability to provide scientists with access to an unlimited supply of threads. Therefore, if the spinning process can be streamlined and perfected, artificial spider fibers have the potential use for a broad range of applications ranging from body armor, surgical sutures, ropes and cables, tires, strings for musical instruments, and composites for aviation and aerospace technology. In order to advance the synthetic silk production process and to yield fibers that display low variance in their material properties from spin to spin, we developed a wet-spinning protocol that integrates expression of recombinant spider silk proteins in bacteria, purification and concentration of the proteins, followed by fiber extrusion and a mechanical post-spin treatment. This is the first visual representation that reveals a step-by-step process to spin and analyze artificial silk fibers on a laboratory scale. It also provides details to minimize the introduction of variability among fibers spun from the same spinning dope. Collectively, these methods will propel the process of artificial silk production, leading to higher quality fibers that surpass natural spider silks. PMID:22847722

SPIDERS (ARANEI OF THE REPUBLIC OF SOUTH OSSETIA

Directory of Open Access Journals (Sweden)

Alexander V. Ponomarev

2015-01-01

Full Text Available Aim. Until recently, spider fauna of the Republic of South Ossetia has been the least studied among the regional araneofaunas of the Caucasus. According to the literature data, as little as 30 spider species have been known from the republic’s territory (Mkheidze, 1997, Mikhailov, 1990; Ponomarev, Dvadnenko, 2013; Trilicauscas, Komarov, 2014. Therefore, the aim of the present article is to summarize available data on the spider fauna of South Ossetia.Location. Republic of South Ossetia.Methods. The material was collected in various districts of South Ossetia in 2011-2014 by Yu.E. Komarov. Mainly, the collecting was performed in the city of Tskhinvali and its environs, and in the South Ossetian State Reserve. Spiders were sampled with pitfall traps and sweep netting. The time of traps’ exposure is April–December.Results and main conclusions. To date, the spider fauna of the Republic of South Ossetia includes 230 species from 29 families. 222 species were registered by the authors, eight species (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus are known from the literature only. Seven species are new to the Caucasus (Clubiona pseudosimilis, Gnaphosa lugubris, Linyphia hortensis, Neriene peltata, Geolycosa vultuosa, Pardosa azerifalcata, Ero aphana, and Philodromus rufus. Of these, two species were known earlier only from Turkey (Pardosa consimilis, Ozyptila spirembolus, and one species (Tegenaria pseudolyncea only from Azerbaijan. Against the background of the widespread species predominance, the Caucasian element is small and presented by twelve species (Tegenaria pseudolyncea, Dysdera tkibuliensis, Haplodrassus caucasius, Zelotes khostensis, Mansuphantes ovalis, Sintula oseticus, Tenuiphantes teberdaensis, Pardosa azerifalcata, P. caucasica, Piratula hurkai, Trochosa cachetiensis, and Xysticus ukrainicus.

Spider mite control and resistance management: does a genome help?

NARCIS (Netherlands)

Van Leeuwen, T.; Dermauw, W.; Grbic, M.; Tirry, L.; Feyereisen, R.

2012-01-01

The complete genome of the two-spotted spider mite, Tetranychus urticae, has been reported. This is the first sequenced genome of a highly polyphagous and resistant agricultural pest. The question as to what the genome offers the community working on spider mite control is addressed.

The Gravity Probe B Payload Hoisted by Crane

Science.gov (United States)

2001-01-01

The Gravity Probe B (GP-B) payload was hoisted by crane to the transportation truck in the W.W. Hansen Experimental Physics Laboratory in Stanford, California for shipment to the launch site at Vandenburg Air Force Base. GP-B is the relativity experiment being developed at Stanford University to test two extraordinary predictions of Albert Einstein's general theory of relativity. The experiment will measure, very precisely, the expected tiny changes in the direction of the spin axes of four gyroscopes contained in an Earth-orbiting satellite at a 400-mile altitude. So free are the gyroscopes from disturbance that they will provide an almost perfect space-time reference system. They will measure how space and time are very slightly warped by the presence of the Earth, and, more profoundly, how the Earth's rotation very slightly drags space-time around with it. These effects, though small for the Earth, have far-reaching implications for the nature of matter and the structure of the Universe. GP-B is among the most thoroughly researched programs ever undertaken by NASA. This is the story of a scientific quest in which physicists and engineers have collaborated closely over many years. Inspired by their quest, they have invented a whole range of technologies that are already enlivening other branches of science and engineering. Launched April 20, 2004, the GP-B program was managed for NASA by the Marshall Space Flight Center. Development of the GP-B is the responsibility of Stanford University, along with major subcontractor Lockheed Martin Corporation. (Photo Credit: Stanford University)

Multi-scale analysis to uncover habitat use of red-crowned cranes: Implications for conservation

Directory of Open Access Journals (Sweden)

Chunyue LIU, Hongxing JIANG, Shuqing ZHANG, Chunrong LI,Yunqiu HOU, Fawen QIAN

2013-10-01

Full Text Available A multi-scale approach is essential to assess the factors that limit avian habitat use. Numerous studies have examined habitat use by the red-crowned crane, but integrated multi-scale habitat use information is lacking. We evaluated the effects of several habitat variables quantified across many spatial scales on crane use and abundance in two periods (2000 and 2009 at Yancheng National Nature Reserve, China. The natural wetlands decreased in area by 30,601 ha (-6.9% from 2000 to 2009, predominantly as a result of conversion to aquaculture ponds and farmland, and the remaining was under degradation due to expansion of the exotic smooth cordgrass. The cranes are focusing in on either larger patches or those that are in close proximity to each other in both years, but occupied patches had smaller size, less proximity and more regular boundaries in 2009. At landscape scales, the area percentage of common seepweed, reed ponds and paddy fields had a greater positive impact on crane presence than the area percentage of aquaculture ponds. The cranes were more abundant in patches that had a greater percent area of common seepweed and reed ponds, while the percent area of paddy fields was inversely related to crane abundance in 2009 due to changing agricultural practices. In 2009, cranes tended to use less fragmented plots in natural wetlands and more fragmented plots in anthropogenic paddy fields, which were largely associated with the huge loss and degradation of natural habitats between the two years. Management should focus on restoration of large patches of natural wetlands, and formation of a relatively stable area of large paddy field and reed pond to mitigate the loss of natural wetlands [Current Zoology 59 (5: 604–617, 2013].

Development of small-size transmission tower erection method; Kogata tetto kumitate koho no kaihatsu kenkyu (gaibushiki crane ni yoru kogata tetto kumitate koho no kaihatsu)

Energy Technology Data Exchange (ETDEWEB)

Matsuishi, S.; Asano, J.; Koji, Y. [Kansai Electric Power Co. Inc., Osaka (Japan); Tsujimura, I.; Teramoto, A. [The Kanden Kogyo Incorporated, Osaka (Japan); Sasaki, T.; Mito, K. [AG Ajikawa Corp., Osaka (Japan); Tsuji, M.; Fukumoto, T.; Yamaguchi, N.

1997-09-30

To reduce the construction period and cost and to enhance the safety during 77 kV-class transmission tower election, a new method of small steel transmission tower erection using an external type crane has been developed. For the selection of cranes, a commercially available self-climbing crane was employed which has an operating radius of 11 m, a lifting load capacity of 1.5 t, and a lift of up to 60 m. For the space analysis using a model tower, various supporting methods with horizontal supporting members, stress analysis for each tower stub, and apparatuses were examined. For the demonstration tests of election using the model tower, strain gages were attached at each point of steel tower, crane and horizontal supporting members, to measure the stress of members at each stage of the election. It was confirmed that there were no problems. For the election of actual steel tower, the practicality of this method was compared with that of conventional methods. The construction period was reduced in 20%, and the cost was reduced in 4%. The safety of this method was drastically enhanced due to the lack of moving on the tower and less manual operation. 9 figs., 1 tab.

Intersexual Trophic Niche Partitioning in an Ant-Eating spider (Araneae: Zodariidae)

DEFF Research Database (Denmark)

Pekár, Stanislav; Martisová, Martina; Bilde, T.

2011-01-01

lead to higher energy demands in females driven by fecundity selection, while males invest in mate searching. We tested predictions of the two hypotheses underlying intersexual trophic niche partitioning in a natural population of spiders. Zodarion jozefienae spiders specialize on Messor barbarus ants...... that are polymorphic in body size and hence comprise potential trophic niches for the spider, making this system well-suited to study intersexual trophic niche partitioning. Methodology/Principal Findings Comparative analysis of trophic morphology (the chelicerae) and body size of males, females and juveniles...... demonstrated highly female biased SSD (Sexual Size Dimorphism) in body size, body weight, and in the size of chelicerae, the latter arising from sex-specific growth patterns in trophic morphology. In the field, female spiders actively selected ant sub-castes that were larger than the average prey size...

The design of steel string crane with lifting capacity 10 tons

International Nuclear Information System (INIS)

Syamsurrijal Ramdja

2007-01-01

The steel string (sling) used for lift Crane of type of Overhead Travelling Crane, with capacities lifting 10 ton are designed. If compared to other string type, string of steel have some excellence. At this design, election of type of string become primary and the factor of safety become prima facie matter with pursuant to up to date standard. From made of design, is hence got by specification and age of steel string. (author)

Association of spiders and lichen on Robben Island, South Africa: a case report

Directory of Open Access Journals (Sweden)

A. Mukherjee

2010-04-01

Full Text Available The present study is a firstrecord of spider occurrence on Robben Island, South Africa. Some habitats were rich in lichens. As we know, lichens enhance wildlife habitat in less direct ways. The objective of the study was to examine the potential importance of lichens in enriching spider diversity and abundance. A total of 260 spiders (170 from lichens and 90 from bush were collected following the visual search method over one year. Seasonal trends in overall species richness and abundance indicated that the relative density of spiders was greater in lichens than in bushes. The result suggests that habitat structure, such as branch size and epiphytic lichen abundance, can be an explanation for the greater number of spiders in lichen-rich patches of the island.

Are whooping cranes destined for extinction? Climate change imperils recruitment and population growth.

Science.gov (United States)

Butler, Matthew J; Metzger, Kristine L; Harris, Grant M

2017-04-01

Identifying climatic drivers of an animal population's vital rates and locating where they operate steers conservation efforts to optimize species recovery. The population growth of endangered whooping cranes ( Grus americana ) hinges on juvenile recruitment. Therefore, we identify climatic drivers (solar activity [sunspots] and weather) of whooping crane recruitment throughout the species' life cycle (breeding, migration, wintering). Our method uses a repeated cross-validated absolute shrinkage and selection operator approach to identify drivers of recruitment. We model effects of climate change on those drivers to predict whooping crane population growth given alternative scenarios of climate change and solar activity. Years with fewer sunspots indicated greater recruitment. Increased precipitation during autumn migration signified less recruitment. On the breeding grounds, fewer days below freezing during winter and more precipitation during breeding suggested less recruitment. We predicted whooping crane recruitment and population growth may fall below long-term averages during all solar cycles when atmospheric CO 2 concentration increases, as expected, to 500 ppm by 2050. Species recovery during a typical solar cycle with 500 ppm may require eight times longer than conditions without climate change and the chance of population decline increases to 31%. Although this whooping crane population is growing and may appear secure, long-term threats imposed by climate change and increased solar activity may jeopardize its persistence. Weather on the breeding grounds likely affects recruitment through hydrological processes and predation risk, whereas precipitation during autumn migration may influence juvenile mortality. Mitigating threats or abating climate change should occur within ≈30 years or this wild population of whooping cranes may begin declining.

Programming spiders, bots, and aggregators in Java

CERN Document Server

Heaton, Jeff

2006-01-01

The content and services available on the web continue to be accessed mostly through direct human control. But this is changing. Increasingly, users rely on automated agents that save them time and effort by programmatically retrieving content, performing complex interactions, and aggregating data from diverse sources. Programming Spiders, Bots, and Aggregators in Java teaches you how to build and deploy a wide variety of these agents-from single-purpose bots to exploratory spiders to aggregators that present a unified view of information from multiple user accounts. You will quickly build on

Recombinant DNA production of spider silk proteins.

Science.gov (United States)

Tokareva, Olena; Michalczechen-Lacerda, Valquíria A; Rech, Elíbio L; Kaplan, David L

2013-11-01

Spider dragline silk is considered to be the toughest biopolymer on Earth due to an extraordinary combination of strength and elasticity. Moreover, silks are biocompatible and biodegradable protein-based materials. Recent advances in genetic engineering make it possible to produce recombinant silks in heterologous hosts, opening up opportunities for large-scale production of recombinant silks for various biomedical and material science applications. We review the current strategies to produce recombinant spider silks. © 2013 The Authors. Microbial Biotechnology published by John Wiley & Sons Ltd and Society for Applied Microbiology.